Protein Family IF11203
Metagenome
Isolate
271
Members
232
Samples
64
Scaffolds
326.71
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2630968413|2631703428|
- Length
- 344 aa
- Sequence
- MYLVKCSQIDSKVTDKMPNNPFNVFDYEDIQLIPQKCILEHRHQAQTSVQLGNYTFQIPVVPANMASVIDEKLAVWLAQNNYFYIMHRFTPQTRFNFVQKMHQQQLYASISVGVQKADYELIDQLVQAHLTPAFITIDIAHGYAPSVQHMIQYIKTYLPQSFVIAGNVATPEAVHFLEDAGADATKVGIGPGRACITKIKTGFGTAGWQLAAVRMCAKAANKPVIADGGIRTNGDIAKSLRFGAQMVMIGSLLAGHDENPGEIRQKNGQKVKVYFGSASEMQKGERKNIEGKAITVPYRGSIKTTLREMKEDLQSAISYAGGRNLADLRKVNYVILKNSIYNGD
Sample Types
Isolate
76.4%
Metagenome
23.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.4%
Apidae
20.1%
Drosophilidae
13.6%
Halictidae
4.2%
Scarabaeidae
4.2%
Tenebrionidae
3.3%
Pyralidae
2.8%
Termitidae
2.8%
Elmidae
1.9%
Blattidae
1.9%
Formicidae
1.9%
Rhinotermitidae
1.4%
Bombycidae
1.4%
Kalotermitidae
1.4%
Passalidae
0.9%
Hydrophilidae
0.9%
Dytiscidae
0.9%
Ixodidae
0.9%
Vespidae
0.5%
Hodotermitidae
0.5%
Ocypodidae
0.5%
Gomphidae
0.5%
Portunidae
0.5%
Penaeidae
0.5%
Curculionidae
0.5%
Euphausiidae
0.5%
Libellulidae
0.5%
Noctuidae
0.5%
Eresidae
0.5%
Culicidae
0.5%
Syrphidae
0.5%
Taxonomy
Archaea
0
Bacteria
262
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 3 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 4 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 5 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 6 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 7 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 8 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 9 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 10 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 11 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 12 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 13 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 14 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 15 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 16 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 17 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 18 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 19 | 2597490379 | Entomoplasma freundtii ATCC 51999 | Isolate | Unclassified |
| 20 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 21 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 22 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 23 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 24 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 29 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 30 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 31 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 32 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 33 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 34 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 35 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 36 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 37 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 38 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 39 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 40 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 41 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 42 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 43 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 44 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 45 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 46 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 47 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 48 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 49 | 2540341224 | Williamsoniiplasma luminosum ATCC 49195 | Isolate | Unclassified |
| 50 | 2545824514 | Entomoplasma somnilux ATCC 49194 | Isolate | Unclassified |
| 51 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 52 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 53 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 54 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 55 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 56 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 57 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 58 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 62 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 63 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 64 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 65 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 66 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 67 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 68 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 69 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 70 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 71 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 72 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 73 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 74 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 75 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 76 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 77 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 78 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 79 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 80 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 81 | 2540341223 | Entomoplasma lucivorax ATCC 49196 | Isolate | Unclassified |
| 82 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 83 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 84 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 85 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 86 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 87 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 88 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 89 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 90 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 91 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 92 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 93 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 94 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 95 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 96 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 97 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 98 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 99 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 100 | 8067289520 | Spiroplasma poulsonii MSRO_BK | Isolate | Drosophilidae |
| 101 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 102 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 103 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 104 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 105 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 106 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 107 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 108 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 109 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 110 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 111 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 112 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 113 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 114 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 115 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 116 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 117 | 2806310699 | Spiroplasma melliferum KC3 | Isolate | Unclassified |
| 118 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 119 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 120 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 121 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 122 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 123 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 124 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 125 | 8100315503 | Spiroplasma sp. hyd1 | Isolate | Drosophilidae |
| 126 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 127 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 128 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 129 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 130 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 131 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 132 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 133 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 134 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 135 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 136 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 137 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 138 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 139 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 140 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 141 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 142 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 143 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 144 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 145 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 146 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 147 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 148 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 149 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 150 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 151 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 152 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 153 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 154 | 8100317081 | Spiroplasma sp. Moj | Isolate | Drosophilidae |
| 155 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 156 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 157 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 158 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 159 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 160 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 161 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 162 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 163 | 2558860181 | Spiroplasma mirum ATCC 29335 | Isolate | Ixodidae |
| 164 | 2558860251 | Spiroplasma mirum SMCA | Isolate | Ixodidae |
| 165 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 166 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 167 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 168 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 169 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 170 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 171 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 172 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 173 | 2802429587 | Spiroplasma eriocheiris CCTCC 'M 207170' | Isolate | Unclassified |
| 174 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 175 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 176 | 8076013101 | Spiroplasma poulsonii sHy/REF | Isolate | Drosophilidae |
| 177 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 178 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 179 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 180 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 181 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 182 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 183 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 184 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 185 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 186 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 187 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 188 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 189 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 190 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 191 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 192 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 193 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 194 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 195 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 196 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 197 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 198 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 199 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 200 | 2554235371 | Spiroplasma chrysopicola DF-1 | Isolate | Unclassified |
| 201 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 202 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 203 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 204 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 205 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 206 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 207 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 208 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 209 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 210 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 211 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 212 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 213 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 214 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 215 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 216 | 2541047151 | Spiroplasma melliferum IPMB4A | Isolate | Apidae |
| 217 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 218 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 219 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 220 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 221 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 222 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 223 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 224 | 2554235381 | Spiroplasma syrphidicola EA-1 | Isolate | Syrphidae |
| 225 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 226 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 227 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 228 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 229 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 230 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 231 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 232 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0067 | 3300056790 | Bacteria | 439269 |
| 2 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 3 | Ga0562379_0083 | 3300056790 | Bacteria | 343504 |
| 4 | Ga0562379_0570 | 3300056790 | Unclassified | 68502 |
| 5 | Ga0562377_0524 | 3300056842 | Bacteria | 60333 |
| 6 | Ga0562376_3762 | 3300056857 | Unclassified | 14517 |
| 7 | HBC_ctgsDRAFT_1001797 | 3300000333 | Bacteria | 4734 |
| 8 | CVPL010L_1001268 | 3300002932 | Unclassified | 6780 |
| 9 | Ga0466706_288741 | 3300042599 | Bacteria | 19647 |
| 10 | Ga0562379_0329 | 3300056790 | Unclassified | 116324 |
| 11 | Ga0562379_1885 | 3300056790 | Bacteria | 20576 |
| 12 | Ga0562375_0519 | 3300056856 | Bacteria | 78358 |
| 13 | Ga0562374_0028 | 3300057007 | Bacteria | 792277 |
| 14 | Ga0074278_126890 | 3300005721 | Bacteria | 7339 |
| 15 | Ga0466707_046753 | 3300042601 | Bacteria | 41362 |
| 16 | Ga0562379_0064 | 3300056790 | Bacteria | 452272 |
| 17 | Ga0562379_1197 | 3300056790 | Bacteria | 32293 |
| 18 | Ga0562377_0250 | 3300056842 | Unclassified | 123161 |
| 19 | Ga0562376_0897 | 3300056857 | Bacteria | 46908 |
| 20 | Ga0063521_1000086 | 3300003973 | Bacteria | 78064 |
| 21 | Ga0466724_52280 | 3300042649 | Bacteria | 15665 |
| 22 | Ga0255572_1006303 | 3300026175 | Bacteria | 4281 |
| 23 | Ga0466700_250676 | 3300042600 | Bacteria | 8514 |
| 24 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 25 | Ga0562375_0058 | 3300056856 | Bacteria | 444736 |
| 26 | Ga0562375_0214 | 3300056856 | Bacteria | 160982 |
| 27 | Ga0562374_0895 | 3300057007 | Bacteria | 41453 |
| 28 | 2227108586 | 2225789004 | Bacteria | 37815 |
| 29 | HBC_ctgsDRAFT_1031128 | 3300000333 | Unclassified | 1312 |
| 30 | Ga0466711_461512 | 3300042615 | Bacteria | 1461 |
| 31 | Ga0466728_164757 | 3300042620 | Bacteria | 27834 |
| 32 | Ga0466713_093617 | 3300042602 | Bacteria | 168801 |
| 33 | Ga0562379_0031 | 3300056790 | Bacteria | 758933 |
| 34 | IMNBL1DRAFT_c0006592 | 3300000062 | Bacteria | 6308 |
| 35 | Ga0466706_166041 | 3300042599 | Bacteria | 2721 |
| 36 | Ga0562379_0259 | 3300056790 | Bacteria | 138507 |
| 37 | Ga0562377_1700 | 3300056842 | Bacteria | 20795 |
| 38 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 39 | Ga0562375_0163 | 3300056856 | Bacteria | 195962 |
| 40 | Ga0562374_0004 | 3300057007 | Bacteria | 3025848 |
| 41 | Ga0562374_0007 | 3300057007 | Bacteria | 2074405 |
| 42 | Ga0562374_0488 | 3300057007 | Bacteria | 66637 |
| 43 | HBC_ctgsDRAFT_1024609 | 3300000333 | Unclassified | 1476 |
| 44 | Ga0466692_108689 | 3300042591 | Bacteria | 1289 |
| 45 | Ga0466706_177911 | 3300042599 | Bacteria | 2786 |
| 46 | Ga0562379_0049 | 3300056790 | Bacteria | 522222 |
| 47 | Ga0562377_2292 | 3300056842 | Bacteria | 14940 |
| 48 | Ga0562375_0052 | 3300056856 | Bacteria | 465920 |
| 49 | Ga0562374_0015 | 3300057007 | Bacteria | 1219565 |
| 50 | Ga0562374_0025 | 3300057007 | Bacteria | 941399 |
| 51 | Ga0466730_031628 | 3300042625 | Unclassified | 3259 |
| 52 | Ga0466733_052227 | 3300042659 | Bacteria | 1752 |
| 53 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 54 | Ga0562379_0006 | 3300056790 | Bacteria | 2459409 |
| 55 | Ga0562379_0028 | 3300056790 | Bacteria | 775176 |
| 56 | Ga0562377_0010 | 3300056842 | Bacteria | 1401665 |
| 57 | Ga0562377_0063 | 3300056842 | Bacteria | 461046 |
| 58 | Ga0562377_0760 | 3300056842 | Unclassified | 44622 |
| 59 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 60 | 2212037353 | 2209111004 | Bacteria | 83381 |
| 61 | Ga0466715_377450 | 3300042616 | Bacteria | 21328 |
| 62 | Ga0466729_016360 | 3300042621 | Bacteria | 4192 |
| 63 | Ga0466706_034455 | 3300042599 | Bacteria | 5208 |
| 64 | Ga0466706_086445 | 3300042599 | Bacteria | 4153 |
Family Sequences
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00478 | GO:0003824 | catalytic activity | MF |
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
| PF03060 | GO:0018580 | nitronate monooxygenase activity | MF |
| PF01070 | GO:0016491 | oxidoreductase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.