Protein Family IF11177
Metagenome
Isolate
155
Members
114
Samples
108
Scaffolds
343.33
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2603880172|2606033649|
- Length
- 385 aa
- Sequence
- MQRLIQRLMQRFPTPYKNRNNRLAYNRAMSLLTHSYPLIRPALFALEPEAAHDLTLATLQRAYDCALTRGVLQTRPEYPTTLMGLPLANPVGLAAGLDKNGAHVDALGNLGFGFIEVGTVTPRAQAGNPKPRLFRLPRAQALINRLGFNNQGLDAFIANVSRQRHWRDQGGVLGLNIGKNADTPMAAATDDYLLGLSGVYPHADYVTVNISSPNTQNLRALQSGDALALLLAALQARRTALAQQYGRRVPMAVKIAPDLDDAQIDAIADALPRFEVDGVIATNTTLTRAAVASQPHANEAGGLSGAPVHELSLRVIARLRQRLGPQMAIIGVGGIMSGRCAQEKIAAGADAVQLYTGLIYRGPGLIGECVAALNNAALQNAATSV
Sample Types
Isolate
30.3%
Metagenome
69.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
16.8%
Elmidae
15.9%
Unclassified
14.0%
Formicidae
10.3%
Curculionidae
9.3%
Culicidae
7.5%
Kalotermitidae
7.5%
Armadillidiidae
4.7%
Rhinotermitidae
3.7%
Drosophilidae
3.7%
Noctuidae
0.9%
Crambidae
0.9%
Apidae
0.9%
Termopsidae
0.9%
Trigoniulidae
0.9%
Pediculidae
0.9%
Siricidae
0.9%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 3 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 4 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 5 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 6 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 7 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 17 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 18 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 19 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 20 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 21 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 22 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 23 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 24 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 26 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 30 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 31 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 32 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 33 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 39 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 40 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 41 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 42 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 43 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 44 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 45 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 46 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 47 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 50 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 51 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 52 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 53 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 54 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 55 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 58 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 63 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 64 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 65 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 66 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 67 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 68 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 69 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 70 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 71 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 74 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 75 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 76 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 77 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 78 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 79 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 80 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 81 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 82 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 83 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 84 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 85 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 86 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 87 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 88 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 89 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 90 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 93 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 94 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 95 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 96 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 97 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 98 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 99 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 100 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 101 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 102 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 103 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 104 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 105 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 106 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 107 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 108 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 109 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 110 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 111 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 112 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 113 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 114 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_231910 | 3300042616 | Bacteria | 8354 |
| 2 | Ga0466690_297639 | 3300042590 | Bacteria | 53281 |
| 3 | Ga0123356_10019486 | 3300010049 | Unclassified | 6431 |
| 4 | Ga0466734_101683 | 3300042623 | Bacteria | 7232 |
| 5 | Ga0466725_129448 | 3300042654 | Bacteria | 92830 |
| 6 | DPOL_contig03111 | 2035918003 | Unclassified | 10895 |
| 7 | DPOL_contig13582 | 2035918003 | Unclassified | 17173 |
| 8 | JGI24702J35022_10001337 | 3300002462 | Bacteria | 15330 |
| 9 | JGI24705J35276_12238454 | 3300002504 | Bacteria | 22621 |
| 10 | CVPL010W_10000504 | 3300002931 | Bacteria | 64250 |
| 11 | CVPL010W_10008505 | 3300002931 | Bacteria | 22696 |
| 12 | Ga0102736_1003158 | 3300007052 | Bacteria | 2467 |
| 13 | Ga0103266_1005970 | 3300007067 | Bacteria | 1550 |
| 14 | Ga0102739_1001633 | 3300007095 | Bacteria | 3649 |
| 15 | Ga0102740_1000570 | 3300007140 | Bacteria | 10113 |
| 16 | Ga0103264_1000085 | 3300007188 | Bacteria | 60514 |
| 17 | Ga0103264_1000142 | 3300007188 | Bacteria | 41822 |
| 18 | Ga0123357_10000102 | 3300009784 | Bacteria | 70798 |
| 19 | Ga0466700_421379 | 3300042600 | Bacteria | 4529 |
| 20 | Ga0160432_101000 | 3300012818 | Unclassified | 11290 |
| 21 | Ga0160458_100878 | 3300012832 | Unclassified | 8279 |
| 22 | Ga0160457_1000644 | 3300012858 | Bacteria | 13578 |
| 23 | Ga0160436_1009382 | 3300012861 | Unclassified | 2163 |
| 24 | Ga0466657_260419 | 3300042582 | Bacteria | 11337 |
| 25 | Ga0466692_044873 | 3300042591 | Bacteria | 14691 |
| 26 | Ga0123353_10001679 | 3300010167 | Unclassified | 27229 |
| 27 | Ga0466704_221815 | 3300042643 | Bacteria | 33662 |
| 28 | Ga0466724_16129 | 3300042649 | Bacteria | 67631 |
| 29 | CVPL010W_10002041 | 3300002931 | Bacteria | 23733 |
| 30 | Ga0103264_1000078 | 3300007188 | Bacteria | 147291 |
| 31 | Ga0103264_1027924 | 3300007188 | Bacteria | 2644 |
| 32 | Ga0105005_1018910 | 3300007505 | Unclassified | 3281 |
| 33 | Ga0466701_101824 | 3300042598 | Bacteria | 199707 |
| 34 | Ga0160431_108138 | 3300012828 | Unclassified | 1442 |
| 35 | Ga0160460_100116 | 3300012845 | Bacteria | 103531 |
| 36 | Ga0160433_100150 | 3300012846 | Bacteria | 60169 |
| 37 | Ga0466731_233567 | 3300042622 | Bacteria | 3033 |
| 38 | Ga0466730_012524 | 3300042625 | Bacteria | 88124 |
| 39 | Ga0466730_089293 | 3300042625 | Bacteria | 1716 |
| 40 | SPBB_contig01065 | 2044078006 | Bacteria | 81840 |
| 41 | CVPL005L_10003373 | 3300002938 | Bacteria | 17842 |
| 42 | Ga0103265_1005553 | 3300007068 | Bacteria | 1734 |
| 43 | Ga0102737_1000030 | 3300007142 | Bacteria | 40501 |
| 44 | Ga0103264_1000096 | 3300007188 | Bacteria | 65851 |
| 45 | Ga0105008_1091214 | 3300007507 | Bacteria | 2961 |
| 46 | Ga0466717_014453 | 3300042604 | Bacteria | 9937 |
| 47 | Ga0466733_185417 | 3300042659 | Bacteria | 37806 |
| 48 | Ga0160440_100437 | 3300012815 | Unclassified | 14637 |
| 49 | Ga0160432_100574 | 3300012818 | Unclassified | 21330 |
| 50 | Ga0160456_100026 | 3300012820 | Bacteria | 249592 |
| 51 | Ga0160455_100420 | 3300012837 | Unclassified | 23007 |
| 52 | Ga0160472_100364 | 3300012839 | Unclassified | 40345 |
| 53 | Ga0466657_118287 | 3300042582 | Bacteria | 11939 |
| 54 | Ga0466657_385949 | 3300042582 | Bacteria | 41593 |
| 55 | Ga0123353_10244342 | 3300010167 | Bacteria | 2786 |
| 56 | Ga0466730_091811 | 3300042625 | Bacteria | 6811 |
| 57 | Ga0466703_125050 | 3300042636 | Bacteria | 41270 |
| 58 | Ga0466709_127110 | 3300042648 | Bacteria | 13816 |
| 59 | Ga0466724_29955 | 3300042649 | Bacteria | 45782 |
| 60 | FGTW_contig30532 | 2065487013 | Unclassified | 11583 |
| 61 | Meta3P_1004379 | 3300002464 | Unclassified | 9883 |
| 62 | Ga0103266_1001972 | 3300007067 | Bacteria | 3283 |
| 63 | Ga0102737_1000292 | 3300007142 | Bacteria | 17000 |
| 64 | Ga0104019_1000098 | 3300007150 | Bacteria | 8947 |
| 65 | Ga0103264_1000148 | 3300007188 | Bacteria | 54758 |
| 66 | Ga0103264_1004151 | 3300007188 | Bacteria | 6779 |
| 67 | Ga0466719_337688 | 3300042606 | Bacteria | 8868 |
| 68 | Ga0123354_10155178 | 3300010882 | Bacteria | 2750 |
| 69 | Ga0466725_277745 | 3300042654 | Bacteria | 8538 |
| 70 | DPO_contig00453 | 2032320009 | Unclassified | 3709 |
| 71 | CVPL005W_1000049 | 3300002934 | Bacteria | 77363 |
| 72 | CVPL005L_10000910 | 3300002938 | Bacteria | 32877 |
| 73 | Ga0466705_208939 | 3300042612 | Bacteria | 37731 |
| 74 | Ga0466732_221416 | 3300042656 | Bacteria | 2428 |
| 75 | Ga0160469_100650 | 3300012824 | Unclassified | 13557 |
| 76 | Ga0466657_134641 | 3300042582 | Bacteria | 1375 |
| 77 | Ga0466691_027423 | 3300042593 | Bacteria | 19121 |
| 78 | Ga0160465_106052 | 3300012803 | Unclassified | 1440 |
| 79 | Ga0466734_013651 | 3300042623 | Bacteria | 3503 |
| 80 | Ga0466730_083050 | 3300042625 | Bacteria | 8716 |
| 81 | SWWA_contig18965__length_16034___numreads_952 | 2100351016 | Bacteria | 16034 |
| 82 | CVPL005W_1000945 | 3300002934 | Unclassified | 9158 |
| 83 | Ga0466701_068827 | 3300042598 | Bacteria | 109676 |
| 84 | Ga0466707_028733 | 3300042601 | Bacteria | 39770 |
| 85 | Ga0123353_10107185 | 3300010167 | Bacteria | 4502 |
| 86 | Ga0466729_303538 | 3300042621 | Bacteria | 14551 |
| 87 | Ga0466730_001315 | 3300042625 | Unclassified | 1435 |
| 88 | Ga0466730_003780 | 3300042625 | Unclassified | 1186 |
| 89 | Ga0466724_57793 | 3300042649 | Bacteria | 70923 |
| 90 | DPO_contig08573 | 2032320009 | Unclassified | 2773 |
| 91 | SWWA_contig31992__length_2943___numreads_59 | 2100351016 | Unclassified | 2943 |
| 92 | Ga0102734_1010149 | 3300007129 | Bacteria | 2618 |
| 93 | Ga0104040_1041870 | 3300007149 | Bacteria | 2302 |
| 94 | Ga0103264_1000047 | 3300007188 | Bacteria | 127089 |
| 95 | Ga0103264_1000203 | 3300007188 | Bacteria | 52961 |
| 96 | Ga0466701_093452 | 3300042598 | Bacteria | 94456 |
| 97 | Ga0466722_189665 | 3300042609 | Bacteria | 6226 |
| 98 | Ga0466710_323442 | 3300042613 | Bacteria | 2134 |
| 99 | Ga0466710_337065 | 3300042613 | Bacteria | 25294 |
| 100 | Ga0160460_100406 | 3300012845 | Bacteria | 27176 |
| 101 | Ga0160435_1000304 | 3300012857 | Bacteria | 20871 |
| 102 | Ga0160436_1001734 | 3300012861 | Unclassified | 5809 |
| 103 | Ga0466730_053273 | 3300042625 | Bacteria | 1207 |
| 104 | Ga0466724_31550 | 3300042649 | Bacteria | 56337 |
| 105 | CVPL010W_10002691 | 3300002931 | Bacteria | 20734 |
| 106 | Ga0068302_10024713 | 3300005071 | Bacteria | 9840 |
| 107 | Ga0102737_1003006 | 3300007142 | Bacteria | 3999 |
| 108 | Ga0466713_078279 | 3300042602 | Bacteria | 18449 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01180 | DHO_dh | Dihydroorotate dehydrogenase | 80 | 369 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.