Protein Family IF11170
Metagenome
Isolate
146
Members
100
Samples
106
Scaffolds
217.92
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2603880170|2606027759|
- Length
- 253 aa
- Sequence
- MRETAVPEAAPSPSSSPTPHDAPAATVSTHSSNRIEFVKFAHQQGVLRFGEFKVKSGRISPYFFNTGLFDSGASLGRLARFYAQALVDSGVAFDMLFGPAYKGIALAATTAVALAAHPALQGRDVPFAFNRKSPKDHGEGGTMVGAPLAGRVVIIDDVITAGTSVNESVQWIRQAGAQPAAVLIALDRQERAGAEGHLEPLSAVQMVAQRYGMPVIPIAALDDIMTLMTQDETFAPHRAAVQTYRQRYGCLPT
Sample Types
Isolate
27.4%
Metagenome
72.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
14.9%
Termitidae
14.9%
Kalotermitidae
13.8%
Curculionidae
10.6%
Formicidae
9.6%
Elmidae
9.6%
Culicidae
5.3%
Rhinotermitidae
3.2%
Drosophilidae
3.2%
Apidae
3.2%
Termopsidae
3.2%
Aphididae
2.1%
Armadillidiidae
2.1%
Trigoniulidae
1.1%
Siricidae
1.1%
Cerambycidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 3 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 4 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 5 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 11 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 16 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 17 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 28 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 29 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 30 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 33 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 34 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 35 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 36 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 37 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 38 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 39 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 40 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 41 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 42 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 47 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 48 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 49 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 50 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 51 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 52 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 56 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 57 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 58 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 59 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 60 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 61 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 62 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 63 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 64 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 65 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 70 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 71 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 72 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 73 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 74 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 75 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 76 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 77 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 78 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 79 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 80 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 81 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 82 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 83 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 84 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 85 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 86 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 87 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 88 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 89 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 90 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 91 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 92 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 93 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 94 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 95 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 96 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 97 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 98 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 99 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 100 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_129966 | 3300042606 | Bacteria | 10699 |
| 2 | Ga0466719_264625 | 3300042606 | Bacteria | 2003 |
| 3 | Ga0466722_026028 | 3300042609 | Bacteria | 27712 |
| 4 | Ga0466692_071110 | 3300042591 | Bacteria | 106079 |
| 5 | Ga0102735_1000108 | 3300007080 | Bacteria | 21481 |
| 6 | Ga0102734_1000473 | 3300007129 | Bacteria | 11519 |
| 7 | Ga0466697_224482 | 3300042611 | Bacteria | 1488 |
| 8 | Ga0466704_214429 | 3300042643 | Bacteria | 21126 |
| 9 | Ga0466727_074891 | 3300042655 | Bacteria | 85958 |
| 10 | Ga0466710_188528 | 3300042613 | Bacteria | 1004 |
| 11 | Ga0466726_116904 | 3300042619 | Bacteria | 1103 |
| 12 | Ga0123354_10011856 | 3300010882 | Bacteria | 13494 |
| 13 | Ga0466716_144808 | 3300042605 | Bacteria | 6723 |
| 14 | Ga0466719_423449 | 3300042606 | Bacteria | 1259 |
| 15 | Ga0160446_100886 | 3300012835 | Bacteria | 8266 |
| 16 | Ga0160447_104529 | 3300012849 | Bacteria | 4090 |
| 17 | Ga0160448_111821 | 3300012854 | Bacteria | 1756 |
| 18 | Ga0466657_110876 | 3300042582 | Bacteria | 19718 |
| 19 | Ga0466693_163956 | 3300042592 | Bacteria | 5970 |
| 20 | DPOL_contig06126 | 2035918003 | Bacteria | 42797 |
| 21 | DPOL_contig17686 | 2035918003 | Bacteria | 24060 |
| 22 | Ga0102736_1001964 | 3300007052 | Bacteria | 3398 |
| 23 | Ga0104049_1030782 | 3300007103 | Unclassified | 2904 |
| 24 | Ga0102737_1000366 | 3300007142 | Bacteria | 15227 |
| 25 | Ga0466697_148595 | 3300042611 | Bacteria | 1721 |
| 26 | Ga0466704_509137 | 3300042643 | Bacteria | 56734 |
| 27 | Ga0466709_313425 | 3300042648 | Bacteria | 2176 |
| 28 | Ga0466724_01321 | 3300042649 | Unclassified | 1013 |
| 29 | Ga0466724_26967 | 3300042649 | Unclassified | 21147 |
| 30 | Ga0466724_39587 | 3300042649 | Unclassified | 1852 |
| 31 | Ga0466705_468969 | 3300042612 | Bacteria | 2214 |
| 32 | Ga0466715_017974 | 3300042616 | Bacteria | 2346 |
| 33 | Ga0123357_10230516 | 3300009784 | Bacteria | 2031 |
| 34 | Ga0466701_019529 | 3300042598 | Bacteria | 146632 |
| 35 | Ga0466707_413247 | 3300042601 | Bacteria | 2380 |
| 36 | Ga0466719_301363 | 3300042606 | Bacteria | 4939 |
| 37 | Ga0466719_499224 | 3300042606 | Bacteria | 1746 |
| 38 | Ga0160433_100026 | 3300012846 | Bacteria | 183415 |
| 39 | Ga0466657_130221 | 3300042582 | Bacteria | 2437 |
| 40 | Ga0466693_109504 | 3300042592 | Bacteria | 1517 |
| 41 | Ga0102737_1000243 | 3300007142 | Bacteria | 18493 |
| 42 | Ga0103264_1000020 | 3300007188 | Bacteria | 106161 |
| 43 | Ga0466705_294136 | 3300042612 | Bacteria | 1757 |
| 44 | Ga0466710_366214 | 3300042613 | Bacteria | 1733 |
| 45 | Ga0123357_10148323 | 3300009784 | Bacteria | 2856 |
| 46 | Ga0160466_101203 | 3300012809 | Unclassified | 7930 |
| 47 | Ga0160436_1001255 | 3300012861 | Unclassified | 7195 |
| 48 | DPO_contig01425 | 2032320009 | Unclassified | 10597 |
| 49 | SPBB_contig11551 | 2044078006 | Bacteria | 45561 |
| 50 | FGTW_contig30970 | 2065487013 | Unclassified | 7147 |
| 51 | JGI24705J35276_12227024 | 3300002504 | Unclassified | 2935 |
| 52 | CVPL010W_10007666 | 3300002931 | Bacteria | 10517 |
| 53 | Ga0102737_1000085 | 3300007142 | Bacteria | 28767 |
| 54 | Ga0103264_1000046 | 3300007188 | Bacteria | 103239 |
| 55 | Ga0103264_1005135 | 3300007188 | Bacteria | 6203 |
| 56 | Ga0103267_1019270 | 3300007190 | Bacteria | 2222 |
| 57 | Ga0466704_244184 | 3300042643 | Bacteria | 1782 |
| 58 | Ga0466704_285706 | 3300042643 | Bacteria | 1348 |
| 59 | Ga0466711_209777 | 3300042615 | Bacteria | 5521 |
| 60 | Ga0466701_026280 | 3300042598 | Bacteria | 117012 |
| 61 | Ga0466701_039790 | 3300042598 | Bacteria | 2932 |
| 62 | Ga0160453_106312 | 3300012814 | Unclassified | 1768 |
| 63 | Ga0160448_108833 | 3300012854 | Unclassified | 2264 |
| 64 | Ga0466691_026027 | 3300042593 | Bacteria | 5757 |
| 65 | SWWA_contig31723__length_12393___numreads_777 | 2100351016 | Unclassified | 12393 |
| 66 | CVPL010W_10000684 | 3300002931 | Bacteria | 37318 |
| 67 | Ga0103264_1000410 | 3300007188 | Bacteria | 23067 |
| 68 | Ga0103267_1000027 | 3300007190 | Bacteria | 53284 |
| 69 | Ga0123357_10000016 | 3300009784 | Bacteria | 146511 |
| 70 | Ga0123357_10000467 | 3300009784 | Bacteria | 39326 |
| 71 | Ga0466708_136478 | 3300042652 | Bacteria | 36125 |
| 72 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 73 | Ga0466700_387139 | 3300042600 | Bacteria | 1416 |
| 74 | Ga0466716_313541 | 3300042605 | Bacteria | 1147 |
| 75 | Ga0466722_032122 | 3300042609 | Bacteria | 2830 |
| 76 | Ga0160455_100113 | 3300012837 | Bacteria | 115506 |
| 77 | DPO_contig07757 | 2032320009 | Unclassified | 41168 |
| 78 | CVPL010W_10000661 | 3300002931 | Bacteria | 37920 |
| 79 | CVPL005W_1001786 | 3300002934 | Bacteria | 5078 |
| 80 | Ga0063521_1000769 | 3300003973 | Bacteria | 11624 |
| 81 | Ga0466731_075285 | 3300042622 | Bacteria | 6143 |
| 82 | Ga0466734_159214 | 3300042623 | Bacteria | 2321 |
| 83 | Ga0466725_111679 | 3300042654 | Bacteria | 3517 |
| 84 | Ga0466716_352846 | 3300042605 | Bacteria | 1703 |
| 85 | Ga0160453_105652 | 3300012814 | Bacteria | 1982 |
| 86 | Ga0160431_106292 | 3300012828 | Unclassified | 1822 |
| 87 | Ga0466690_398237 | 3300042590 | Bacteria | 2112 |
| 88 | Ga0466690_426666 | 3300042590 | Bacteria | 2989 |
| 89 | Ga0466696_104235 | 3300042596 | Bacteria | 4229 |
| 90 | SPBB_contig00097 | 2044078006 | Unclassified | 9935 |
| 91 | Ga0103264_1006851 | 3300007188 | Bacteria | 5479 |
| 92 | Ga0466709_348913 | 3300042648 | Bacteria | 4196 |
| 93 | Ga0466708_420039 | 3300042652 | Bacteria | 12442 |
| 94 | Ga0466710_039350 | 3300042613 | Bacteria | 3256 |
| 95 | Ga0466717_009622 | 3300042604 | Bacteria | 1798 |
| 96 | Ga0466696_155893 | 3300042596 | Bacteria | 1959 |
| 97 | Ga0102735_1000367 | 3300007080 | Bacteria | 12861 |
| 98 | Ga0104044_1146906 | 3300007136 | Bacteria | 1786 |
| 99 | Ga0466705_244930 | 3300042612 | Bacteria | 14099 |
| 100 | Ga0466734_098166 | 3300042623 | Bacteria | 7022 |
| 101 | Ga0466735_049798 | 3300042624 | Bacteria | 2616 |
| 102 | Ga0466703_229504 | 3300042636 | Bacteria | 5875 |
| 103 | Ga0466704_110726 | 3300042643 | Bacteria | 63753 |
| 104 | Ga0466715_072482 | 3300042616 | Bacteria | 8088 |
| 105 | Ga0466723_037052 | 3300042618 | Bacteria | 31156 |
| 106 | Ga0466729_176195 | 3300042621 | Bacteria | 7598 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_387139 | Ga0466700_387139_272_952 | 186 |
| 2 | 3300042582 | Ga0466657_110876 | Ga0466657_110876_18958_19596 | 193 |
| 3 | 3300042591 | Ga0466692_071110 | Ga0466692_071110_98181_98828 | 195 |
| 4 | 3300042598 | Ga0466701_019529 | Ga0466701_019529_99098_99739 | 198 |
| 5 | 3300042606 | Ga0466719_264625 | Ga0466719_264625_1091_1738 | 199 |
| 6 | 3300007188 | Ga0103264_1006851 | Ga0103264_10068515 | 206 |
| 7 | 3300042655 | Ga0466727_074891 | Ga0466727_074891_63295_63939 | 207 |
| 8 | 3300007103 | Ga0104049_1030782 | Ga0104049_10307824 | 211 |
| 9 | 3300042582 | Ga0466657_130221 | Ga0466657_130221_507_1145 | 212 |
| 10 | 3300042613 | Ga0466710_366214 | Ga0466710_366214_949_1626 | 212 |
| 11 | iso_pr_bacteria | 2846359427 | 2846360127 | 212 |
| 12 | iso_pr_bacteria | 2846379220 | 2846380106 | 212 |
| 13 | iso_pr_bacteria | 2849409164 | 2849411198 | 212 |
| 14 | 2035918003 | DPOL_contig06126 | DPOLB_238300 | 213 |
| 15 | 2065487013 | FGTW_contig30970 | FGTW_00805240 | 213 |
| 16 | 2100351016 | SWWA_contig31723__length_12393___numreads_777 | SWWA_02208110 | 213 |
| 17 | 3300042598 | Ga0466701_026280 | Ga0466701_026280_1062_1703 | 213 |
| 18 | 3300042613 | Ga0466710_039350 | Ga0466710_039350_878_1519 | 213 |
| 19 | 3300042649 | Ga0466724_01321 | Ga0466724_01321_125_766 | 213 |
| 20 | 3300042649 | Ga0466724_26967 | Ga0466724_26967_11242_11883 | 213 |
| 21 | 3300042649 | Ga0466724_39587 | Ga0466724_39587_1087_1728 | 213 |
| 22 | 3300056842 | Ga0562377_0013 | Ga0562377_0013_893457_894098 | 213 |
| 23 | iso_pr_bacteria | 2528768159 | 2529054744 | 213 |
| 24 | iso_pr_bacteria | 2645727860 | 2647289814 | 213 |
| 25 | iso_pr_bacteria | 2648501209 | 2648984969 | 213 |
| 26 | iso_pr_bacteria | 2833053935 | 2833056873 | 213 |
| 27 | iso_pr_bacteria | 2864739902 | 2864743136 | 213 |
| 28 | iso_pr_bacteria | 2864751016 | 2864753132 | 213 |
| 29 | iso_pr_bacteria | 2864926767 | 2864933000 | 213 |
| 30 | iso_pr_bacteria | 2864944480 | 2864945457 | 213 |
| 31 | iso_pr_bacteria | 2987233858 | 2987237559 | 213 |
| 32 | iso_pr_bacteria | 2997878596 | 2997883873 | 213 |
| 33 | iso_pr_bacteria | 3007473699 | 3007476599 | 213 |
| 34 | iso_pr_bacteria | 3007478678 | 3007483291 | 213 |
| 35 | iso_pr_bacteria | 637000219 | 638004272 | 213 |
| 36 | iso_pr_bacteria | 8011329375 | 8011332112 | 213 |
| 37 | iso_pr_bacteria | 8011357093 | 8011360279 | 213 |
| 38 | iso_pr_bacteria | 8035422605 | 8035423008 | 213 |
| 39 | iso_pr_bacteria | 8052469819 | 8052472380 | 213 |
| 40 | iso_pr_bacteria | 8062647588 | 8062648620 | 213 |
| 41 | iso_pr_bacteria | 8099192374 | 8099196972 | 213 |
| 42 | 2032320009 | DPO_contig01425 | DPOB_487050 | 214 |
| 43 | 2044078006 | SPBB_contig00097 | SPBB_1098010 | 214 |
| 44 | 3300003973 | Ga0063521_1000769 | Ga0063521_10007699 | 214 |
| 45 | 3300007080 | Ga0102735_1000367 | Ga0102735_10003678 | 214 |
| 46 | 3300007136 | Ga0104044_1146906 | Ga0104044_11469063 | 214 |
| 47 | 3300007190 | Ga0103267_1019270 | Ga0103267_10192701 | 214 |
| 48 | 3300012814 | Ga0160453_105652 | Ga0160453_1056522 | 214 |
| 49 | 3300012814 | Ga0160453_106312 | Ga0160453_1063121 | 214 |
| 50 | 3300012828 | Ga0160431_106292 | Ga0160431_1062922 | 214 |
| 51 | 3300012837 | Ga0160455_100113 | Ga0160455_10011327 | 214 |
| 52 | 3300012846 | Ga0160433_100026 | Ga0160433_10002692 | 214 |
| 53 | 3300012849 | Ga0160447_104529 | Ga0160447_1045292 | 214 |
| 54 | 3300012854 | Ga0160448_108833 | Ga0160448_1088334 | 214 |
| 55 | 3300012861 | Ga0160436_1001255 | Ga0160436_10012557 | 214 |
| 56 | iso_pr_bacteria | 2519899622 | 2520392627 | 214 |
| 57 | iso_pr_bacteria | 2864745180 | 2864747094 | 214 |
| 58 | iso_pr_bacteria | 2864853652 | 2864855681 | 214 |
| 59 | iso_pr_bacteria | 2864859030 | 2864862164 | 214 |
| 60 | iso_pr_bacteria | 2864914039 | 2864917160 | 214 |
| 61 | iso_pr_bacteria | 2864988360 | 2864990977 | 214 |
| 62 | iso_pr_bacteria | 2972038244 | 2972038583 | 214 |
| 63 | iso_pr_bacteria | 8035321120 | 8035325279 | 214 |
| 64 | iso_pr_bacteria | 8035326735 | 8035327168 | 214 |
| 65 | 3300012809 | Ga0160466_101203 | Ga0160466_1012037 | 215 |
| 66 | 3300012835 | Ga0160446_100886 | Ga0160446_1008868 | 215 |
| 67 | 3300012854 | Ga0160448_111821 | Ga0160448_1118213 | 215 |
| 68 | 3300042590 | Ga0466690_398237 | Ga0466690_398237_254_901 | 215 |
| 69 | 3300042590 | Ga0466690_426666 | Ga0466690_426666_1477_2124 | 215 |
| 70 | 3300042596 | Ga0466696_104235 | Ga0466696_104235_113_760 | 215 |
| 71 | 3300042601 | Ga0466707_413247 | Ga0466707_413247_473_1120 | 215 |
| 72 | 3300042605 | Ga0466716_144808 | Ga0466716_144808_4224_4871 | 215 |
| 73 | 3300042605 | Ga0466716_313541 | Ga0466716_313541_243_890 | 215 |
| 74 | 3300042605 | Ga0466716_352846 | Ga0466716_352846_665_1312 | 215 |
| 75 | 3300042606 | Ga0466719_129966 | Ga0466719_129966_6829_7476 | 215 |
| 76 | 3300042606 | Ga0466719_301363 | Ga0466719_301363_1880_2527 | 215 |
| 77 | 3300042606 | Ga0466719_499224 | Ga0466719_499224_602_1249 | 215 |
| 78 | 3300042609 | Ga0466722_026028 | Ga0466722_026028_5156_5803 | 215 |
| 79 | 3300042609 | Ga0466722_032122 | Ga0466722_032122_831_1478 | 215 |
| 80 | 3300042612 | Ga0466705_244930 | Ga0466705_244930_3750_4397 | 215 |
| 81 | 3300042612 | Ga0466705_294136 | Ga0466705_294136_576_1223 | 215 |
| 82 | 3300042612 | Ga0466705_468969 | Ga0466705_468969_781_1428 | 215 |
| 83 | 3300042615 | Ga0466711_209777 | Ga0466711_209777_4229_4876 | 215 |
| 84 | 3300042616 | Ga0466715_072482 | Ga0466715_072482_697_1344 | 215 |
| 85 | 3300042618 | Ga0466723_037052 | Ga0466723_037052_1202_1849 | 215 |
| 86 | 3300042619 | Ga0466726_116904 | Ga0466726_116904_304_951 | 215 |
| 87 | 3300042624 | Ga0466735_049798 | Ga0466735_049798_1436_2083 | 215 |
| 88 | 3300042636 | Ga0466703_229504 | Ga0466703_229504_2053_2700 | 215 |
| 89 | 3300042643 | Ga0466704_214429 | Ga0466704_214429_17236_17883 | 215 |
| 90 | 3300042643 | Ga0466704_244184 | Ga0466704_244184_980_1627 | 215 |
| 91 | 3300042643 | Ga0466704_285706 | Ga0466704_285706_102_749 | 215 |
| 92 | 3300042648 | Ga0466709_313425 | Ga0466709_313425_1066_1713 | 215 |
| 93 | 3300042648 | Ga0466709_348913 | Ga0466709_348913_1055_1702 | 215 |
| 94 | iso_pr_bacteria | 2820123897 | 2820125386 | 215 |
| 95 | iso_pr_bacteria | 2891720358 | 2891723625 | 215 |
| 96 | 3300042596 | Ga0466696_155893 | Ga0466696_155893_756_1406 | 216 |
| 97 | 3300042604 | Ga0466717_009622 | Ga0466717_009622_746_1396 | 216 |
| 98 | iso_pr_bacteria | 2820062699 | 2820062800 | 216 |
| 99 | iso_pr_bacteria | 2820065746 | 2820067745 | 216 |
| 100 | 3300002504 | JGI24705J35276_12227024 | JGI24705J35276_122270242 | 217 |
| 101 | 3300007188 | Ga0103264_1000046 | Ga0103264_100004681 | 217 |
| 102 | 3300042606 | Ga0466719_423449 | Ga0466719_423449_386_1039 | 217 |
| 103 | 3300042616 | Ga0466715_017974 | Ga0466715_017974_364_1017 | 217 |
| 104 | 3300042654 | Ga0466725_111679 | Ga0466725_111679_371_1024 | 217 |
| 105 | 3300042621 | Ga0466729_176195 | Ga0466729_176195_4013_4669 | 218 |
| 106 | 3300009784 | Ga0123357_10000016 | Ga0123357_10000016130 | 219 |
| 107 | 3300042593 | Ga0466691_026027 | Ga0466691_026027_3650_4312 | 220 |
| 108 | 2032320009 | DPO_contig07757 | DPOB_610190 | 221 |
| 109 | 2035918003 | DPOL_contig17686 | DPOLB_499110 | 221 |
| 110 | 2044078006 | SPBB_contig11551 | SPBB_414420 | 221 |
| 111 | 3300007142 | Ga0102737_1000366 | Ga0102737_100036610 | 222 |
| 112 | 3300042623 | Ga0466734_098166 | Ga0466734_098166_5946_6614 | 222 |
| 113 | iso_pr_bacteria | 2848339753 | 2848340413 | 222 |
| 114 | 3300042643 | Ga0466704_110726 | Ga0466704_110726_1109_1786 | 225 |
| 115 | iso_pr_bacteria | 2820103659 | 2820104708 | 225 |
| 116 | 3300009784 | Ga0123357_10000467 | Ga0123357_100004679 | 226 |
| 117 | 3300042592 | Ga0466693_109504 | Ga0466693_109504_158_838 | 226 |
| 118 | 3300042623 | Ga0466734_159214 | Ga0466734_159214_915_1595 | 226 |
| 119 | 3300007188 | Ga0103264_1005135 | Ga0103264_10051354 | 227 |
| 120 | 3300009784 | Ga0123357_10230516 | Ga0123357_102305162 | 227 |
| 121 | 3300042611 | Ga0466697_224482 | Ga0466697_224482_754_1437 | 227 |
| 122 | 3300002931 | CVPL010W_10000684 | CVPL010W_1000068425 | 228 |
| 123 | 3300007129 | Ga0102734_1000473 | Ga0102734_10004738 | 228 |
| 124 | 3300009784 | Ga0123357_10148323 | Ga0123357_101483233 | 228 |
| 125 | 3300010882 | Ga0123354_10011856 | Ga0123354_100118568 | 228 |
| 126 | 3300007080 | Ga0102735_1000108 | Ga0102735_100010814 | 229 |
| 127 | 3300007190 | Ga0103267_1000027 | Ga0103267_10000278 | 230 |
| 128 | 3300002931 | CVPL010W_10007666 | CVPL010W_100076664 | 231 |
| 129 | 3300042598 | Ga0466701_039790 | Ga0466701_039790_447_1142 | 231 |
| 130 | iso_pr_bacteria | 2518285616 | 2518642532 | 231 |
| 131 | 3300007188 | Ga0103264_1000020 | Ga0103264_100002010 | 232 |
| 132 | 3300042643 | Ga0466704_509137 | Ga0466704_509137_38363_39061 | 232 |
| 133 | 3300042592 | Ga0466693_163956 | Ga0466693_163956_2154_2855 | 233 |
| 134 | 3300042611 | Ga0466697_148595 | Ga0466697_148595_848_1549 | 233 |
| 135 | 3300042613 | Ga0466710_188528 | Ga0466710_188528_186_887 | 233 |
| 136 | 3300042652 | Ga0466708_136478 | Ga0466708_136478_12781_13482 | 233 |
| 137 | 3300007052 | Ga0102736_1001964 | Ga0102736_10019643 | 235 |
| 138 | 3300007142 | Ga0102737_1000243 | Ga0102737_10002434 | 235 |
| 139 | 3300042652 | Ga0466708_420039 | Ga0466708_420039_3354_4064 | 236 |
| 140 | 3300042622 | Ga0466731_075285 | Ga0466731_075285_4198_4914 | 238 |
| 141 | iso_pr_bacteria | 2687453742 | 2689988634 | 241 |
| 142 | 3300002934 | CVPL005W_1001786 | CVPL005W_10017863 | 242 |
| 143 | 3300007142 | Ga0102737_1000085 | Ga0102737_100008522 | 242 |
| 144 | 3300007188 | Ga0103264_1000410 | Ga0103264_10004104 | 242 |
| 145 | 3300002931 | CVPL010W_10000661 | CVPL010W_1000066133 | 243 |
| 146 | iso_pr_bacteria | 2603880170 | 2606027759 | 253 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 77 | 192 | 0.87 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.