Protein Family IF11061

Metagenome Isolate
161 Members
70 Samples
133 Scaffolds
340.91 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2593339125|2595066000|
Length
382 aa
Sequence
MQRMNLKGYFRSCNRYITKSLKKILLIIRYTYTKLPNNDGGTKMKKIKTTEAVGNVICHDITQIIKGEKKDVAFKKGHIVTEEDIPVLLSIGKDNLYVWEKKEGMLHENEAAEILCKICKSDYMSATKVKEGKIELIAAEDGLFKIDIEKLRKINSLGEMMIATRHSNFPVKKGDKLAGTRIIPLVIEQKKMDEAVKLAGDKPLMEILPFIHKKAGIVTTGNEVFYGRIKDTFGPVIREKLAEYNVEVLGQKILSDDPKLITEAIKDFIKEGAELIICTGGMSVDPDDTTPTAIQNTGAKIVSYGAPVLPGAMFLLAYYNDTLPVIGLPGCVMYAKRTIFDLVLPRVMVDDKITLEDISNLGHGGLCLSCDICTFPNCGFGK

πŸ“Š Sample Types

Isolate 17.4%
Metagenome 82.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 31.9%
Termitidae 31.9%
Kalotermitidae 17.4%
Blattidae 4.3%
Rhinotermitidae 4.3%
Passalidae 2.9%
Termopsidae 2.9%
Scarabaeidae 1.4%
Hodotermitidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
2 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
3 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
4 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
5 2820730639 Unclassified Chloroflexi Th196P4bin31 Isolate Unclassified
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
14 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
15 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
16 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
32 2590828839 Clostridium sp. 1 Isolate Termitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
44 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
45 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
46 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
47 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
50 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
51 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
52 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
57 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
58 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
59 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
60 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
61 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
62 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
63 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
64 2593339125 Clostridium sp. 5 Isolate Termitidae
65 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
66 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
67 2820731983 Unclassified Chloroflexi Nt197P3bin126 Isolate Unclassified
68 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
69 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10203748 3300009826 Bacteria 2884
2 Ga0123356_10015556 3300010049 Bacteria 7286
3 Ga0123356_10113538 3300010049 Bacteria 2621
4 Ga0123353_10099667 3300010167 Bacteria 4682
5 Ga0123353_10160418 3300010167 Bacteria 3581
6 Ga0123353_10174531 3300010167 Bacteria 3409
7 Ga0123353_10399040 3300010167 Bacteria 2048
8 Ga0466709_209552 3300042648 Bacteria 15383
9 Ga0466725_407550 3300042654 Bacteria 2544
10 Ga0264413_101023 3300024493 Bacteria 4567
11 Ga0264413_101171 3300024493 Bacteria 7160
12 Ga0466692_126673 3300042591 Bacteria 21184
13 Ga0466692_202211 3300042591 Bacteria 4585
14 Ga0466696_434331 3300042596 Bacteria 1892
15 Ga0466699_188412 3300042597 Bacteria 1227
16 Ga0466714_083417 3300042603 Bacteria 15765
17 Ga0466717_305009 3300042604 Bacteria 7110
18 Ga0466720_018749 3300042607 Bacteria 13625
19 Ga0466720_051991 3300042607 Bacteria 3599
20 Ga0466720_153303 3300042607 Bacteria 2794
21 IMNBL1DRAFT_c0000349 3300000062 Bacteria 39000
22 Ga0072940_1523198 3300005200 Bacteria 1547
23 Ga0123356_10000140 3300010049 Bacteria 81836
24 Ga0466735_062986 3300042624 Bacteria 1630
25 Ga0466690_071752 3300042590 Bacteria 48946
26 Ga0466713_037915 3300042602 Bacteria 12221
27 Ga0466713_137341 3300042602 Bacteria 1448
28 Ga0466719_533500 3300042606 Bacteria 2678
29 Ga0466720_223616 3300042607 Bacteria 2980
30 Ga0466722_001589 3300042609 Bacteria 7489
31 Ga0466722_211220 3300042609 Bacteria 6534
32 Ga0466732_243562 3300042656 Bacteria 11049
33 Ga0562377_0006 3300056842 Bacteria 3350072
34 Ga0123356_10059104 3300010049 Bacteria 3576
35 Ga0123356_10107854 3300010049 Bacteria 2684
36 Ga0123356_10167077 3300010049 Bacteria 2206
37 Ga0466723_144132 3300042618 Bacteria 7381
38 Ga0466726_044528 3300042619 Bacteria 29828
39 Ga0264413_101022 3300024493 Bacteria 3553
40 Ga0415639_235125 3300038395 Bacteria 3362
41 Ga0466699_182827 3300042597 Bacteria 45951
42 Ga0466706_176499 3300042599 Bacteria 6126
43 Ga0466720_044705 3300042607 Bacteria 17060
44 Ga0466720_152531 3300042607 Bacteria 7566
45 Ga0068305_10428648 3300005083 Bacteria 7880
46 Ga0123357_10395014 3300009784 Bacteria 1266
47 Ga0123353_10099602 3300010167 Bacteria 4684
48 Ga0466705_479965 3300042612 Bacteria 20919
49 Ga0466724_63674 3300042649 Bacteria 1897
50 Ga0456237_0003852 3300041968 Bacteria 2422
51 Ga0466692_143489 3300042591 Bacteria 4679
52 Ga0466693_417692 3300042592 Bacteria 20246
53 Ga0466691_116012 3300042593 Bacteria 7367
54 Ga0466707_014389 3300042601 Bacteria 75654
55 Ga0466719_571022 3300042606 Bacteria 1298
56 Ga0466720_063332 3300042607 Bacteria 12713
57 Ga0466733_122844 3300042659 Bacteria 20067
58 Ga0123355_10325567 3300009826 Bacteria 2065
59 Ga0123356_10176074 3300010049 Bacteria 2156
60 Ga0123356_10538295 3300010049 Bacteria 1328
61 Ga0123356_10741285 3300010049 Bacteria 1152
62 Ga0123353_10000319 3300010167 Bacteria 59439
63 Ga0123353_10056291 3300010167 Bacteria 6293
64 Ga0123353_10241625 3300010167 Bacteria 2805
65 Ga0123353_10620793 3300010167 Bacteria 1539
66 Ga0466715_481771 3300042616 Bacteria 30259
67 Ga0466718_061107 3300042617 Bacteria 3255
68 Ga0466728_274274 3300042620 Bacteria 22423
69 Ga0466703_026451 3300042636 Bacteria 14174
70 Ga0264413_112649 3300024493 Bacteria 3686
71 Ga0466692_133006 3300042591 Bacteria 12247
72 Ga0466699_051861 3300042597 Bacteria 28735
73 Ga0466706_221283 3300042599 Bacteria 43471
74 Ga0466717_042591 3300042604 Bacteria 2282
75 Ga0466716_073641 3300042605 Bacteria 7197
76 Ga0466719_033626 3300042606 Bacteria 45932
77 Ga0466720_101077 3300042607 Bacteria 10045
78 IMNBL1DRAFT_c0001432 3300000062 Bacteria 17846
79 IMNBL1DRAFT_c0004395 3300000062 Bacteria 8498
80 JGI24702J35022_10017748 3300002462 Bacteria 3885
81 Ga0466705_219837 3300042612 Bacteria 6870
82 Ga0466732_117934 3300042656 Bacteria 5090
83 Ga0123355_10052033 3300009826 Unclassified 6646
84 Ga0123356_10000918 3300010049 Bacteria 32588
85 Ga0123356_10076506 3300010049 Bacteria 3154
86 Ga0123356_10207428 3300010049 Bacteria 2005
87 Ga0123353_10007556 3300010167 Bacteria 14723
88 Ga0466718_068121 3300042617 Bacteria 3967
89 Ga0466704_308552 3300042643 Bacteria 41896
90 Ga0264413_101021 3300024493 Bacteria 7582
91 Ga0466707_193454 3300042601 Bacteria 2720
92 Ga0466707_324286 3300042601 Bacteria 1717
93 Ga0466720_029698 3300042607 Bacteria 1419
94 Ga0466720_238607 3300042607 Bacteria 1381
95 JGI24702J35022_10015404 3300002462 Bacteria 4209
96 Ga0466733_210407 3300042659 Bacteria 8951
97 Ga0123356_10003854 3300010049 Bacteria 15620
98 Ga0123356_10057271 3300010049 Bacteria 3632
99 Ga0123356_10084392 3300010049 Unclassified 3010
100 Ga0123353_10010938 3300010167 Bacteria 12723
101 Ga0123353_10081325 3300010167 Bacteria 5209
102 Ga0123353_10129493 3300010167 Bacteria 4052
103 Ga0123353_10142258 3300010167 Bacteria 3841
104 Ga0123353_10204525 3300010167 Bacteria 3103
105 Ga0466718_164300 3300042617 Bacteria 2908
106 Ga0466709_152210 3300042648 Bacteria 18824
107 Ga0264413_105753 3300024493 Bacteria 1916
108 Ga0466690_187650 3300042590 Bacteria 9765
109 Ga0466694_205617 3300042594 Bacteria 3280
110 Ga0466696_300951 3300042596 Bacteria 5540
111 Ga0466720_032145 3300042607 Bacteria 21125
112 2227499634 2225789004 Unclassified 19437
113 IMNBL1DRAFT_c0023793 3300000062 Bacteria 2392
114 JGI24702J35022_10000288 3300002462 Bacteria 29450
115 Ga0562377_0538 3300056842 Bacteria 59511
116 Ga0123356_10259262 3300010049 Bacteria 1821
117 Ga0123356_10688736 3300010049 Bacteria 1191
118 Ga0466715_046838 3300042616 Bacteria 8323
119 Ga0466715_209291 3300042616 Bacteria 20063
120 Ga0466718_014723 3300042617 Bacteria 10181
121 Ga0466723_055810 3300042618 Bacteria 20174
122 Ga0264413_100391 3300024493 Bacteria 6645
123 Ga0264413_101172 3300024493 Bacteria 3614
124 Ga0466699_015261 3300042597 Bacteria 2563
125 Ga0466699_274103 3300042597 Bacteria 22431
126 Ga0466707_076357 3300042601 Bacteria 224161
127 Ga0466720_010845 3300042607 Bacteria 17725
128 Ga0466720_046061 3300042607 Bacteria 9587
129 Ga0466720_116740 3300042607 Bacteria 72912
130 IMNBL1DRAFT_c0001830 3300000062 Bacteria 15499
131 AustNasuHG_c1000808 3300000089 Bacteria 11230
132 JGI24705J35276_12238080 3300002504 Bacteria 15669
133 Ga0072940_1035784 3300005200 Bacteria 5817

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_101171 Ga0264413_1011717 298
2 3300024493 Ga0264413_105753 Ga0264413_1057532 298
3 3300042617 Ga0466718_014723 Ga0466718_014723_2778_3686 302
4 3300010167 Ga0123353_10142258 Ga0123353_101422582 304
5 3300042607 Ga0466720_029698 Ga0466720_029698_68_988 306
6 3300005200 Ga0072940_1035784 Ga0072940_10357847 309
7 3300042590 Ga0466690_071752 Ga0466690_071752_38286_39311 309
8 3300042594 Ga0466694_205617 Ga0466694_205617_31_1002 323
9 3300042659 Ga0466733_210407 Ga0466733_210407_5834_6808 324
10 3300056842 Ga0562377_0538 Ga0562377_0538_35674_36648 324
11 iso_pr_bacteria 646311952 646428718 324
12 3300010049 Ga0123356_10059104 Ga0123356_100591044 328
13 3300042591 Ga0466692_202211 Ga0466692_202211_3242_4228 328
14 3300042607 Ga0466720_153303 Ga0466720_153303_616_1641 329
15 3300042609 Ga0466722_001589 Ga0466722_001589_216_1205 329
16 3300042601 Ga0466707_324286 Ga0466707_324286_659_1672 337
17 3300042605 Ga0466716_073641 Ga0466716_073641_830_1867 337
18 3300042618 Ga0466723_144132 Ga0466723_144132_5233_6273 337
19 3300024493 Ga0264413_101023 Ga0264413_1010233 338
20 3300042607 Ga0466720_044705 Ga0466720_044705_6961_7977 338
21 3300042656 Ga0466732_117934 Ga0466732_117934_3839_4855 338
22 3300042656 Ga0466732_243562 Ga0466732_243562_950_1966 338
23 iso_pr_bacteria 2940373808 2940374296 338
24 3300010167 Ga0123353_10129493 Ga0123353_101294934 339
25 3300024493 Ga0264413_101022 Ga0264413_1010224 339
26 3300041968 Ga0456237_0003852 Ga0456237_0003852_1329_2348 339
27 3300042591 Ga0466692_126673 Ga0466692_126673_11360_12379 339
28 3300042599 Ga0466706_221283 Ga0466706_221283_25443_26462 339
29 3300042601 Ga0466707_014389 Ga0466707_014389_49246_50265 339
30 3300042601 Ga0466707_076357 Ga0466707_076357_86870_87889 339
31 3300042601 Ga0466707_193454 Ga0466707_193454_650_1669 339
32 3300042606 Ga0466719_571022 Ga0466719_571022_125_1144 339
33 3300042612 Ga0466705_479965 Ga0466705_479965_14862_15881 339
34 3300042643 Ga0466704_308552 Ga0466704_308552_30423_31442 339
35 3300056842 Ga0562377_0006 Ga0562377_0006_3281372_3282391 339
36 iso_pr_bacteria 2590828839 2593250989 339
37 iso_pr_bacteria 2590828839 2593253628 339
38 iso_pr_bacteria 2781125692 2781430347 339
39 iso_pr_bacteria 2820535361 2820535473 339
40 iso_pr_bacteria 2940241992 2940242503 339
41 iso_pr_bacteria 2940349480 2940350127 339
42 iso_pr_bacteria 8064531044 8064531722 339
43 2225789004 2227499634 2227980976 340
44 3300000062 IMNBL1DRAFT_c0023793 IMNBL1DRAFT_00237931 340
45 3300042606 Ga0466719_533500 Ga0466719_533500_45_1067 340
46 3300042648 Ga0466709_209552 Ga0466709_209552_4613_5635 340
47 iso_pr_bacteria 2634166424 2635616582 340
48 iso_pr_bacteria 2820483401 2820485590 340
49 iso_pr_bacteria 2820501819 2820502761 340
50 iso_pr_bacteria 2820539610 2820540624 340
51 iso_pr_bacteria 2820641689 2820643554 340
52 3300000062 IMNBL1DRAFT_c0004395 IMNBL1DRAFT_00043955 341
53 3300009784 Ga0123357_10395014 Ga0123357_103950142 341
54 3300009826 Ga0123355_10052033 Ga0123355_100520332 341
55 3300010049 Ga0123356_10176074 Ga0123356_101760742 341
56 3300010167 Ga0123353_10056291 Ga0123353_100562916 341
57 3300010167 Ga0123353_10620793 Ga0123353_106207932 341
58 3300024493 Ga0264413_100391 Ga0264413_1003918 341
59 3300024493 Ga0264413_101021 Ga0264413_1010214 341
60 3300024493 Ga0264413_112649 Ga0264413_1126494 341
61 3300038395 Ga0415639_235125 Ga0415639_235125_2266_3291 341
62 3300042596 Ga0466696_434331 Ga0466696_434331_738_1763 341
63 3300042599 Ga0466706_176499 Ga0466706_176499_713_1738 341
64 3300042607 Ga0466720_010845 Ga0466720_010845_6205_7230 341
65 3300042607 Ga0466720_032145 Ga0466720_032145_14947_15972 341
66 3300042607 Ga0466720_063332 Ga0466720_063332_5652_6677 341
67 3300042607 Ga0466720_101077 Ga0466720_101077_445_1470 341
68 3300042607 Ga0466720_116740 Ga0466720_116740_56269_57294 341
69 3300042607 Ga0466720_223616 Ga0466720_223616_618_1643 341
70 3300042612 Ga0466705_219837 Ga0466705_219837_4153_5178 341
71 3300042616 Ga0466715_209291 Ga0466715_209291_6146_7171 341
72 3300042616 Ga0466715_481771 Ga0466715_481771_25891_26916 341
73 3300042617 Ga0466718_061107 Ga0466718_061107_1633_2658 341
74 3300042617 Ga0466718_068121 Ga0466718_068121_294_1319 341
75 3300042617 Ga0466718_164300 Ga0466718_164300_31_1056 341
76 3300042624 Ga0466735_062986 Ga0466735_062986_439_1464 341
77 iso_pr_bacteria 2781125631 2781268675 341
78 iso_pr_bacteria 2820272499 2820274220 341
79 iso_pr_bacteria 2820364642 2820366379 341
80 iso_pr_bacteria 2820442516 2820443478 341
81 iso_pr_bacteria 2820566695 2820567445 341
82 iso_pr_bacteria 2820730639 2820731096 341
83 iso_pr_bacteria 2820731983 2820732260 341
84 3300000062 IMNBL1DRAFT_c0000349 IMNBL1DRAFT_00003497 342
85 3300000062 IMNBL1DRAFT_c0001432 IMNBL1DRAFT_00014326 342
86 3300000062 IMNBL1DRAFT_c0001830 IMNBL1DRAFT_000183019 342
87 3300000089 AustNasuHG_c1000808 AustNasuHG_10008083 342
88 3300002462 JGI24702J35022_10000288 JGI24702J35022_100002888 342
89 3300009826 Ga0123355_10325567 Ga0123355_103255672 342
90 3300010049 Ga0123356_10000140 Ga0123356_1000014011 342
91 3300010049 Ga0123356_10003854 Ga0123356_100038546 342
92 3300010049 Ga0123356_10015556 Ga0123356_100155567 342
93 3300010049 Ga0123356_10057271 Ga0123356_100572715 342
94 3300010049 Ga0123356_10076506 Ga0123356_100765061 342
95 3300010049 Ga0123356_10107854 Ga0123356_101078542 342
96 3300010049 Ga0123356_10113538 Ga0123356_101135383 342
97 3300010049 Ga0123356_10207428 Ga0123356_102074282 342
98 3300010049 Ga0123356_10259262 Ga0123356_102592623 342
99 3300010049 Ga0123356_10538295 Ga0123356_105382951 342
100 3300010049 Ga0123356_10688736 Ga0123356_106887362 342
101 3300010167 Ga0123353_10000319 Ga0123353_1000031911 342
102 3300010167 Ga0123353_10007556 Ga0123353_100075569 342
103 3300010167 Ga0123353_10099602 Ga0123353_100996025 342
104 3300010167 Ga0123353_10099667 Ga0123353_100996672 342
105 3300010167 Ga0123353_10160418 Ga0123353_101604182 342
106 3300010167 Ga0123353_10174531 Ga0123353_101745313 342
107 3300010167 Ga0123353_10204525 Ga0123353_102045252 342
108 3300010167 Ga0123353_10399040 Ga0123353_103990403 342
109 3300042591 Ga0466692_143489 Ga0466692_143489_2671_3699 342
110 3300042603 Ga0466714_083417 Ga0466714_083417_3241_4269 342
111 3300042607 Ga0466720_152531 Ga0466720_152531_6323_7351 342
112 3300042618 Ga0466723_055810 Ga0466723_055810_10912_11940 342
113 3300042659 Ga0466733_122844 Ga0466733_122844_6204_7232 342
114 iso_pr_bacteria 2820327087 2820328486 342
115 3300005200 Ga0072940_1523198 Ga0072940_15231981 343
116 3300010049 Ga0123356_10000918 Ga0123356_1000091819 343
117 3300042606 Ga0466719_033626 Ga0466719_033626_42548_43579 343
118 3300042616 Ga0466715_046838 Ga0466715_046838_2789_3820 343
119 3300042636 Ga0466703_026451 Ga0466703_026451_1189_2220 343
120 iso_pr_bacteria 2590828839 2593253260 343
121 3300010049 Ga0123356_10084392 Ga0123356_100843924 344
122 3300010049 Ga0123356_10167077 Ga0123356_101670772 344
123 3300010167 Ga0123353_10081325 Ga0123353_100813251 344
124 3300042602 Ga0466713_037915 Ga0466713_037915_3466_4500 344
125 3300042604 Ga0466717_042591 Ga0466717_042591_728_1762 344
126 iso_pr_bacteria 2820005795 2820006248 344
127 iso_pr_bacteria 2820350530 2820351625 344
128 iso_pr_bacteria 8064531044 8064534396 344
129 3300002462 JGI24702J35022_10017748 JGI24702J35022_100177483 345
130 3300010167 Ga0123353_10241625 Ga0123353_102416253 345
131 3300042593 Ga0466691_116012 Ga0466691_116012_3107_4144 345
132 3300042648 Ga0466709_152210 Ga0466709_152210_16766_17803 345
133 3300042591 Ga0466692_133006 Ga0466692_133006_3796_4836 346
134 3300042597 Ga0466699_182827 Ga0466699_182827_16377_17417 346
135 3300042607 Ga0466720_051991 Ga0466720_051991_268_1308 346
136 3300042619 Ga0466726_044528 Ga0466726_044528_1659_2699 346
137 3300042620 Ga0466728_274274 Ga0466728_274274_3215_4255 346
138 3300042649 Ga0466724_63674 Ga0466724_63674_414_1454 346
139 3300009826 Ga0123355_10203748 Ga0123355_102037482 347
140 3300042590 Ga0466690_187650 Ga0466690_187650_1150_2193 347
141 3300042609 Ga0466722_211220 Ga0466722_211220_1809_2855 348
142 3300042596 Ga0466696_300951 Ga0466696_300951_1133_2182 349
143 3300042597 Ga0466699_015261 Ga0466699_015261_1164_2213 349
144 3300002462 JGI24702J35022_10015404 JGI24702J35022_100154044 350
145 3300005083 Ga0068305_10428648 Ga0068305_104286481 351
146 3300042592 Ga0466693_417692 Ga0466693_417692_1426_2481 351
147 iso_pr_bacteria 2781125639 2781286018 351
148 3300002504 JGI24705J35276_12238080 JGI24705J35276_122380805 353
149 3300010049 Ga0123356_10741285 Ga0123356_107412851 353
150 3300042607 Ga0466720_018749 Ga0466720_018749_7746_8807 353
151 3300042607 Ga0466720_046061 Ga0466720_046061_255_1316 353
152 3300042607 Ga0466720_238607 Ga0466720_238607_120_1181 353
153 3300010167 Ga0123353_10010938 Ga0123353_100109389 354
154 3300042597 Ga0466699_188412 Ga0466699_188412_50_1114 354
155 3300042597 Ga0466699_274103 Ga0466699_274103_8009_9079 356
156 3300024493 Ga0264413_101172 Ga0264413_1011722 360
157 3300042597 Ga0466699_051861 Ga0466699_051861_2977_4059 360
158 3300042602 Ga0466713_137341 Ga0466713_137341_14_1096 360
159 3300042604 Ga0466717_305009 Ga0466717_305009_3293_4378 361
160 3300042654 Ga0466725_407550 Ga0466725_407550_1016_2140 374
161 iso_pr_bacteria 2593339125 2595066000 382

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00994 MoCF_biosynth Probable molybdopterin binding domain 216 347 0.84

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.