Protein Family IF11056
Metagenome
Isolate
128
Members
70
Samples
114
Scaffolds
217.4
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2590828803|2592928651|
- Length
- 250 aa
- Sequence
- MLKKERYQEFVAYFSKHQPQAETELHYSNPFELLIAVILSAQCTDKRINQITPKLFERYPTPESLAASTAEEVFTYIRSVSYPNNKSKHLVGMAKILVEEFGGIVPEDVKDLQKMPGVGRKTANVIASVIYNAPTMAVDTHVFRVSNRLGLTSAAKTPLAVEKQLTKYLPQDKIHIAHHWLILHGRYVCIARNPKCEICPISYFCKYYALQNTPAALLRKEQAELKKAVQKKKLAQKKQLAKALKKRAVK
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.0%
Kalotermitidae
17.7%
Armadillidiidae
9.7%
Culicidae
8.1%
Drosophilidae
6.5%
Unclassified
6.5%
Termopsidae
4.8%
Rhinotermitidae
3.2%
Passalidae
3.2%
Formicidae
1.6%
Bombycidae
1.6%
Daphniidae
1.6%
Hydrophilidae
1.6%
Apidae
1.6%
Elmidae
1.6%
Blattidae
1.6%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 9 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 26 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 27 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 32 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 44 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 45 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 50 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 51 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 52 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 53 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 54 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 58 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 60 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 61 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 64 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 65 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 66 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 67 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 70 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_312237 | 3300042613 | Bacteria | 6688 |
| 2 | Ga0466711_246690 | 3300042615 | Bacteria | 9487 |
| 3 | Ga0466719_142628 | 3300042606 | Bacteria | 2154 |
| 4 | Ga0466722_244590 | 3300042609 | Bacteria | 6098 |
| 5 | Ga0123357_10173344 | 3300009784 | Bacteria | 2544 |
| 6 | Ga0123357_10304636 | 3300009784 | Bacteria | 1602 |
| 7 | Ga0123355_10922622 | 3300009826 | Bacteria | 944 |
| 8 | Ga0466724_20098 | 3300042649 | Bacteria | 21220 |
| 9 | Ga0160455_100004 | 3300012837 | Bacteria | 1044325 |
| 10 | Ga0466657_401792 | 3300042582 | Bacteria | 4099 |
| 11 | Ga0466696_065557 | 3300042596 | Bacteria | 2940 |
| 12 | 2227205807 | 2225789004 | Bacteria | 7692 |
| 13 | Ga0072941_1507140 | 3300005201 | Bacteria | 1382 |
| 14 | Ga0104045_1026875 | 3300007085 | Bacteria | 3214 |
| 15 | Ga0105005_1031046 | 3300007505 | Unclassified | 2681 |
| 16 | Ga0466715_023087 | 3300042616 | Bacteria | 3019 |
| 17 | Ga0466723_046824 | 3300042618 | Bacteria | 57163 |
| 18 | Ga0466726_229581 | 3300042619 | Bacteria | 4485 |
| 19 | Ga0466707_051492 | 3300042601 | Bacteria | 6352 |
| 20 | Ga0466714_068261 | 3300042603 | Bacteria | 2499 |
| 21 | Ga0466716_427145 | 3300042605 | Bacteria | 20038 |
| 22 | Ga0466724_18924 | 3300042649 | Bacteria | 1157 |
| 23 | Ga0466725_244094 | 3300042654 | Bacteria | 1262 |
| 24 | Ga0160453_100100 | 3300012814 | Bacteria | 87119 |
| 25 | Ga0160452_100844 | 3300012834 | Bacteria | 12815 |
| 26 | Ga0160446_100031 | 3300012835 | Bacteria | 163435 |
| 27 | Ga0160472_102994 | 3300012839 | Unclassified | 3531 |
| 28 | Ga0160457_1000009 | 3300012858 | Bacteria | 506736 |
| 29 | Ga0160457_1000646 | 3300012858 | Bacteria | 13554 |
| 30 | Ga0160457_1007749 | 3300012858 | Bacteria | 1563 |
| 31 | Ga0104050_1202230 | 3300007153 | Bacteria | 1655 |
| 32 | Ga0105005_1104131 | 3300007505 | Unclassified | 3130 |
| 33 | Ga0105005_1116153 | 3300007505 | Bacteria | 1807 |
| 34 | Ga0466697_175217 | 3300042611 | Bacteria | 24944 |
| 35 | Ga0466711_044603 | 3300042615 | Bacteria | 28836 |
| 36 | Ga0466723_177221 | 3300042618 | Bacteria | 14498 |
| 37 | Ga0123356_10204304 | 3300010049 | Bacteria | 2018 |
| 38 | Ga0123356_10762119 | 3300010049 | Bacteria | 1138 |
| 39 | Ga0123353_10615329 | 3300010167 | Bacteria | 1548 |
| 40 | Ga0160442_103749 | 3300012806 | Unclassified | 1580 |
| 41 | Ga0466727_110836 | 3300042655 | Bacteria | 19836 |
| 42 | Ga0160472_100133 | 3300012839 | Bacteria | 115645 |
| 43 | Ga0466690_015788 | 3300042590 | Bacteria | 4078 |
| 44 | Ga0072941_1093178 | 3300005201 | Bacteria | 1688 |
| 45 | Ga0466710_272009 | 3300042613 | Bacteria | 3254 |
| 46 | Ga0466712_274032 | 3300042614 | Bacteria | 1046 |
| 47 | Ga0466714_067326 | 3300042603 | Bacteria | 3387 |
| 48 | Ga0466722_260190 | 3300042609 | Bacteria | 7052 |
| 49 | Ga0466735_042432 | 3300042624 | Bacteria | 2442 |
| 50 | Ga0466735_159877 | 3300042624 | Bacteria | 16168 |
| 51 | Ga0160470_100512 | 3300012813 | Bacteria | 15579 |
| 52 | Ga0160469_109797 | 3300012824 | Unclassified | 845 |
| 53 | Ga0466657_041081 | 3300042582 | Bacteria | 5506 |
| 54 | Ga0466696_506800 | 3300042596 | Bacteria | 9676 |
| 55 | JGI24702J35022_10000680 | 3300002462 | Bacteria | 20715 |
| 56 | Ga0466697_254592 | 3300042611 | Bacteria | 16415 |
| 57 | Ga0466715_064301 | 3300042616 | Bacteria | 4106 |
| 58 | Ga0466716_468884 | 3300042605 | Bacteria | 5168 |
| 59 | Ga0123357_10006248 | 3300009784 | Bacteria | 14478 |
| 60 | Ga0123357_10133013 | 3300009784 | Bacteria | 3088 |
| 61 | Ga0123357_10408989 | 3300009784 | Bacteria | 1225 |
| 62 | Ga0123357_10429783 | 3300009784 | Unclassified | 1168 |
| 63 | Ga0466734_039470 | 3300042623 | Bacteria | 1049 |
| 64 | Ga0466704_086086 | 3300042643 | Bacteria | 7177 |
| 65 | Ga0466724_47745 | 3300042649 | Bacteria | 3261 |
| 66 | Ga0160444_101701 | 3300012841 | Bacteria | 3812 |
| 67 | Ga0160435_1003758 | 3300012857 | Bacteria | 3558 |
| 68 | Ga0160457_1001333 | 3300012858 | Bacteria | 7028 |
| 69 | Ga0466690_273332 | 3300042590 | Bacteria | 9975 |
| 70 | 2227596020 | 2225789004 | Bacteria | 2380 |
| 71 | Ga0104048_1022162 | 3300007143 | Bacteria | 11480 |
| 72 | Ga0466705_003668 | 3300042612 | Bacteria | 18332 |
| 73 | Ga0466723_367247 | 3300042618 | Bacteria | 38308 |
| 74 | Ga0466701_103254 | 3300042598 | Bacteria | 3792 |
| 75 | Ga0466719_000558 | 3300042606 | Unclassified | 2391 |
| 76 | Ga0123353_10711931 | 3300010167 | Bacteria | 1406 |
| 77 | Ga0123353_11639831 | 3300010167 | Bacteria | 809 |
| 78 | Ga0466735_194256 | 3300042624 | Bacteria | 1271 |
| 79 | Ga0466704_370636 | 3300042643 | Bacteria | 2485 |
| 80 | Ga0466709_294666 | 3300042648 | Bacteria | 2861 |
| 81 | Ga0160453_100225 | 3300012814 | Bacteria | 54739 |
| 82 | Ga0160433_100376 | 3300012846 | Bacteria | 25407 |
| 83 | Ga0415639_208716 | 3300038395 | Bacteria | 2371 |
| 84 | Ga0102735_1002055 | 3300007080 | Bacteria | 5557 |
| 85 | Ga0104045_1003484 | 3300007085 | Bacteria | 5278 |
| 86 | Ga0466705_064959 | 3300042612 | Bacteria | 1661 |
| 87 | Ga0466733_089158 | 3300042659 | Bacteria | 1500 |
| 88 | Ga0466711_008567 | 3300042615 | Bacteria | 15554 |
| 89 | Ga0466715_104419 | 3300042616 | Bacteria | 3098 |
| 90 | Ga0466701_056777 | 3300042598 | Bacteria | 2858 |
| 91 | Ga0466716_483581 | 3300042605 | Bacteria | 3347 |
| 92 | Ga0123353_10019346 | 3300010167 | Bacteria | 10112 |
| 93 | Ga0466730_053826 | 3300042625 | Bacteria | 92011 |
| 94 | Ga0466709_284581 | 3300042648 | Bacteria | 42412 |
| 95 | Ga0466724_36635 | 3300042649 | Bacteria | 20132 |
| 96 | Ga0160445_100119 | 3300012847 | Bacteria | 69517 |
| 97 | Ga0160445_101787 | 3300012847 | Unclassified | 5603 |
| 98 | Ga0160447_100023 | 3300012849 | Bacteria | 248054 |
| 99 | Ga0160447_106237 | 3300012849 | Unclassified | 3181 |
| 100 | Ga0466692_164014 | 3300042591 | Bacteria | 3697 |
| 101 | IMNBL1DRAFT_c0002211 | 3300000062 | Unclassified | 13716 |
| 102 | JGI24702J35022_10037152 | 3300002462 | Bacteria | 2601 |
| 103 | Ga0466715_241574 | 3300042616 | Bacteria | 1918 |
| 104 | Ga0466715_524738 | 3300042616 | Bacteria | 26476 |
| 105 | Ga0466701_061827 | 3300042598 | Bacteria | 11464 |
| 106 | Ga0466719_095217 | 3300042606 | Bacteria | 1271 |
| 107 | Ga0123357_10118659 | 3300009784 | Bacteria | 3342 |
| 108 | Ga0123353_10172441 | 3300010167 | Bacteria | 3432 |
| 109 | Ga0123353_10517778 | 3300010167 | Bacteria | 1732 |
| 110 | Ga0466735_048139 | 3300042624 | Bacteria | 1756 |
| 111 | Ga0466735_228991 | 3300042624 | Bacteria | 9990 |
| 112 | Ga0466703_055614 | 3300042636 | Bacteria | 1372 |
| 113 | Ga0466693_407715 | 3300042592 | Bacteria | 1697 |
| 114 | JGI24702J35022_10016763 | 3300002462 | Bacteria | 4013 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005201 | Ga0072941_1507140 | Ga0072941_15071402 | 205 |
| 2 | 3300042648 | Ga0466709_294666 | Ga0466709_294666_1807_2433 | 208 |
| 3 | 3300042649 | Ga0466724_47745 | Ga0466724_47745_807_1433 | 208 |
| 4 | 3300042598 | Ga0466701_056777 | Ga0466701_056777_1187_1816 | 209 |
| 5 | 3300042605 | Ga0466716_468884 | Ga0466716_468884_4255_4884 | 209 |
| 6 | 3300009826 | Ga0123355_10922622 | Ga0123355_109226221 | 210 |
| 7 | 3300010167 | Ga0123353_10711931 | Ga0123353_107119312 | 210 |
| 8 | 3300010167 | Ga0123353_11639831 | Ga0123353_116398311 | 210 |
| 9 | 3300042598 | Ga0466701_103254 | Ga0466701_103254_2103_2735 | 210 |
| 10 | 3300042601 | Ga0466707_051492 | Ga0466707_051492_1197_1829 | 210 |
| 11 | 3300042603 | Ga0466714_067326 | Ga0466714_067326_1615_2247 | 210 |
| 12 | 3300042616 | Ga0466715_104419 | Ga0466715_104419_478_1110 | 210 |
| 13 | 3300042618 | Ga0466723_046824 | Ga0466723_046824_9525_10157 | 210 |
| 14 | 3300042623 | Ga0466734_039470 | Ga0466734_039470_121_753 | 210 |
| 15 | 3300042624 | Ga0466735_048139 | Ga0466735_048139_340_972 | 210 |
| 16 | 3300042624 | Ga0466735_228991 | Ga0466735_228991_914_1546 | 210 |
| 17 | 3300042655 | Ga0466727_110836 | Ga0466727_110836_1548_2180 | 210 |
| 18 | 3300038395 | Ga0415639_208716 | Ga0415639_208716_844_1479 | 211 |
| 19 | 3300042582 | Ga0466657_401792 | Ga0466657_401792_1643_2278 | 211 |
| 20 | 3300042592 | Ga0466693_407715 | Ga0466693_407715_878_1513 | 211 |
| 21 | 3300042596 | Ga0466696_065557 | Ga0466696_065557_115_750 | 211 |
| 22 | 3300042598 | Ga0466701_061827 | Ga0466701_061827_1978_2613 | 211 |
| 23 | 3300042609 | Ga0466722_244590 | Ga0466722_244590_2067_2702 | 211 |
| 24 | 3300042611 | Ga0466697_175217 | Ga0466697_175217_23287_23922 | 211 |
| 25 | 3300042611 | Ga0466697_254592 | Ga0466697_254592_2374_3009 | 211 |
| 26 | 3300042612 | Ga0466705_064959 | Ga0466705_064959_454_1089 | 211 |
| 27 | 3300042614 | Ga0466712_274032 | Ga0466712_274032_358_993 | 211 |
| 28 | 3300042615 | Ga0466711_246690 | Ga0466711_246690_7618_8253 | 211 |
| 29 | 2225789004 | 2227205807 | 2227633051 | 212 |
| 30 | 3300009784 | Ga0123357_10133013 | Ga0123357_101330133 | 212 |
| 31 | 3300009784 | Ga0123357_10304636 | Ga0123357_103046362 | 212 |
| 32 | 3300042615 | Ga0466711_008567 | Ga0466711_008567_3623_4261 | 212 |
| 33 | 3300042615 | Ga0466711_044603 | Ga0466711_044603_26795_27433 | 212 |
| 34 | 3300042616 | Ga0466715_023087 | Ga0466715_023087_2107_2745 | 212 |
| 35 | 3300042624 | Ga0466735_159877 | Ga0466735_159877_966_1604 | 212 |
| 36 | iso_pr_bacteria | 2940216256 | 2940217344 | 212 |
| 37 | 2225789004 | 2227596020 | 2228158650 | 213 |
| 38 | 3300009784 | Ga0123357_10429783 | Ga0123357_104297831 | 213 |
| 39 | 3300010167 | Ga0123353_10615329 | Ga0123353_106153292 | 213 |
| 40 | 3300012824 | Ga0160469_109797 | Ga0160469_1097971 | 213 |
| 41 | 3300012847 | Ga0160445_100119 | Ga0160445_10011959 | 213 |
| 42 | 3300042590 | Ga0466690_015788 | Ga0466690_015788_590_1231 | 213 |
| 43 | 3300042596 | Ga0466696_506800 | Ga0466696_506800_6556_7197 | 213 |
| 44 | 3300042612 | Ga0466705_003668 | Ga0466705_003668_5006_5647 | 213 |
| 45 | 3300042624 | Ga0466735_042432 | Ga0466735_042432_829_1470 | 213 |
| 46 | 3300042636 | Ga0466703_055614 | Ga0466703_055614_346_987 | 213 |
| 47 | 3300042643 | Ga0466704_086086 | Ga0466704_086086_3022_3663 | 213 |
| 48 | 3300042659 | Ga0466733_089158 | Ga0466733_089158_741_1382 | 213 |
| 49 | 3300000062 | IMNBL1DRAFT_c0002211 | IMNBL1DRAFT_00022116 | 214 |
| 50 | 3300009784 | Ga0123357_10173344 | Ga0123357_101733443 | 214 |
| 51 | 3300010049 | Ga0123356_10204304 | Ga0123356_102043042 | 214 |
| 52 | 3300012858 | Ga0160457_1007749 | Ga0160457_10077494 | 214 |
| 53 | 3300042605 | Ga0466716_427145 | Ga0466716_427145_8876_9520 | 214 |
| 54 | 3300042606 | Ga0466719_095217 | Ga0466719_095217_214_858 | 214 |
| 55 | 3300042609 | Ga0466722_260190 | Ga0466722_260190_3953_4597 | 214 |
| 56 | 3300042616 | Ga0466715_241574 | Ga0466715_241574_722_1366 | 214 |
| 57 | 3300042618 | Ga0466723_367247 | Ga0466723_367247_6622_7266 | 214 |
| 58 | 3300042590 | Ga0466690_273332 | Ga0466690_273332_8301_8948 | 215 |
| 59 | 3300042591 | Ga0466692_164014 | Ga0466692_164014_159_806 | 215 |
| 60 | 3300042603 | Ga0466714_068261 | Ga0466714_068261_882_1529 | 215 |
| 61 | 3300042605 | Ga0466716_483581 | Ga0466716_483581_119_766 | 215 |
| 62 | 3300042606 | Ga0466719_142628 | Ga0466719_142628_256_903 | 215 |
| 63 | 3300042618 | Ga0466723_177221 | Ga0466723_177221_13291_13938 | 215 |
| 64 | 3300042619 | Ga0466726_229581 | Ga0466726_229581_1311_1958 | 215 |
| 65 | 3300042643 | Ga0466704_370636 | Ga0466704_370636_12_659 | 215 |
| 66 | 3300009784 | Ga0123357_10408989 | Ga0123357_104089892 | 216 |
| 67 | 3300012813 | Ga0160470_100512 | Ga0160470_1005124 | 216 |
| 68 | 3300012834 | Ga0160452_100844 | Ga0160452_1008449 | 216 |
| 69 | 3300012837 | Ga0160455_100004 | Ga0160455_100004320 | 216 |
| 70 | 3300042624 | Ga0466735_194256 | Ga0466735_194256_347_997 | 216 |
| 71 | 3300042654 | Ga0466725_244094 | Ga0466725_244094_426_1076 | 216 |
| 72 | 3300002462 | JGI24702J35022_10016763 | JGI24702J35022_100167631 | 217 |
| 73 | 3300042613 | Ga0466710_272009 | Ga0466710_272009_526_1179 | 217 |
| 74 | 3300007153 | Ga0104050_1202230 | Ga0104050_12022301 | 218 |
| 75 | 3300012841 | Ga0160444_101701 | Ga0160444_1017013 | 218 |
| 76 | 3300012846 | Ga0160433_100376 | Ga0160433_1003764 | 218 |
| 77 | 3300012847 | Ga0160445_101787 | Ga0160445_1017875 | 218 |
| 78 | 3300012858 | Ga0160457_1000009 | Ga0160457_1000009425 | 218 |
| 79 | 3300012858 | Ga0160457_1001333 | Ga0160457_10013333 | 218 |
| 80 | 3300007080 | Ga0102735_1002055 | Ga0102735_10020554 | 219 |
| 81 | 3300007085 | Ga0104045_1026875 | Ga0104045_10268755 | 219 |
| 82 | 3300007143 | Ga0104048_1022162 | Ga0104048_10221622 | 219 |
| 83 | 3300010167 | Ga0123353_10019346 | Ga0123353_100193461 | 219 |
| 84 | iso_pr_bacteria | 2820762746 | 2820763124 | 219 |
| 85 | 3300005201 | Ga0072941_1093178 | Ga0072941_10931782 | 220 |
| 86 | 3300010049 | Ga0123356_10762119 | Ga0123356_107621191 | 220 |
| 87 | iso_pr_bacteria | 2820768849 | 2820769813 | 220 |
| 88 | iso_pr_bacteria | 2820774381 | 2820775482 | 220 |
| 89 | 3300002462 | JGI24702J35022_10037152 | JGI24702J35022_100371521 | 221 |
| 90 | 3300009784 | Ga0123357_10118659 | Ga0123357_101186593 | 221 |
| 91 | 3300012806 | Ga0160442_103749 | Ga0160442_1037492 | 221 |
| 92 | 3300012849 | Ga0160447_106237 | Ga0160447_1062371 | 221 |
| 93 | 3300042616 | Ga0466715_524738 | Ga0466715_524738_10685_11350 | 221 |
| 94 | 3300042648 | Ga0466709_284581 | Ga0466709_284581_34902_35567 | 221 |
| 95 | iso_pr_bacteria | 2873776654 | 2873779598 | 221 |
| 96 | 3300010167 | Ga0123353_10517778 | Ga0123353_105177782 | 222 |
| 97 | 3300012814 | Ga0160453_100100 | Ga0160453_10010021 | 222 |
| 98 | 3300012835 | Ga0160446_100031 | Ga0160446_10003130 | 222 |
| 99 | 3300012839 | Ga0160472_100133 | Ga0160472_1001339 | 222 |
| 100 | 3300012839 | Ga0160472_102994 | Ga0160472_1029942 | 222 |
| 101 | 3300012849 | Ga0160447_100023 | Ga0160447_10002344 | 222 |
| 102 | 3300012858 | Ga0160457_1000646 | Ga0160457_10006468 | 222 |
| 103 | 3300007085 | Ga0104045_1003484 | Ga0104045_10034844 | 223 |
| 104 | 3300009784 | Ga0123357_10006248 | Ga0123357_1000624814 | 223 |
| 105 | 3300042649 | Ga0466724_20098 | Ga0466724_20098_717_1388 | 223 |
| 106 | iso_pr_bacteria | 2579779088 | 2582237126 | 223 |
| 107 | 3300042606 | Ga0466719_000558 | Ga0466719_000558_1345_2019 | 224 |
| 108 | iso_pr_bacteria | 2896321640 | 2896323766 | 224 |
| 109 | iso_pr_bacteria | 2896330536 | 2896331849 | 224 |
| 110 | iso_pr_bacteria | 2896350215 | 2896351660 | 224 |
| 111 | iso_pr_bacteria | 2898741527 | 2898744006 | 224 |
| 112 | iso_pr_bacteria | 2898741527 | 2898745572 | 224 |
| 113 | 3300042649 | Ga0466724_36635 | Ga0466724_36635_2991_3668 | 225 |
| 114 | iso_pr_bacteria | 2864836148 | 2864836508 | 225 |
| 115 | 3300007505 | Ga0105005_1104131 | Ga0105005_11041314 | 226 |
| 116 | 3300012814 | Ga0160453_100225 | Ga0160453_10022516 | 226 |
| 117 | 3300042582 | Ga0466657_041081 | Ga0466657_041081_3118_3801 | 227 |
| 118 | iso_pr_bacteria | 8065497608 | 8065499581 | 227 |
| 119 | 3300042613 | Ga0466710_312237 | Ga0466710_312237_678_1364 | 228 |
| 120 | 3300010167 | Ga0123353_10172441 | Ga0123353_101724412 | 229 |
| 121 | 3300012857 | Ga0160435_1003758 | Ga0160435_10037583 | 230 |
| 122 | 3300042625 | Ga0466730_053826 | Ga0466730_053826_46258_46950 | 230 |
| 123 | 3300002462 | JGI24702J35022_10000680 | JGI24702J35022_100006802 | 231 |
| 124 | 3300007505 | Ga0105005_1031046 | Ga0105005_10310463 | 231 |
| 125 | 3300042649 | Ga0466724_18924 | Ga0466724_18924_343_1047 | 234 |
| 126 | 3300042616 | Ga0466715_064301 | Ga0466715_064301_3333_4040 | 235 |
| 127 | 3300007505 | Ga0105005_1116153 | Ga0105005_11161532 | 245 |
| 128 | iso_pr_bacteria | 2590828803 | 2592928651 | 250 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF10576 | GO:0051539 | 4 iron, 4 sulfur cluster binding | MF |
| PF00730 | GO:0006284 | base-excision repair | BP |
| PF00633 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.