Protein Family IF10930

Metagenome Isolate
191 Members
129 Samples
132 Scaffolds
341.22 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2556921669|2558277112|
Length
411 aa
Sequence
MGRFPGRAGAVLIAVALPCISGAYFFMQFRPESRFAVSRNCFTNGTRPSTRLKDIAMSAFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQEDNDCIYCVVDLHAITAQLVHEDMRSQIRSIAAAFIASGIDPKKHIVFNQSAVPQHAELAWIFNCVARIGWMERMTQFKDKTGGKNAEQVSLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNIDFGSHIRKAGTGVDIVVGEEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDASDLSRINLTDDADTISKKIRKAKTDPDALPSEAEGLKGRPEAENLVGIYAALSDKSKAEILAEFGGQQFSVFKPALIDLAVNVLSPITDEMRRLMDDTSHIDGILRDGGERARARAEKTMKEVRDIIGFVQ

📊 Sample Types

Isolate 30.9%
Metagenome 69.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 20.2%
Formicidae 14.5%
Apidae 13.7%
Termitidae 12.9%
Kalotermitidae 9.7%
Armadillidiidae 7.3%
Culicidae 3.2%
Blattidae 2.4%
Termopsidae 2.4%
Daphniidae 1.6%
Nephropidae 1.6%
Aphididae 1.6%
Rhinotermitidae 1.6%
Elmidae 1.6%
Passalidae 1.6%
Hodotermitidae 0.8%
Hydrophilidae 0.8%
Muscidae 0.8%
Cicadellidae 0.8%
Carabidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2556921669 Shinella sp. DD12 Isolate Daphniidae
2 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
3 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
4 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
5 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
6 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
7 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
11 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
12 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
13 8068946563 Bartonella apihabitans M0187 Isolate Apidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
18 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
19 2751185856 Bartonella apis BBC0244 Isolate Apidae
20 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
21 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
22 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
23 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
24 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
25 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
26 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
27 2896955351 Streptomyces sp. GF20 Isolate Termitidae
28 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
34 8073617375 Bartonella apis W8098 Isolate Apidae
35 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
40 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
41 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
42 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
43 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
44 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
45 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
46 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
47 8068953321 Bartonella apihabitans M0190 Isolate Apidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
52 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
53 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
54 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
55 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
56 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
57 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
58 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
59 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
62 8073624232 Bartonella sp. W8151 Isolate Apidae
63 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
64 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
65 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 2718218026 Phaeobacter porticola P97 Isolate Unclassified
68 2820148564 Unclassified Proteobacteria Emb289P1bin36 Isolate Unclassified
69 2820449349 Unclassified Firmicutes Lab288P3bin191 Isolate Unclassified
70 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
71 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
72 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
74 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
75 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
76 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
77 2841330038 Sulfitobacter sp. D7 Isolate
78 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
79 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
80 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
81 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
82 8068950955 Bartonella apihabitans W8097 Isolate Apidae
83 8073621894 Bartonella apis W8099 Isolate Apidae
84 2718218463 Candidatus Phytoplasma M3 Isolate Cicadellidae
85 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
86 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
87 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
88 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
89 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
90 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
91 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
92 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
93 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
94 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
95 8073626464 Bartonella apis W8152 Isolate Apidae
96 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
97 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
98 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
99 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
100 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
101 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
102 2751185858 Bartonella apis BBC0122 Isolate Apidae
103 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
104 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
105 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
106 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
107 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
108 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
109 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
112 8073619611 Bartonella apis B10834G6 Isolate Apidae
113 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
114 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
115 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
116 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
117 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
118 2751185853 Bartonella apis BBC0178 Isolate Apidae
119 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
120 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
121 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
122 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
123 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
124 2920168565 Paludibacter sp. 221 Isolate Blattidae
125 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
126 8068944069 Bartonella choladocola W8125 Isolate Apidae
127 8068955631 Bartonella apihabitans M0280 Isolate Apidae
128 8073628750 Bartonella sp. W8167 Isolate Apidae
129 8002448939 Spiroplasma endosymbiont of 'Nebria riversi' Nriv7 Isolate Carabidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_065022 3300042612 Unclassified 3987
2 Ga0123356_10053730 3300010049 Unclassified 3750
3 Ga0160464_100233 3300012805 Bacteria 54312
4 Ga0466707_075425 3300042601 Bacteria 2311
5 Ga0160459_101018 3300012831 Unclassified 8067
6 Ga0160460_104682 3300012845 Bacteria 2057
7 Ga0160443_100205 3300012848 Bacteria 76097
8 Ga0309903_100011 3300029809 Bacteria 51837
9 Ga0466730_009222 3300042625 Bacteria 34505
10 Ga0466704_160200 3300042643 Bacteria 26149
11 2227258585 2225789004 Bacteria 7025
12 2227477395 2225789004 Bacteria 22591
13 IMNBL1DRAFT_c0003860 3300000062 Bacteria 9322
14 JGI24705J35276_12237345 3300002504 Bacteria 10769
15 CVPL010W_10001313 3300002931 Unclassified 28943
16 Ga0103266_1000035 3300007067 Bacteria 107458
17 Ga0102734_1000463 3300007129 Bacteria 12858
18 Ga0103264_1000102 3300007188 Bacteria 49840
19 Ga0103264_1017723 3300007188 Bacteria 3701
20 Ga0127649_105736 3300009460 Bacteria 31423
21 Ga0123357_10000770 3300009784 Bacteria 32362
22 Ga0466726_408311 3300042619 Bacteria 1593
23 Ga0123355_10164631 3300009826 Bacteria 3331
24 Ga0123355_10706401 3300009826 Bacteria 1156
25 Ga0466701_033542 3300042598 Bacteria 9047
26 Ga0466713_132879 3300042602 Bacteria 21057
27 Ga0466714_073602 3300042603 Bacteria 3636
28 Ga0466716_540993 3300042605 Bacteria 22338
29 Ga0466698_130310 3300042610 Bacteria 5067
30 Ga0160443_103880 3300012848 Bacteria 2428
31 Ga0466657_250077 3300042582 Bacteria 3209
32 Ga0466735_119940 3300042624 Bacteria 2604
33 Ga0466703_149023 3300042636 Bacteria 13490
34 Ga0466727_345386 3300042655 Bacteria 3502
35 CVPL010W_10000656 3300002931 Bacteria 38021
36 Ga0074278_131423 3300005721 Unclassified 4999
37 Ga0103264_1009122 3300007188 Bacteria 8938
38 Ga0466711_256523 3300042615 Bacteria 3243
39 Ga0466726_123791 3300042619 Bacteria 6008
40 Ga0466726_265925 3300042619 Bacteria 2543
41 Ga0466705_176980 3300042612 Bacteria 3299
42 Ga0123355_10297828 3300009826 Bacteria 2203
43 Ga0123356_10011372 3300010049 Bacteria 8682
44 Ga0466706_223543 3300042599 Bacteria 1355
45 Ga0160469_103849 3300012824 Unclassified 1910
46 Ga0160441_100018 3300012825 Bacteria 285148
47 Ga0160457_1003886 3300012858 Bacteria 2493
48 Ga0466690_269609 3300042590 Bacteria 12430
49 Ga0466694_225797 3300042594 Bacteria 1651
50 Ga0466696_128689 3300042596 Bacteria 3240
51 Ga0466696_401137 3300042596 Bacteria 1489
52 Ga0466704_231546 3300042643 Bacteria 11049
53 CVPL010W_10000074 3300002931 Bacteria 66706
54 Ga0123355_10024154 3300009826 Bacteria 9764
55 Ga0123355_10056576 3300009826 Bacteria 6346
56 Ga0123353_10495681 3300010167 Bacteria 1782
57 Ga0160467_104596 3300012829 Bacteria 1920
58 Ga0160446_100044 3300012835 Bacteria 130318
59 Ga0160433_100111 3300012846 Bacteria 79834
60 Ga0160445_100311 3300012847 Bacteria 29371
61 Ga0160445_100811 3300012847 Bacteria 11652
62 Ga0160445_101179 3300012847 Bacteria 8059
63 Ga0160443_100864 3300012848 Bacteria 14421
64 Ga0160457_1000001 3300012858 Bacteria 1192173
65 Ga0466696_255888 3300042596 Bacteria 16827
66 Ga0466735_143562 3300042624 Bacteria 85207
67 Ga0466704_461185 3300042643 Bacteria 28981
68 Ga0102736_1005791 3300007052 Bacteria 1558
69 Ga0102734_1000557 3300007129 Bacteria 10516
70 Ga0102738_1000011 3300007141 Bacteria 105735
71 Ga0466723_301081 3300042618 Bacteria 11213
72 Ga0466729_114703 3300042621 Bacteria 8889
73 Ga0123355_10206618 3300009826 Bacteria 2856
74 Ga0123355_10472869 3300009826 Bacteria 1565
75 Ga0123355_10740005 3300009826 Bacteria 1115
76 Ga0466713_017950 3300042602 Bacteria 56336
77 Ga0466716_111154 3300042605 Bacteria 5914
78 Ga0160460_100032 3300012845 Bacteria 316932
79 Ga0255572_1000007 3300026175 Bacteria 235375
80 Ga0309902_000003 3300028910 Bacteria 117768
81 Ga0309904_1000015 3300029810 Bacteria 39496
82 Ga0316159_10066 3300030930 Bacteria 18084
83 Ga0466709_014514 3300042648 Bacteria 492815
84 CVPL010W_10000177 3300002931 Bacteria 55052
85 CVPL005L_10002445 3300002938 Bacteria 28796
86 CVPL005L_10019783 3300002938 Bacteria 7425
87 Ga0127656_100969 3300009453 Bacteria 16558
88 Ga0466726_444899 3300042619 Bacteria 2272
89 Ga0123355_10071574 3300009826 Bacteria 5565
90 Ga0123355_10341941 3300009826 Bacteria 1992
91 Ga0123355_10570442 3300009826 Bacteria 1358
92 Ga0123353_10128629 3300010167 Unclassified 4067
93 Ga0160446_100015 3300012835 Bacteria 268940
94 Ga0160444_100088 3300012841 Bacteria 120536
95 Ga0160460_100168 3300012845 Bacteria 72821
96 Ga0466696_451563 3300042596 Bacteria 2302
97 Ga0466727_317010 3300042655 Bacteria 1333
98 IMNBL1DRAFT_c0025621 3300000062 Bacteria 2258
99 Ga0466728_390129 3300042620 Bacteria 16264
100 Ga0466732_028661 3300042656 Bacteria 90899
101 Ga0123355_10006597 3300009826 Bacteria 17222
102 Ga0123355_10050076 3300009826 Bacteria 6788
103 Ga0123355_10126663 3300009826 Bacteria 3945
104 Ga0123355_10141806 3300009826 Bacteria 3675
105 Ga0123355_10730839 3300009826 Bacteria 1126
106 Ga0466706_028791 3300042599 Bacteria 17709
107 Ga0466707_083251 3300042601 Bacteria 4353
108 Ga0466719_336472 3300042606 Bacteria 54006
109 Ga0160468_100062 3300012819 Bacteria 150650
110 Ga0160467_100145 3300012829 Bacteria 100492
111 Ga0160455_100499 3300012837 Unclassified 19467
112 Ga0160447_100001 3300012849 Bacteria 804378
113 IMNBL1DRAFT_c0004948 3300000062 Unclassified 7788
114 JGI24702J35022_10042924 3300002462 Bacteria 2408
115 CVPL005W_1001061 3300002934 Bacteria 8288
116 Ga0074278_110995 3300005721 Bacteria 14615
117 Ga0102739_1006303 3300007095 Bacteria 1599
118 Ga0466715_311065 3300042616 Bacteria 7645
119 Ga0466726_030519 3300042619 Bacteria 34235
120 Ga0160464_107585 3300012805 Bacteria 1095
121 Ga0466716_149833 3300042605 Bacteria 35494
122 Ga0466716_224633 3300042605 Bacteria 16907
123 Ga0466722_195162 3300042609 Bacteria 20316
124 Ga0160433_100052 3300012846 Bacteria 131130
125 Ga0160443_102895 3300012848 Bacteria 3360
126 Ga0309901_1000013 3300028918 Bacteria 346588
127 Ga0466696_126250 3300042596 Bacteria 16468
128 Ga0466724_47345 3300042649 Bacteria 162557
129 CVPL010L_1000063 3300002932 Bacteria 48906
130 Ga0103264_1000080 3300007188 Bacteria 75180
131 Ga0466726_386331 3300042619 Bacteria 7603
132 Ga0466728_071660 3300042620 Bacteria 25955

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820546020 2820546593 291
2 3300012829 Ga0160467_104596 Ga0160467_1045963 304
3 3300042605 Ga0466716_111154 Ga0466716_111154_3820_4761 313
4 3300012837 Ga0160455_100499 Ga0160455_1004998 325
5 iso_pr_bacteria 2576861701 2579270094 327
6 3300012825 Ga0160441_100018 Ga0160441_10001858 328
7 3300012848 Ga0160443_100205 Ga0160443_10020534 328
8 3300042590 Ga0466690_269609 Ga0466690_269609_8941_9927 328
9 3300042605 Ga0466716_224633 Ga0466716_224633_8886_9872 328
10 3300042621 Ga0466729_114703 Ga0466729_114703_159_1145 328
11 3300042636 Ga0466703_149023 Ga0466703_149023_8827_9813 328
12 iso_pr_bacteria 2940195863 2940197172 328
13 2225789004 2227258585 2227704095 329
14 3300002462 JGI24702J35022_10042924 JGI24702J35022_100429241 329
15 3300009826 Ga0123355_10050076 Ga0123355_100500762 329
16 3300042601 Ga0466707_075425 Ga0466707_075425_555_1544 329
17 3300042601 Ga0466707_083251 Ga0466707_083251_3345_4334 329
18 3300042612 Ga0466705_065022 Ga0466705_065022_2266_3255 329
19 3300042615 Ga0466711_256523 Ga0466711_256523_125_1114 329
20 3300042618 Ga0466723_301081 Ga0466723_301081_9982_10971 329
21 3300042624 Ga0466735_119940 Ga0466735_119940_281_1270 329
22 3300042643 Ga0466704_160200 Ga0466704_160200_14645_15634 329
23 3300012847 Ga0160445_101179 Ga0160445_1011795 330
24 3300042594 Ga0466694_225797 Ga0466694_225797_385_1377 330
25 3300042596 Ga0466696_451563 Ga0466696_451563_417_1409 330
26 3300042612 Ga0466705_176980 Ga0466705_176980_2287_3279 330
27 3300042620 Ga0466728_071660 Ga0466728_071660_319_1311 330
28 3300042620 Ga0466728_390129 Ga0466728_390129_13909_14901 330
29 3300042643 Ga0466704_231546 Ga0466704_231546_1328_2320 330
30 3300042643 Ga0466704_461185 Ga0466704_461185_15307_16299 330
31 3300042655 Ga0466727_345386 Ga0466727_345386_512_1504 330
32 iso_pr_bacteria 2940202316 2940202871 330
33 3300042596 Ga0466696_126250 Ga0466696_126250_8939_9934 331
34 3300042596 Ga0466696_255888 Ga0466696_255888_2380_3375 331
35 3300042599 Ga0466706_028791 Ga0466706_028791_256_1251 331
36 3300042602 Ga0466713_017950 Ga0466713_017950_44062_45057 331
37 3300042603 Ga0466714_073602 Ga0466714_073602_1944_2939 331
38 3300042616 Ga0466715_311065 Ga0466715_311065_857_1852 331
39 3300042619 Ga0466726_265925 Ga0466726_265925_1442_2437 331
40 3300042619 Ga0466726_444899 Ga0466726_444899_139_1134 331
41 3300042656 Ga0466732_028661 Ga0466732_028661_42015_43010 331
42 iso_pr_bacteria 2590828803 2592927786 331
43 iso_pr_bacteria 2820449349 2820449766 331
44 iso_pr_bacteria 2820789850 2820790579 331
45 iso_pr_bacteria 2896955351 2896957948 331
46 iso_pr_bacteria 2920168565 2920169387 331
47 iso_pr_bacteria 8077783556 8077786068 331
48 2225789004 2227477395 2227931158 332
49 3300010167 Ga0123353_10128629 Ga0123353_101286292 332
50 3300012819 Ga0160468_100062 Ga0160468_10006241 332
51 3300012829 Ga0160467_100145 Ga0160467_10014559 332
52 3300012841 Ga0160444_100088 Ga0160444_10008888 332
53 3300012846 Ga0160433_100052 Ga0160433_10005281 332
54 3300012846 Ga0160433_100111 Ga0160433_10011140 332
55 3300012847 Ga0160445_100811 Ga0160445_1008115 332
56 3300012848 Ga0160443_103880 Ga0160443_1038803 332
57 3300042605 Ga0466716_149833 Ga0466716_149833_12580_13578 332
58 iso_pr_bacteria 2873776654 2873781391 332
59 iso_pr_bacteria 8053361298 8053361891 332
60 3300000062 IMNBL1DRAFT_c0004948 IMNBL1DRAFT_00049487 333
61 3300000062 IMNBL1DRAFT_c0025621 IMNBL1DRAFT_00256212 333
62 3300009826 Ga0123355_10164631 Ga0123355_101646311 333
63 3300010049 Ga0123356_10011372 Ga0123356_100113724 333
64 3300012805 Ga0160464_100233 Ga0160464_10023322 333
65 3300012805 Ga0160464_107585 Ga0160464_1075851 333
66 3300012835 Ga0160446_100015 Ga0160446_10001576 333
67 3300012845 Ga0160460_100032 Ga0160460_10003215 333
68 3300012849 Ga0160447_100001 Ga0160447_100001567 333
69 3300012858 Ga0160457_1003886 Ga0160457_10038863 333
70 3300042606 Ga0466719_336472 Ga0466719_336472_17677_18678 333
71 3300042609 Ga0466722_195162 Ga0466722_195162_9105_10106 333
72 3300042619 Ga0466726_030519 Ga0466726_030519_5187_6188 333
73 3300042619 Ga0466726_408311 Ga0466726_408311_531_1532 333
74 3300042624 Ga0466735_143562 Ga0466735_143562_12136_13137 333
75 3300042648 Ga0466709_014514 Ga0466709_014514_34401_35402 333
76 iso_pr_bacteria 2681813507 2684382717 333
77 3300009826 Ga0123355_10206618 Ga0123355_102066182 334
78 3300012858 Ga0160457_1000001 Ga0160457_1000001504 334
79 3300042619 Ga0466726_386331 Ga0466726_386331_333_1337 334
80 3300009826 Ga0123355_10071574 Ga0123355_100715742 335
81 3300042655 Ga0466727_317010 Ga0466727_317010_196_1260 335
82 iso_pr_bacteria 2718218463 2721569804 335
83 iso_pr_bacteria 2820280018 2820282473 335
84 iso_pr_bacteria 8002448939 8002450095 335
85 3300009826 Ga0123355_10297828 Ga0123355_102978282 336
86 3300042599 Ga0466706_223543 Ga0466706_223543_69_1079 336
87 3300042610 Ga0466698_130310 Ga0466698_130310_2287_3297 336
88 iso_pr_bacteria 2820516196 2820516651 336
89 3300009826 Ga0123355_10024154 Ga0123355_1002415411 337
90 3300009826 Ga0123355_10056576 Ga0123355_100565768 337
91 3300009826 Ga0123355_10341941 Ga0123355_103419412 337
92 3300042596 Ga0466696_401137 Ga0466696_401137_388_1401 337
93 3300009826 Ga0123355_10126663 Ga0123355_101266633 338
94 3300042605 Ga0466716_540993 Ga0466716_540993_15038_16054 338
95 iso_pr_bacteria 2820533259 2820534973 338
96 iso_pr_bacteria 2841330038 2841330613 338
97 3300009826 Ga0123355_10006597 Ga0123355_1000659710 339
98 3300042619 Ga0466726_123791 Ga0466726_123791_1586_2605 339
99 iso_pr_bacteria 2507262005 2507288042 339
100 iso_pr_bacteria 2835143510 2835145491 339
101 iso_pr_bacteria 648861007 648921463 339
102 3300000062 IMNBL1DRAFT_c0003860 IMNBL1DRAFT_00038608 340
103 3300009453 Ga0127656_100969 Ga0127656_1009697 340
104 3300012831 Ga0160459_101018 Ga0160459_1010182 340
105 3300012835 Ga0160446_100044 Ga0160446_10004447 340
106 3300012845 Ga0160460_100168 Ga0160460_10016830 340
107 iso_pr_bacteria 2806310572 2806766232 340
108 iso_pr_bacteria 2820512088 2820512307 340
109 3300009826 Ga0123355_10570442 Ga0123355_105704421 341
110 3300009826 Ga0123355_10706401 Ga0123355_107064011 341
111 3300009826 Ga0123355_10740005 Ga0123355_107400051 341
112 iso_pr_bacteria 2711768164 2712505299 342
113 iso_pr_bacteria 2718218026 2719802185 342
114 iso_pr_bacteria 2816332503 2818125385 342
115 iso_pr_bacteria 2816332545 2818334764 342
116 iso_pr_bacteria 2820240463 2820240890 342
117 iso_pr_bacteria 2820290662 2820291936 342
118 iso_pr_bacteria 2820483401 2820485053 342
119 3300005721 Ga0074278_131423 Ga0074278_1314235 343
120 iso_pr_bacteria 2839785767 2839789234 343
121 iso_pr_bacteria 2820146621 2820147614 344
122 iso_pr_bacteria 2820148564 2820149867 344
123 3300009826 Ga0123355_10141806 Ga0123355_101418063 345
124 3300010049 Ga0123356_10053730 Ga0123356_100537302 345
125 3300012845 Ga0160460_104682 Ga0160460_1046822 345
126 3300042602 Ga0466713_132879 Ga0466713_132879_4080_5117 345
127 3300010167 Ga0123353_10495681 Ga0123353_104956812 346
128 3300042582 Ga0466657_250077 Ga0466657_250077_1868_2908 346
129 3300042596 Ga0466696_128689 Ga0466696_128689_264_1304 346
130 3300042625 Ga0466730_009222 Ga0466730_009222_32714_33754 346
131 iso_pr_bacteria 2695420964 2698253675 346
132 3300002932 CVPL010L_1000063 CVPL010L_10000639 347
133 3300007188 Ga0103264_1009122 Ga0103264_10091226 347
134 3300009826 Ga0123355_10472869 Ga0123355_104728691 349
135 3300009826 Ga0123355_10730839 Ga0123355_107308391 349
136 3300012848 Ga0160443_102895 Ga0160443_1028952 349
137 iso_pr_bacteria 2820115951 2820117998 350
138 3300002504 JGI24705J35276_12237345 JGI24705J35276_122373457 351
139 3300009784 Ga0123357_10000770 Ga0123357_1000077016 351
140 3300007188 Ga0103264_1017723 Ga0103264_10177233 354
141 iso_pr_bacteria 2724678956 2724790673 354
142 iso_pr_bacteria 2864993140 2864994243 354
143 iso_pr_bacteria 2873468275 2873469379 354
144 3300002931 CVPL010W_10000074 CVPL010W_1000007427 355
145 3300002931 CVPL010W_10000177 CVPL010W_1000017742 355
146 3300002931 CVPL010W_10001313 CVPL010W_1000131316 355
147 3300002934 CVPL005W_1001061 CVPL005W_10010612 355
148 3300007129 Ga0102734_1000557 Ga0102734_10005578 355
149 3300012848 Ga0160443_100864 Ga0160443_1008647 355
150 3300026175 Ga0255572_1000007 Ga0255572_100000779 355
151 3300028910 Ga0309902_000003 Ga0309902_000003_103103_104170 355
152 3300029810 Ga0309904_1000015 Ga0309904_100001511 355
153 3300030930 Ga0316159_10066 Ga0316159_1006611 355
154 3300042598 Ga0466701_033542 Ga0466701_033542_1872_2939 355
155 3300042649 Ga0466724_47345 Ga0466724_47345_130292_131359 355
156 iso_pr_bacteria 2751185853 2753585903 355
157 iso_pr_bacteria 2751185856 2753591221 355
158 iso_pr_bacteria 2751185858 2753595042 355
159 iso_pr_bacteria 8067483258 8067485180 355
160 iso_pr_bacteria 8068941587 8068941924 355
161 iso_pr_bacteria 8068944069 8068944847 355
162 iso_pr_bacteria 8068946563 8068947349 355
163 iso_pr_bacteria 8068950955 8068951417 355
164 iso_pr_bacteria 8068953321 8068954734 355
165 iso_pr_bacteria 8068955631 8068957012 355
166 iso_pr_bacteria 8073617375 8073618944 355
167 iso_pr_bacteria 8073619611 8073620410 355
168 iso_pr_bacteria 8073621894 8073622342 355
169 iso_pr_bacteria 8073624232 8073625439 355
170 iso_pr_bacteria 8073626464 8073626552 355
171 iso_pr_bacteria 8073628750 8073630159 355
172 iso_pr_bacteria 8082291289 8082291534 355
173 3300005721 Ga0074278_110995 Ga0074278_1109959 356
174 3300007052 Ga0102736_1005791 Ga0102736_10057911 356
175 3300009460 Ga0127649_105736 Ga0127649_10573640 356
176 iso_pr_bacteria 2900132049 2900133668 356
177 3300002931 CVPL010W_10000656 CVPL010W_100006568 357
178 3300007095 Ga0102739_1006303 Ga0102739_10063032 357
179 3300007129 Ga0102734_1000463 Ga0102734_10004636 357
180 3300007188 Ga0103264_1000080 Ga0103264_100008052 359
181 3300002938 CVPL005L_10002445 CVPL005L_1000244519 360
182 3300002938 CVPL005L_10019783 CVPL005L_100197833 360
183 3300007067 Ga0103266_1000035 Ga0103266_100003529 360
184 3300007141 Ga0102738_1000011 Ga0102738_100001198 360
185 iso_pr_bacteria 2886876212 2886877998 360
186 3300007188 Ga0103264_1000102 Ga0103264_100010235 362
187 3300012824 Ga0160469_103849 Ga0160469_1038492 371
188 3300012847 Ga0160445_100311 Ga0160445_10031112 371
189 3300028918 Ga0309901_1000013 Ga0309901_1000013192 372
190 3300029809 Ga0309903_100011 Ga0309903_1000112 375
191 iso_pr_bacteria 2556921669 2558277112 411

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 64 347 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.