Protein Family IF10820

Metagenome Isolate
522 Members
330 Samples
139 Scaffolds
477.28 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2515154048|2515334122|
Length
522 aa
Sequence
MSNKGLPKDFLWGGAVAAHQLEGAWQVGGKGVSVADVMTVGSPKSYRKITEGVIEGEYYPNHEAIDFYHHYKDDIKLFAEMGFKCFRTSIAWTRIFPKGDELAPNEEGLKFYDELFDECLKYNIEPVVTLSHFELPYYLVTEYGGFRNRKLIDFFVRFAEVCFDRYKNKVKYWMTFNEINNQANFDEDFAPFTNSGIFYKAGDNREQIMYQASHYELVASAKAVQIGHAINPDFEIGCMLAMIPIYPETCKPGDILMAQKAMERKYFFADVHVHGQYPNHIIKYWQGKNYKLDVTTQDLEILANGTVDYIGFSYYMSNAIRKKSDNYEYNEKTDLIGNQYVKKSDWGWQIDPEGLRYTLNWLTDMYRLPLFIVENGFGAYDKVEADGSIHDAYRIDYLREHIKQMKIAVEEDGVDLMGYTPWGCIDLVSAGTGEMEKRYGFIYVDKDNHGNGTLKRSRKDSFIWYKKVIGSNGEILSLVELITDYYLLENKKSDEKSIDYLCCWDVIILNGQKSNRIFCKPK

πŸ“Š Sample Types

Isolate 73.4%
Metagenome 26.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Apidae 34.1%
Unclassified 15.6%
Drosophilidae 8.3%
Blattidae 6.4%
Tenebrionidae 4.5%
Muscidae 4.1%
Kalotermitidae 3.8%
Termitidae 2.9%
Calliphoridae 2.5%
Curculionidae 1.6%
Scarabaeidae 1.6%
Tephritidae 1.6%
Armadillidiidae 1.3%
Cerambycidae 1.3%
Formicidae 1.0%
Termopsidae 1.0%
Culicidae 0.6%
Aphididae 0.6%
Sarcophagidae 0.6%
Rhinotermitidae 0.6%
Hydrophilidae 0.6%
Plutellidae 0.6%
Passalidae 0.6%
Ceratopogonidae 0.3%
Anthomyiidae 0.3%
Gomphidae 0.3%
Anthocoridae 0.3%
Vespidae 0.3%
Hodotermitidae 0.3%
Pyrrhocoridae 0.3%
Noctuidae 0.3%
Libellulidae 0.3%
Pentatomidae 0.3%
Rhopalidae 0.3%
Carabidae 0.3%
Crambidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 492
Eukaryota 0
Viruses 0
Unclassified 30

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
2 2540341223 Entomoplasma lucivorax ATCC 49196 Isolate Unclassified
3 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
4 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
5 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
6 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
7 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
8 2841195917 Gilliamella apicola wkB7 Isolate Apidae
9 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
10 2849452216 Gilliamella apicola AW11 Isolate Apidae
11 2849455045 Gilliamella apicola NO8 Isolate Apidae
12 2868504459 Gilliamella apis NO4 Isolate Apidae
13 2870917785 Gilliamella apis NO15 Isolate Apidae
14 2873636219 Gilliamella apicola App2-1 Isolate Apidae
15 2876033458 Gilliamella apicola AM6 Isolate Apidae
16 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
17 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
18 2878464769 Gilliamella apis ESL0169 Isolate Apidae
19 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
20 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
21 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
22 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
23 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
24 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
25 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
26 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
27 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
28 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
29 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
33 8007223943 Enterococcus sp. MSG2901 Isolate
34 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
35 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
36 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
37 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
38 8071333649 Escherichia coli PN108 Isolate Calliphoridae
39 8071338694 Escherichia coli PN87 Isolate Calliphoridae
40 8102982778 Erwinia sp. S63 Isolate Curculionidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
45 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
46 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
47 2648501209 Winslowiella iniecta B149 Isolate Aphididae
48 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
49 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
50 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
51 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
52 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
53 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
54 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
55 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
56 2854147632 Gilliamella apicola wkB195 Isolate Apidae
57 2868489326 Gilliamella apicola N10 Isolate Apidae
58 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
59 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
60 2870920129 Gilliamella apicola wkB108 Isolate Apidae
61 2873638493 Gilliamella apicola wkB72 Isolate Apidae
62 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
63 2876025319 Gilliamella apis NO12 Isolate Apidae
64 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
65 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
66 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
67 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
68 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
69 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
70 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
71 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
72 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
73 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
74 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
75 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
76 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
77 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
78 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
79 8088493931 Gilliamella apis K-MP18 Isolate Apidae
80 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
81 2511231129 Vibrio sp. EJY3 Isolate Unclassified
82 2540341224 Williamsoniiplasma luminosum ATCC 49195 Isolate Unclassified
83 2590828840 Clostridium sp. 2 Isolate Termitidae
84 2645727860 Winslowiella iniecta B120 Isolate Aphididae
85 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
86 2834098943 Gilliamella apis NO3 Isolate Apidae
87 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
88 2846480698 Gilliamella apis N-G4 Isolate Apidae
89 2846488152 Gilliamella apicola Bim3-2 Isolate Apidae
90 2849449383 Gilliamella apicola WF3-4 Isolate Apidae
91 2849458003 Gilliamella apicola HK7 Isolate Apidae
92 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
93 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
94 2857876020 Gilliamella apicola Nev6-6 Isolate Apidae
95 2857881114 Gilliamella apis N-G3 Isolate Apidae
96 2868494745 Gilliamella apis NO1 Isolate Apidae
97 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
98 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
99 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
100 2876016455 Gilliamella apicola N6 Isolate Apidae
101 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
102 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
103 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
104 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
105 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
106 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
107 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
108 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
109 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
110 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
111 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
112 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
113 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
114 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
115 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
116 8007237282 Enterococcus sp. DIV0212c Isolate
117 8017489919 Lactobacillus brevis EF Isolate Unclassified
118 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
119 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
120 8022345672 Vibrio sp. 070316B Isolate Unclassified
121 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
122 8088486376 Gilliamella apis ESL0172 Isolate Apidae
123 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
124 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
125 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
126 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
127 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
128 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
129 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
130 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
131 2684622921 Frischella perrara Fp_167 Isolate Unclassified
132 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
133 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
134 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
135 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
136 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
137 2833532623 Frischella perrara ESL0167 Isolate Apidae
138 2840795165 Gilliamella apicola N-22 Isolate Apidae
139 2846483029 Gilliamella apis AM1 Isolate Apidae
140 2849466174 Gilliamella apis P83G Isolate Apidae
141 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
142 2854134697 Gilliamella apicola Fer4-1 Isolate Apidae
143 2854144746 Gilliamella apicola NO6 Isolate Apidae
144 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
145 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
146 2857873190 Gilliamella apicola Nev5-1 Isolate Apidae
147 2857886120 Gilliamella apicola Bim1-2 Isolate Apidae
148 2868492035 Gilliamella apicola Occ4-3 Isolate Apidae
149 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
150 2876030618 Gilliamella apicola HK2 Isolate Apidae
151 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
152 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
153 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
154 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
155 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
156 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
157 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
158 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
159 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
160 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
161 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
162 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
163 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
164 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
165 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
166 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
167 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
168 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
169 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
170 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
171 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
172 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
173 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
174 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
175 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
176 8100176769 Kosakonia sp. S57 Isolate Curculionidae
177 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
178 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
179 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
180 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
181 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
182 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
183 2593339124 Clostridium sp. 4 Isolate Termitidae
184 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
185 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
186 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
187 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
188 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
189 2785510746 Gilliamella sp. ESL0441 Isolate Apidae
190 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
191 2806310895 Mesoplasma florum CnuA-2 Isolate Unclassified
192 2836714267 Shimwellia blattae NCTC10965 Isolate
193 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
194 2846485327 Gilliamella apicola AM4 Isolate Apidae
195 2849471304 Gilliamella apicola NO5 Isolate Apidae
196 2873643457 Gilliamella apis A-4-12 Isolate Apidae
197 2876011797 Gilliamella apis NO16 Isolate Apidae
198 2876022486 Gilliamella apicola A8 Isolate Apidae
199 2876027665 Gilliamella apicola P54G Isolate Apidae
200 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
201 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
202 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
203 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
204 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
205 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
206 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
207 3300000462 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 Metagenome Apidae
208 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
209 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
210 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
211 8021546568 Klebsiella sp. Kps Isolate Tephritidae
212 8071322446 Escherichia coli PN122 Isolate Calliphoridae
213 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
214 8100171289 Kosakonia sp. S42 Isolate Curculionidae
215 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
216 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
217 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
218 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
219 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
220 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
221 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
222 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
223 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
224 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
225 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
226 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
227 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
228 2846472545 Gilliamella sp. N-W3 Isolate Apidae
229 2846475167 Gilliamella apicola N-G5 Isolate Apidae
230 2846493360 Gilliamella apis N-G1 Isolate Apidae
231 2854132136 Gilliamella apicola wkB292 Isolate Apidae
232 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
233 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
234 2870908367 Gilliamella apis NO13 Isolate Apidae
235 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
236 2873648542 Gilliamella apicola NO10 Isolate Apidae
237 2873653628 Gilliamella apicola App6-5 Isolate Apidae
238 2876014139 Gilliamella apicola wkB18 Isolate Apidae
239 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
240 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
241 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
242 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
243 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
244 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
245 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
246 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
247 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
248 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
249 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
250 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
251 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
252 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
253 8071343737 Escherichia coli PN119 Isolate Calliphoridae
254 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
255 2515154048 Candidatus Gilliamella apicola wkB11 Isolate Apidae
256 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
257 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
258 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
259 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
260 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
261 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
262 2846477985 Gilliamella apicola Fer1-1 Isolate Apidae
263 2849460838 Gilliamella apicola Gris3-2 Isolate Apidae
264 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
265 2857868033 Gilliamella apis P62G Isolate Apidae
266 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
267 2870905362 Gilliamella apicola Nev3-1 Isolate Apidae
268 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
269 2873645950 Gilliamella apicola Fer2-1 Isolate Apidae
270 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
271 2898975184 Erwinia dacicola IL Isolate Tephritidae
272 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
273 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
274 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
275 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
276 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
277 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
278 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
279 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
280 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
281 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
282 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
283 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
284 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
285 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
286 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
287 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
288 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
289 8018312681 Enterobacter sp. OLF Isolate Tephritidae
290 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
291 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
292 8088488961 Gilliamella apis ESL0169 Isolate Apidae
293 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
294 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
295 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
296 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
297 2515154034 Frischella perrara PEB0191 Isolate Apidae
298 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
299 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
300 2630968947 Frischella perrara PEB0191 Isolate Apidae
301 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
302 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
303 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
304 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
305 2561511101 Mesoplasma grammopterae ATCC 49580 Isolate Cerambycidae
306 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
307 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
308 2846490831 Gilliamella apis ESL0172 Isolate Apidae
309 2849446820 Gilliamella apicola Bif1-4 Isolate Apidae
310 2849468476 Gilliamella apicola N-28 Isolate Apidae
311 2854129949 Gilliamella apis M1-2G Isolate Apidae
312 2857883421 Gilliamella apicola N2 Isolate Apidae
313 2857891623 Gilliamella apicola wkB171 Isolate Apidae
314 2868486652 Gilliamella sp. N-G2 Isolate Apidae
315 2868506828 Gilliamella apicola App4-10 Isolate Apidae
316 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
317 2870900452 Gilliamella apis NO14 Isolate Apidae
318 2873640908 Gilliamella apicola wkB308 Isolate Apidae
319 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
320 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
321 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
322 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
323 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
324 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
325 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
326 3007994558 Escherichia alba B35 Isolate Tenebrionidae
327 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
328 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
329 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
330 8100181737 Kosakonia sp. S58 Isolate Curculionidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_015908 3300042612 Bacteria 3666
2 Ga0562378_0116 3300056814 Bacteria 208911
3 Ga0562377_0001 3300056842 Bacteria 5082480
4 Ga0562377_0015 3300056842 Bacteria 1211570
5 Ga0562375_0015 3300056856 Bacteria 1028412
6 Ga0562374_0076 3300057007 Bacteria 303088
7 Ga0265387_1000027 3300024582 Bacteria 58359
8 Ga0247289_0501 3300035363 Unclassified 5675
9 Ga0466691_096132 3300042593 Bacteria 8474
10 Ga0466696_344823 3300042596 Bacteria 1887
11 Ga0466730_032447 3300042625 Bacteria 115525
12 Ga0466730_103221 3300042625 Bacteria 88398
13 Ga0466713_018622 3300042602 Unclassified 46772
14 Ga0466716_049256 3300042605 Bacteria 12966
15 gam1t_NODE_603478_length=226970_GC=33_8_Contigs=8 2189573031 Bacteria 227040
16 2227141937 2225789004 Bacteria 8680
17 HBC_ctgsDRAFT_1000229 3300000333 Bacteria 12990
18 HBC_ctgsDRAFT_1006972 3300000333 Unclassified 2656
19 CVPL010L_1000014 3300002932 Bacteria 149512
20 CVPL010L_1000284 3300002932 Unclassified 38096
21 Ga0063521_1000039 3300003973 Bacteria 113027
22 Ga0063521_1000063 3300003973 Bacteria 93948
23 Ga0074278_144901 3300005721 Bacteria 227040
24 Ga0104042_1001040 3300007130 Bacteria 6706
25 Ga0105553_1041633 3300007767 Bacteria 21407
26 Ga0466733_026022 3300042659 Bacteria 24606
27 Ga0466733_217407 3300042659 Bacteria 5238
28 Ga0562379_0171 3300056790 Bacteria 192504
29 Ga0562375_0018 3300056856 Bacteria 940838
30 Ga0466730_017433 3300042625 Unclassified 1827
31 Ga0466703_421610 3300042636 Bacteria 7319
32 Ga0466709_143213 3300042648 Unclassified 182374
33 Ga0466716_358851 3300042605 Bacteria 3697
34 FGTW_contig07373 2065487013 Unclassified 3347
35 FGTW_contig08725 2065487013 Bacteria 3517
36 AglaG_contig22045 2084038013 Bacteria 2659
37 CVPL010L_1000650 3300002932 Unclassified 13370
38 Ga0104042_1120115 3300007130 Bacteria 2344
39 Ga0466733_002585 3300042659 Bacteria 14684
40 Ga0562377_0570 3300056842 Bacteria 56722
41 Ga0562377_2715 3300056842 Bacteria 12063
42 Ga0562375_0224 3300056856 Unclassified 157279
43 Ga0247289_0621 3300035363 Bacteria 4735
44 Ga0466696_160524 3300042596 Bacteria 4766
45 Ga0123353_10032186 3300010167 Bacteria 8140
46 Ga0466715_238609 3300042616 Bacteria 16876
47 Ga0466726_073097 3300042619 Bacteria 9490
48 Ga0466734_086589 3300042623 Bacteria 8322
49 Ga0466709_378904 3300042648 Bacteria 79096
50 Ga0466727_284169 3300042655 Bacteria 2409
51 Ga0466719_220510 3300042606 Bacteria 8058
52 Ga0466719_231538 3300042606 Bacteria 35850
53 FGTW_contig30584 2065487013 Unclassified 15218
54 2227358556 2225789004 Bacteria 119167
55 CVPL010L_1000056 3300002932 Bacteria 84288
56 Ga0074278_123693 3300005721 Unclassified 9116
57 Ga0562379_0006 3300056790 Bacteria 2459409
58 Ga0562379_0446 3300056790 Bacteria 86279
59 Ga0562377_0003 3300056842 Bacteria 3990310
60 Ga0562375_0403 3300056856 Bacteria 96431
61 Ga0562374_0006 3300057007 Bacteria 2178283
62 Ga0316159_10001 3300030930 Bacteria 1642808
63 Ga0247290_00279 3300035364 Unclassified 12660
64 Ga0466693_113441 3300042592 Bacteria 28543
65 Ga0466710_017395 3300042613 Bacteria 26782
66 Ga0466730_065681 3300042625 Bacteria 59925
67 Ga0466703_017044 3300042636 Bacteria 5449
68 Ga0466704_238432 3300042643 Bacteria 18190
69 Ga0466724_52343 3300042649 Bacteria 143169
70 Ga0466708_367788 3300042652 Bacteria 6074
71 Ga0466713_026132 3300042602 Bacteria 60756
72 Ga0466713_117968 3300042602 Bacteria 408806
73 Ga0466713_155845 3300042602 Unclassified 168359
74 Ga0466716_240743 3300042605 Bacteria 4511
75 HBC_ctgsDRAFT_1001694 3300000333 Unclassified 4840
76 SCG598I22_12445 3300000462 Unclassified 10050
77 Ga0074278_137786 3300005721 Unclassified 4499
78 Ga0562379_0314 3300056790 Bacteria 120596
79 Ga0160433_101427 3300012846 Bacteria 6640
80 Ga0466715_023250 3300042616 Bacteria 5878
81 Ga0466735_143531 3300042624 Bacteria 9291
82 Ga0466730_023294 3300042625 Bacteria 44022
83 Ga0466709_232856 3300042648 Bacteria 6894
84 Ga0466724_67835 3300042649 Bacteria 278968
85 FGTW_contig31432 2065487013 Bacteria 4379
86 IMNBL1DRAFT_c0000113 3300000062 Bacteria 72819
87 CVPL010L_1004350 3300002932 Unclassified 2760
88 Ga0074278_136215 3300005721 Unclassified 12881
89 Ga0466705_133976 3300042612 Bacteria 12154
90 Ga0466705_343942 3300042612 Bacteria 2443
91 Ga0562379_0039 3300056790 Bacteria 641946
92 Ga0562377_0045 3300056842 Bacteria 589149
93 Ga0562377_0424 3300056842 Unclassified 73762
94 Ga0562377_1843 3300056842 Bacteria 19072
95 Ga0562376_0677 3300056857 Bacteria 56875
96 Ga0160455_100096 3300012837 Bacteria 131260
97 Ga0265387_1000016 3300024582 Bacteria 71008
98 Ga0265387_1000493 3300024582 Bacteria 6268
99 Ga0247289_0965 3300035363 Bacteria 3219
100 Ga0466692_196088 3300042591 Bacteria 6831
101 Ga0466711_360483 3300042615 Bacteria 4825
102 Ga0466723_208009 3300042618 Bacteria 3638
103 Ga0466730_061169 3300042625 Bacteria 13126
104 HBC_ctgsDRAFT_1011080 3300000333 Unclassified 2153
105 SCG598I20_12761 3300000473 Bacteria 87981
106 SCG598L16_135255 3300000490 Unclassified 10425
107 Ga0104147_1028782 3300007224 Bacteria 4648
108 Ga0466733_120718 3300042659 Bacteria 2831
109 Ga0562378_0457 3300056814 Bacteria 70193
110 Ga0562377_0008 3300056842 Bacteria 1610398
111 Ga0160444_101686 3300012841 Unclassified 3849
112 Ga0316159_10046 3300030930 Bacteria 22446
113 Ga0247290_00275 3300035364 Unclassified 12947
114 Ga0466696_464825 3300042596 Bacteria 4641
115 Ga0466723_009537 3300042618 Bacteria 17122
116 Ga0466730_096054 3300042625 Unclassified 1421
117 Ga0466713_077272 3300042602 Bacteria 50502
118 IMNBL1DRAFT_c0035140 3300000062 Bacteria 1771
119 Ga0074278_134698 3300005721 Unclassified 15575
120 Ga0105553_1041648 3300007767 Unclassified 12694
121 Ga0466705_040091 3300042612 Bacteria 7781
122 Ga0466733_020467 3300042659 Bacteria 10024
123 Ga0562379_0419 3300056790 Bacteria 91895
124 Ga0562375_3454 3300056856 Bacteria 14712
125 Ga0160445_100393 3300012847 Bacteria 24221
126 Ga0265387_1001903 3300024582 Unclassified 2981
127 Ga0466715_414478 3300042616 Bacteria 7125
128 Ga0466730_014610 3300042625 Bacteria 23670
129 Ga0466730_068670 3300042625 Bacteria 13749
130 Ga0466727_293995 3300042655 Bacteria 4910
131 Ga0466706_039932 3300042599 Bacteria 7047
132 Ga0466713_014851 3300042602 Bacteria 5449
133 gam1t_NODE_402211_length=12841_GC=30_2_Contigs=5 2189573031 Unclassified 12881
134 2227535728 2225789004 Bacteria 57613
135 2227535735 2225789004 Bacteria 56787
136 IMNBL1DRAFT_c0009335 3300000062 Bacteria 4853
137 CVPL010L_1000190 3300002932 Unclassified 27461
138 CVPL010L_1001968 3300002932 Unclassified 3017
139 Ga0104147_1006250 3300007224 Bacteria 18926

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2970225615 2970227297 392
2 3300042625 Ga0466730_096054 Ga0466730_096054_215_1408 397
3 iso_pr_bacteria 2846472545 2846473618 401
4 iso_pr_bacteria 2868486652 2868487554 401
5 iso_pr_bacteria 2850695442 2850698129 444
6 3300042602 Ga0466713_014851 Ga0466713_014851_2015_3439 451
7 3300042602 Ga0466713_026132 Ga0466713_026132_24385_25752 455
8 3300042648 Ga0466709_378904 Ga0466709_378904_22410_23834 456
9 3300000333 HBC_ctgsDRAFT_1001694 HBC_ctgsDRAFT_10016941 461
10 3300002932 CVPL010L_1004350 CVPL010L_10043503 462
11 iso_pr_bacteria 2914375287 2914375917 462
12 3300042636 Ga0466703_421610 Ga0466703_421610_2178_3617 463
13 iso_pr_bacteria 2873595552 2873595632 465
14 iso_pr_bacteria 2622736579 2623391848 467
15 3300012841 Ga0160444_101686 Ga0160444_1016863 468
16 3300042616 Ga0466715_414478 Ga0466715_414478_2063_3469 468
17 iso_pr_bacteria 2940380068 2940385953 468
18 iso_pr_bacteria 2940386776 2940392668 468
19 iso_pr_bacteria 2940393498 2940399359 468
20 iso_pr_bacteria 2940400224 2940406104 468
21 iso_pr_bacteria 2940406939 2940412620 468
22 3300042592 Ga0466693_113441 Ga0466693_113441_4823_6232 469
23 3300042613 Ga0466710_017395 Ga0466710_017395_3338_4747 469
24 3300042615 Ga0466711_360483 Ga0466711_360483_2078_3487 469
25 3300042618 Ga0466723_208009 Ga0466723_208009_1736_3145 469
26 iso_pr_bacteria 2684622913 2686078174 470
27 iso_pr_bacteria 8017462664 8017464628 470
28 3300005721 Ga0074278_137786 Ga0074278_1377861 471
29 3300035363 Ga0247289_0965 Ga0247289_0965_703_2118 471
30 3300035364 Ga0247290_00275 Ga0247290_00275_4503_5939 471
31 3300056790 Ga0562379_0446 Ga0562379_0446_19308_20723 471
32 2189573031 gam1t_NODE_402211_length=12841_GC=30_2_Contigs=5 gam1t_00106030 472
33 3300042616 Ga0466715_023250 Ga0466715_023250_2859_4277 472
34 3300005721 Ga0074278_136215 Ga0074278_1362153 473
35 3300012846 Ga0160433_101427 Ga0160433_1014272 473
36 3300042606 Ga0466719_220510 Ga0466719_220510_66_1490 474
37 3300042659 Ga0466733_020467 Ga0466733_020467_6335_7759 474
38 3300042659 Ga0466733_120718 Ga0466733_120718_1276_2700 474
39 iso_pr_bacteria 8007237282 8007238261 474
40 iso_pr_bacteria 8018798118 8018798979 474
41 iso_pr_bacteria 8018802046 8018803788 474
42 iso_pr_bacteria 8114537524 8114539351 474
43 iso_pr_bacteria 8114541043 8114543981 474
44 2225789004 2227535735 2228052720 475
45 3300042596 Ga0466696_160524 Ga0466696_160524_611_2038 475
46 3300042605 Ga0466716_049256 Ga0466716_049256_2332_3759 475
47 3300042605 Ga0466716_358851 Ga0466716_358851_2170_3597 475
48 3300042659 Ga0466733_217407 Ga0466733_217407_385_1812 475
49 3300056790 Ga0562379_0314 Ga0562379_0314_57345_58772 475
50 iso_pr_bacteria 2585428141 2588054334 475
51 iso_pr_bacteria 8002299145 8002302844 475
52 2065487013 FGTW_contig31432 FGTW_00497590 476
53 2225789004 2227535728 2228052335 476
54 3300000062 IMNBL1DRAFT_c0000113 IMNBL1DRAFT_000011356 476
55 3300000062 IMNBL1DRAFT_c0035140 IMNBL1DRAFT_00351402 476
56 3300024582 Ga0265387_1000027 Ga0265387_10000272 476
57 3300024582 Ga0265387_1000493 Ga0265387_10004936 476
58 3300030930 Ga0316159_10046 Ga0316159_100469 476
59 3300035363 Ga0247289_0621 Ga0247289_0621_1546_2976 476
60 3300042602 Ga0466713_018622 Ga0466713_018622_44390_45820 476
61 3300042602 Ga0466713_077272 Ga0466713_077272_10527_11957 476
62 3300042606 Ga0466719_231538 Ga0466719_231538_16463_17893 476
63 3300042612 Ga0466705_343942 Ga0466705_343942_68_1498 476
64 3300042616 Ga0466715_238609 Ga0466715_238609_13358_14788 476
65 3300042623 Ga0466734_086589 Ga0466734_086589_2325_3755 476
66 3300042625 Ga0466730_014610 Ga0466730_014610_13295_14725 476
67 3300042625 Ga0466730_065681 Ga0466730_065681_11613_13043 476
68 3300042625 Ga0466730_068670 Ga0466730_068670_12020_13450 476
69 3300042648 Ga0466709_232856 Ga0466709_232856_2470_3924 476
70 3300042649 Ga0466724_52343 Ga0466724_52343_67177_68607 476
71 3300056790 Ga0562379_0171 Ga0562379_0171_21025_22455 476
72 3300056814 Ga0562378_0116 Ga0562378_0116_176281_177711 476
73 3300056842 Ga0562377_0015 Ga0562377_0015_664036_665466 476
74 3300056856 Ga0562375_0224 Ga0562375_0224_82951_84381 476
75 3300056857 Ga0562376_0677 Ga0562376_0677_4202_5632 476
76 iso_pr_bacteria 2503538010 2503576261 476
77 iso_pr_bacteria 2507262057 2507515872 476
78 iso_pr_bacteria 2519899623 2520396340 476
79 iso_pr_bacteria 2547132185 2547708928 476
80 iso_pr_bacteria 2551306516 2553378905 476
81 iso_pr_bacteria 2551306531 2553448899 476
82 iso_pr_bacteria 2588253791 2588729271 476
83 iso_pr_bacteria 2740892556 2743948804 476
84 iso_pr_bacteria 2775507073 2777016526 476
85 iso_pr_bacteria 2785510744 2785738599 476
86 iso_pr_bacteria 2785510745 2785741067 476
87 iso_pr_bacteria 2785510747 2785745792 476
88 iso_pr_bacteria 2822856742 2822857961 476
89 iso_pr_bacteria 2824588292 2824591141 476
90 iso_pr_bacteria 2834951433 2834952914 476
91 iso_pr_bacteria 2854127928 2854128024 476
92 iso_pr_bacteria 2854132136 2854133844 476
93 iso_pr_bacteria 2854147632 2854149160 476
94 iso_pr_bacteria 2857891623 2857893487 476
95 iso_pr_bacteria 2873638493 2873639654 476
96 iso_pr_bacteria 2873651485 2873651925 476
97 iso_pr_bacteria 2874880541 2874880646 476
98 iso_pr_bacteria 2876014139 2876015885 476
99 iso_pr_bacteria 2876036378 2876037581 476
100 iso_pr_bacteria 2938192669 2938197716 476
101 iso_pr_bacteria 647533136 647746249 476
102 iso_pr_bacteria 8002299145 8002304101 476
103 iso_pr_bacteria 8004118532 8004122366 476
104 iso_pr_bacteria 8007211731 8007214381 476
105 iso_pr_bacteria 8007215774 8007219137 476
106 iso_pr_bacteria 8007220153 8007223432 476
107 iso_pr_bacteria 8007237282 8007238112 476
108 iso_pr_bacteria 8012939035 8012941865 476
109 iso_pr_bacteria 8012942269 8012943014 476
110 iso_pr_bacteria 8018312681 8018317540 476
111 iso_pr_bacteria 8018750880 8018753236 476
112 iso_pr_bacteria 8018754795 8018755470 476
113 iso_pr_bacteria 8018794549 8018795600 476
114 iso_pr_bacteria 8018798118 8018799152 476
115 iso_pr_bacteria 8018802046 8018803959 476
116 iso_pr_bacteria 8021535516 8021537407 476
117 iso_pr_bacteria 8021540981 8021541449 476
118 iso_pr_bacteria 8028002147 8028005416 476
119 iso_pr_bacteria 8077780672 8077780990 476
120 iso_pr_bacteria 8108576847 8108579389 476
121 iso_pr_bacteria 8114537524 8114539192 476
122 iso_pr_bacteria 8114541043 8114544145 476
123 iso_pr_bacteria 8114544644 8114546812 476
124 iso_pr_bacteria 8114549044 8114551586 476
125 2065487013 FGTW_contig07373 FGTW_02447610 477
126 2065487013 FGTW_contig30584 FGTW_01727850 477
127 2225789004 2227358556 2227805151 477
128 3300002932 CVPL010L_1000190 CVPL010L_100019020 477
129 3300002932 CVPL010L_1001968 CVPL010L_10019682 477
130 3300007130 Ga0104042_1120115 Ga0104042_11201152 477
131 3300007767 Ga0105553_1041648 Ga0105553_10416483 477
132 3300012837 Ga0160455_100096 Ga0160455_10009644 477
133 3300024582 Ga0265387_1000016 Ga0265387_100001633 477
134 3300024582 Ga0265387_1001903 Ga0265387_10019033 477
135 3300035363 Ga0247289_0501 Ga0247289_0501_3590_5023 477
136 3300035364 Ga0247290_00279 Ga0247290_00279_2212_3645 477
137 3300042602 Ga0466713_117968 Ga0466713_117968_169968_171401 477
138 3300042625 Ga0466730_017433 Ga0466730_017433_56_1489 477
139 3300042625 Ga0466730_023294 Ga0466730_023294_12573_14006 477
140 3300042625 Ga0466730_061169 Ga0466730_061169_7391_8824 477
141 3300042625 Ga0466730_103221 Ga0466730_103221_84681_86114 477
142 3300042649 Ga0466724_67835 Ga0466724_67835_159158_160591 477
143 3300056814 Ga0562378_0457 Ga0562378_0457_8737_10170 477
144 3300056842 Ga0562377_0008 Ga0562377_0008_786749_788182 477
145 3300056842 Ga0562377_0424 Ga0562377_0424_13847_15280 477
146 3300056842 Ga0562377_0570 Ga0562377_0570_40111_41544 477
147 3300057007 Ga0562374_0076 Ga0562374_0076_59216_60649 477
148 iso_pr_bacteria 2507262057 2507515507 477
149 iso_pr_bacteria 2519899623 2520397286 477
150 iso_pr_bacteria 2531839602 2534154523 477
151 iso_pr_bacteria 2537561600 2537927312 477
152 iso_pr_bacteria 2547132185 2547709418 477
153 iso_pr_bacteria 2551306516 2553381412 477
154 iso_pr_bacteria 2551306531 2553448408 477
155 iso_pr_bacteria 2588253732 2588525680 477
156 iso_pr_bacteria 2588253732 2588526158 477
157 iso_pr_bacteria 2588253791 2588729736 477
158 iso_pr_bacteria 2590828840 2593255677 477
159 iso_pr_bacteria 2593339124 2595062572 477
160 iso_pr_bacteria 2765235945 2766084660 477
161 iso_pr_bacteria 2765235945 2766085351 477
162 iso_pr_bacteria 2778261152 2779037534 477
163 iso_pr_bacteria 2778261153 2779044019 477
164 iso_pr_bacteria 2788499854 2788760084 477
165 iso_pr_bacteria 2822856742 2822857561 477
166 iso_pr_bacteria 2824588292 2824589420 477
167 iso_pr_bacteria 2833053935 2833057749 477
168 iso_pr_bacteria 2856068565 2856071109 477
169 iso_pr_bacteria 2873581347 2873582553 477
170 iso_pr_bacteria 2873595552 2873597348 477
171 iso_pr_bacteria 2874880541 2874884565 477
172 iso_pr_bacteria 2876334352 2876335039 477
173 iso_pr_bacteria 2876358570 2876362836 477
174 iso_pr_bacteria 2921816052 2921819261 477
175 iso_pr_bacteria 2921842437 2921843278 477
176 iso_pr_bacteria 2937387794 2937390836 477
177 iso_pr_bacteria 2937427229 2937428853 477
178 iso_pr_bacteria 2938192669 2938195595 477
179 iso_pr_bacteria 2940236825 2940237145 477
180 iso_pr_bacteria 2940236825 2940238638 477
181 iso_pr_bacteria 2940339133 2940339454 477
182 iso_pr_bacteria 2940339133 2940341030 477
183 iso_pr_bacteria 2940341480 2940343181 477
184 iso_pr_bacteria 2940341480 2940343533 477
185 iso_pr_bacteria 2940343849 2940345548 477
186 iso_pr_bacteria 2940343849 2940345915 477
187 iso_pr_bacteria 2940352027 2940354002 477
188 iso_pr_bacteria 2940354458 2940356406 477
189 iso_pr_bacteria 2940356891 2940358846 477
190 iso_pr_bacteria 2940359323 2940361279 477
191 iso_pr_bacteria 2940361758 2940363730 477
192 iso_pr_bacteria 2940364193 2940366107 477
193 iso_pr_bacteria 2940366561 2940368476 477
194 iso_pr_bacteria 2940368928 2940370798 477
195 iso_pr_bacteria 2957730672 2957731227 477
196 iso_pr_bacteria 2964846109 2964849048 477
197 iso_pr_bacteria 2964859436 2964863143 477
198 iso_pr_bacteria 2967915117 2967919601 477
199 iso_pr_bacteria 2967924226 2967926353 477
200 iso_pr_bacteria 2970322301 2970323969 477
201 iso_pr_bacteria 2970335472 2970338148 477
202 iso_pr_bacteria 2977691992 2977692303 477
203 iso_pr_bacteria 2977727922 2977728045 477
204 iso_pr_bacteria 2977745872 2977750337 477
205 iso_pr_bacteria 2979682021 2979682605 477
206 iso_pr_bacteria 2997944163 2997944305 477
207 iso_pr_bacteria 3004010258 3004013742 477
208 iso_pr_bacteria 3004364956 3004366440 477
209 iso_pr_bacteria 3007994558 3007997130 477
210 iso_pr_bacteria 8001059720 8001061575 477
211 iso_pr_bacteria 8004118532 8004119067 477
212 iso_pr_bacteria 8007223943 8007224011 477
213 iso_pr_bacteria 8018312681 8018313489 477
214 iso_pr_bacteria 8021535516 8021538590 477
215 iso_pr_bacteria 8021540981 8021544642 477
216 iso_pr_bacteria 8021546568 8021547480 477
217 iso_pr_bacteria 8021546568 8021552047 477
218 iso_pr_bacteria 8028002147 8028004932 477
219 iso_pr_bacteria 8062647588 8062650607 477
220 iso_pr_bacteria 8071322446 8071323298 477
221 iso_pr_bacteria 8071333649 8071334430 477
222 iso_pr_bacteria 8071338694 8071339676 477
223 iso_pr_bacteria 8071343737 8071344205 477
224 iso_pr_bacteria 8073124432 8073128581 477
225 iso_pr_bacteria 8100171289 8100173811 477
226 iso_pr_bacteria 8100171289 8100175372 477
227 iso_pr_bacteria 8100176769 8100177719 477
228 iso_pr_bacteria 8100176769 8100179499 477
229 iso_pr_bacteria 8100181737 8100182551 477
230 iso_pr_bacteria 8100181737 8100184486 477
231 iso_pr_bacteria 8102982778 8102984863 477
232 2084038013 AglaG_contig22045 AglaG_05334920 478
233 2189573031 gam1t_NODE_603478_length=226970_GC=33_8_Contigs=8 gam1t_00177620 478
234 2225789004 2227141937 2227544330 478
235 3300002932 CVPL010L_1000014 CVPL010L_100001461 478
236 3300002932 CVPL010L_1000056 CVPL010L_100005625 478
237 3300002932 CVPL010L_1000650 CVPL010L_100065011 478
238 3300003973 Ga0063521_1000039 Ga0063521_100003933 478
239 3300003973 Ga0063521_1000063 Ga0063521_100006334 478
240 3300007224 Ga0104147_1028782 Ga0104147_10287824 478
241 3300007767 Ga0105553_1041633 Ga0105553_10416339 478
242 3300030930 Ga0316159_10001 Ga0316159_1000142 478
243 3300042602 Ga0466713_155845 Ga0466713_155845_61812_63248 478
244 3300042648 Ga0466709_143213 Ga0466709_143213_61744_63180 478
245 3300056842 Ga0562377_0003 Ga0562377_0003_1282181_1283617 478
246 3300056842 Ga0562377_1843 Ga0562377_1843_1721_3157 478
247 3300056842 Ga0562377_2715 Ga0562377_2715_9691_11127 478
248 iso_pr_bacteria 2513020017 2513099327 478
249 iso_pr_bacteria 2515154034 2515298978 478
250 iso_pr_bacteria 2515154047 2515333579 478
251 iso_pr_bacteria 2576861670 2579166140 478
252 iso_pr_bacteria 2597490293 2598963162 478
253 iso_pr_bacteria 2630968947 2633887383 478
254 iso_pr_bacteria 2684622921 2686091872 478
255 iso_pr_bacteria 2684622922 2686093277 478
256 iso_pr_bacteria 2684622923 2686095597 478
257 iso_pr_bacteria 2684622924 2686098122 478
258 iso_pr_bacteria 2684622925 2686100782 478
259 iso_pr_bacteria 2684622926 2686103752 478
260 iso_pr_bacteria 2690315820 2691199987 478
261 iso_pr_bacteria 2718218475 2721606768 478
262 iso_pr_bacteria 2728369362 2730149628 478
263 iso_pr_bacteria 2756170265 2756752861 478
264 iso_pr_bacteria 2756170266 2756755286 478
265 iso_pr_bacteria 2770939318 2771019481 478
266 iso_pr_bacteria 2785510746 2785743743 478
267 iso_pr_bacteria 2820236043 2820238388 478
268 iso_pr_bacteria 2833532623 2833534352 478
269 iso_pr_bacteria 2834098943 2834101069 478
270 iso_pr_bacteria 2836714267 2836714988 478
271 iso_pr_bacteria 2837615801 2837616763 478
272 iso_pr_bacteria 2837618715 2837620712 478
273 iso_pr_bacteria 2838840603 2838843158 478
274 iso_pr_bacteria 2840795165 2840797687 478
275 iso_pr_bacteria 2840797934 2840800269 478
276 iso_pr_bacteria 2841195917 2841196633 478
277 iso_pr_bacteria 2843334863 2843337511 478
278 iso_pr_bacteria 2843337836 2843338724 478
279 iso_pr_bacteria 2846475167 2846476458 478
280 iso_pr_bacteria 2846477985 2846479152 478
281 iso_pr_bacteria 2846480698 2846482808 478
282 iso_pr_bacteria 2846483029 2846484028 478
283 iso_pr_bacteria 2846485327 2846486594 478
284 iso_pr_bacteria 2846488152 2846489388 478
285 iso_pr_bacteria 2846490831 2846491741 478
286 iso_pr_bacteria 2846493360 2846494030 478
287 iso_pr_bacteria 2846495668 2846496419 478
288 iso_pr_bacteria 2849446820 2849448030 478
289 iso_pr_bacteria 2849449383 2849451054 478
290 iso_pr_bacteria 2849452216 2849454511 478
291 iso_pr_bacteria 2849455045 2849457660 478
292 iso_pr_bacteria 2849458003 2849458984 478
293 iso_pr_bacteria 2849460838 2849461554 478
294 iso_pr_bacteria 2849463436 2849465302 478
295 iso_pr_bacteria 2849466174 2849467936 478
296 iso_pr_bacteria 2849468476 2849471032 478
297 iso_pr_bacteria 2849471304 2849472475 478
298 iso_pr_bacteria 2852431164 2852432607 478
299 iso_pr_bacteria 2854129949 2854130524 478
300 iso_pr_bacteria 2854134697 2854136606 478
301 iso_pr_bacteria 2854141978 2854143949 478
302 iso_pr_bacteria 2854144746 2854146381 478
303 iso_pr_bacteria 2854149989 2854151511 478
304 iso_pr_bacteria 2857868033 2857870383 478
305 iso_pr_bacteria 2857870431 2857872777 478
306 iso_pr_bacteria 2857873190 2857875475 478
307 iso_pr_bacteria 2857876020 2857876805 478
308 iso_pr_bacteria 2857881114 2857882556 478
309 iso_pr_bacteria 2857883421 2857884284 478
310 iso_pr_bacteria 2857886120 2857888511 478
311 iso_pr_bacteria 2857888719 2857890628 478
312 iso_pr_bacteria 2868489326 2868491668 478
313 iso_pr_bacteria 2868492035 2868494409 478
314 iso_pr_bacteria 2868494745 2868495837 478
315 iso_pr_bacteria 2868497104 2868498214 478
316 iso_pr_bacteria 2868499409 2868500541 478
317 iso_pr_bacteria 2868504459 2868505949 478
318 iso_pr_bacteria 2868506828 2868508807 478
319 iso_pr_bacteria 2870897478 2870899918 478
320 iso_pr_bacteria 2870900452 2870901899 478
321 iso_pr_bacteria 2870902796 2870905062 478
322 iso_pr_bacteria 2870905362 2870905413 478
323 iso_pr_bacteria 2870908367 2870909919 478
324 iso_pr_bacteria 2870913170 2870914511 478
325 iso_pr_bacteria 2870915472 2870916579 478
326 iso_pr_bacteria 2870917785 2870918895 478
327 iso_pr_bacteria 2870920129 2870920870 478
328 iso_pr_bacteria 2873636219 2873636606 478
329 iso_pr_bacteria 2873640908 2873642700 478
330 iso_pr_bacteria 2873643457 2873645230 478
331 iso_pr_bacteria 2873645950 2873648181 478
332 iso_pr_bacteria 2873648542 2873650602 478
333 iso_pr_bacteria 2873653628 2873656084 478
334 iso_pr_bacteria 2873656248 2873658725 478
335 iso_pr_bacteria 2876011797 2876012122 478
336 iso_pr_bacteria 2876016455 2876018188 478
337 iso_pr_bacteria 2876019154 2876020284 478
338 iso_pr_bacteria 2876022486 2876024924 478
339 iso_pr_bacteria 2876025319 2876027597 478
340 iso_pr_bacteria 2876027665 2876027890 478
341 iso_pr_bacteria 2876030618 2876033196 478
342 iso_pr_bacteria 2876033458 2876034250 478
343 iso_pr_bacteria 2878462549 2878463898 478
344 iso_pr_bacteria 2878464769 2878465570 478
345 iso_pr_bacteria 2878857142 2878858439 478
346 iso_pr_bacteria 2902668162 2902670422 478
347 iso_pr_bacteria 2937236879 2937239330 478
348 iso_pr_bacteria 2940373808 2940377036 478
349 iso_pr_bacteria 2957623355 2957624606 478
350 iso_pr_bacteria 2960772748 2960774309 478
351 iso_pr_bacteria 2960772748 2960776003 478
352 iso_pr_bacteria 2964739456 2964740759 478
353 iso_pr_bacteria 2964749277 2964750383 478
354 iso_pr_bacteria 2964765680 2964767317 478
355 iso_pr_bacteria 2964765680 2964768925 478
356 iso_pr_bacteria 2964775400 2964776278 478
357 iso_pr_bacteria 2964778705 2964779642 478
358 iso_pr_bacteria 2967802344 2967803684 478
359 iso_pr_bacteria 2967825073 2967826760 478
360 iso_pr_bacteria 2970199020 2970200268 478
361 iso_pr_bacteria 2970254690 2970256402 478
362 iso_pr_bacteria 2977592972 2977594190 478
363 iso_pr_bacteria 2977596371 2977598015 478
364 iso_pr_bacteria 2977622177 2977622853 478
365 iso_pr_bacteria 2977628635 2977629736 478
366 iso_pr_bacteria 2977635137 2977636232 478
367 iso_pr_bacteria 2977653127 2977654366 478
368 iso_pr_bacteria 8088486376 8088488363 478
369 iso_pr_bacteria 8088488961 8088490718 478
370 iso_pr_bacteria 8088491222 8088493394 478
371 iso_pr_bacteria 8088493931 8088495858 478
372 2065487013 FGTW_contig08725 FGTW_01013790 479
373 3300000062 IMNBL1DRAFT_c0009335 IMNBL1DRAFT_00093353 479
374 3300000333 HBC_ctgsDRAFT_1011080 HBC_ctgsDRAFT_10110801 479
375 3300000462 SCG598I22_12445 SCG598I22_124459 479
376 3300000473 SCG598I20_12761 SCG598I20_1276157 479
377 3300002932 CVPL010L_1000284 CVPL010L_10002846 479
378 3300005721 Ga0074278_123693 Ga0074278_1236939 479
379 3300005721 Ga0074278_134698 Ga0074278_13469814 479
380 3300005721 Ga0074278_144901 Ga0074278_14490150 479
381 3300007130 Ga0104042_1001040 Ga0104042_10010406 479
382 3300042612 Ga0466705_133976 Ga0466705_133976_1808_3262 479
383 3300042636 Ga0466703_017044 Ga0466703_017044_3486_4925 479
384 3300042655 Ga0466727_284169 Ga0466727_284169_749_2188 479
385 3300056842 Ga0562377_0045 Ga0562377_0045_175393_176832 479
386 iso_pr_bacteria 2561511101 2562063779 479
387 iso_pr_bacteria 2576861670 2579167320 479
388 iso_pr_bacteria 2597490293 2598963013 479
389 iso_pr_bacteria 2690315820 2691201762 479
390 iso_pr_bacteria 2718218475 2721609054 479
391 iso_pr_bacteria 2728369362 2730151928 479
392 iso_pr_bacteria 2770939318 2771021697 479
393 iso_pr_bacteria 2778261153 2779041678 479
394 iso_pr_bacteria 2799112220 2799192142 479
395 iso_pr_bacteria 2806310895 2807944941 479
396 iso_pr_bacteria 2898975184 2898977057 479
397 iso_pr_bacteria 2898991528 2898995406 479
398 iso_pr_bacteria 2901296437 2901298576 479
399 iso_pr_bacteria 2912636047 2912640723 479
400 iso_pr_bacteria 2937236879 2937238091 479
401 iso_pr_bacteria 2940218408 2940220353 479
402 iso_pr_bacteria 2940261461 2940263400 479
403 iso_pr_bacteria 2957623355 2957626439 479
404 iso_pr_bacteria 2960772748 2960773637 479
405 iso_pr_bacteria 2964739456 2964742121 479
406 iso_pr_bacteria 2964749277 2964752392 479
407 iso_pr_bacteria 2964765680 2964768822 479
408 iso_pr_bacteria 2964775400 2964778419 479
409 iso_pr_bacteria 2964778705 2964781703 479
410 iso_pr_bacteria 2967802344 2967805391 479
411 iso_pr_bacteria 2967825073 2967827860 479
412 iso_pr_bacteria 2970199020 2970201909 479
413 iso_pr_bacteria 2970225615 2970228684 479
414 iso_pr_bacteria 2970254690 2970257474 479
415 iso_pr_bacteria 2977592972 2977595567 479
416 iso_pr_bacteria 2977596371 2977599274 479
417 iso_pr_bacteria 2977622177 2977624555 479
418 iso_pr_bacteria 2977628635 2977631661 479
419 iso_pr_bacteria 2977635137 2977638162 479
420 iso_pr_bacteria 2977653127 2977656010 479
421 iso_pr_bacteria 8022116796 8022117313 479
422 iso_pr_bacteria 8022345672 8022347468 479
423 iso_pr_bacteria 8073124432 8073126744 479
424 iso_pr_bacteria 8108576847 8108578406 479
425 iso_pr_bacteria 8110023836 8110026248 479
426 iso_pr_bacteria 8114549044 8114550603 479
427 3300007224 Ga0104147_1006250 Ga0104147_10062504 480
428 3300056790 Ga0562379_0419 Ga0562379_0419_25954_27396 480
429 3300056842 Ga0562377_0001 Ga0562377_0001_4768247_4769689 480
430 3300056856 Ga0562375_0015 Ga0562375_0015_298011_299453 480
431 iso_pr_bacteria 2511231129 2511732956 480
432 iso_pr_bacteria 2576861670 2579167321 480
433 iso_pr_bacteria 2597490293 2598963014 480
434 iso_pr_bacteria 2599185261 2599817020 480
435 iso_pr_bacteria 2645727860 2647288458 480
436 iso_pr_bacteria 2648501209 2648984816 480
437 iso_pr_bacteria 2690315820 2691201761 480
438 iso_pr_bacteria 2718218475 2721609053 480
439 iso_pr_bacteria 2728369362 2730151927 480
440 iso_pr_bacteria 2770939318 2771021696 480
441 iso_pr_bacteria 2775507073 2777016551 480
442 iso_pr_bacteria 2937236879 2937238090 480
443 iso_pr_bacteria 2957623355 2957626438 480
444 iso_pr_bacteria 2960772748 2960773638 480
445 iso_pr_bacteria 2964739456 2964742122 480
446 iso_pr_bacteria 2964749277 2964752391 480
447 iso_pr_bacteria 2964765680 2964768821 480
448 iso_pr_bacteria 2964775400 2964778418 480
449 iso_pr_bacteria 2964778705 2964781702 480
450 iso_pr_bacteria 2967802344 2967805392 480
451 iso_pr_bacteria 2967825073 2967827859 480
452 iso_pr_bacteria 2970199020 2970201908 480
453 iso_pr_bacteria 2970225615 2970228685 480
454 iso_pr_bacteria 2970254690 2970257473 480
455 iso_pr_bacteria 2977592972 2977595566 480
456 iso_pr_bacteria 2977596371 2977599275 480
457 iso_pr_bacteria 2977622177 2977624554 480
458 iso_pr_bacteria 2977628635 2977631660 480
459 iso_pr_bacteria 2977635137 2977638161 480
460 iso_pr_bacteria 2977653127 2977656009 480
461 iso_pr_bacteria 8001918023 8001918343 480
462 iso_pr_bacteria 8018794549 8018795635 480
463 3300042605 Ga0466716_240743 Ga0466716_240743_869_2314 481
464 3300042659 Ga0466733_002585 Ga0466733_002585_2081_3526 481
465 iso_pr_bacteria 2788499854 2788760167 481
466 3300000333 HBC_ctgsDRAFT_1000229 HBC_ctgsDRAFT_10002292 482
467 3300042659 Ga0466733_026022 Ga0466733_026022_15242_16690 482
468 iso_pr_bacteria 2540341223 2540961966 482
469 iso_pr_bacteria 2540341224 2540962425 482
470 iso_pr_bacteria 2540341224 2540962743 482
471 iso_pr_bacteria 2540341224 2540962998 482
472 iso_pr_bacteria 2684622925 2686101458 482
473 iso_pr_bacteria 2838840603 2838841919 482
474 iso_pr_bacteria 2840795165 2840797532 482
475 iso_pr_bacteria 2843334863 2843337432 482
476 iso_pr_bacteria 2846475167 2846477415 482
477 iso_pr_bacteria 2846495668 2846497111 482
478 iso_pr_bacteria 2849468476 2849469987 482
479 iso_pr_bacteria 2870897478 2870898661 482
480 iso_pr_bacteria 2873656248 2873657617 482
481 iso_pr_bacteria 2876022486 2876024660 482
482 iso_pr_bacteria 8088491222 8088492688 482
483 iso_pr_bacteria 8088493931 8088495446 482
484 3300000490 SCG598L16_135255 SCG598L16_1352554 483
485 3300012847 Ga0160445_100393 Ga0160445_1003939 483
486 3300042625 Ga0466730_032447 Ga0466730_032447_63730_65181 483
487 3300056856 Ga0562375_0018 Ga0562375_0018_414980_416431 483
488 3300056856 Ga0562375_0403 Ga0562375_0403_83367_84818 483
489 3300042599 Ga0466706_039932 Ga0466706_039932_2186_3640 484
490 3300042655 Ga0466727_293995 Ga0466727_293995_3300_4754 484
491 iso_pr_bacteria 2758568513 2760266193 484
492 iso_pr_bacteria 2758568514 2760267482 484
493 iso_pr_bacteria 2940218408 2940219792 484
494 iso_pr_bacteria 2940261461 2940262774 484
495 iso_pr_bacteria 8017536074 8017536941 484
496 3300000333 HBC_ctgsDRAFT_1006972 HBC_ctgsDRAFT_10069722 485
497 3300042619 Ga0466726_073097 Ga0466726_073097_5667_7124 485
498 iso_pr_bacteria 2551306396 2552921589 485
499 iso_pr_bacteria 2799112229 2799228910 485
500 iso_pr_bacteria 2881375749 2881376898 485
501 iso_pr_bacteria 2882334426 2882335219 485
502 iso_pr_bacteria 2983866074 2983867290 485
503 3300042591 Ga0466692_196088 Ga0466692_196088_2593_4053 486
504 3300042593 Ga0466691_096132 Ga0466691_096132_2734_4194 486
505 3300042618 Ga0466723_009537 Ga0466723_009537_13529_14989 486
506 3300042652 Ga0466708_367788 Ga0466708_367788_3443_4903 486
507 3300042596 Ga0466696_344823 Ga0466696_344823_320_1783 487
508 3300042596 Ga0466696_464825 Ga0466696_464825_3165_4628 487
509 3300042612 Ga0466705_015908 Ga0466705_015908_956_2419 487
510 3300042612 Ga0466705_040091 Ga0466705_040091_2583_4046 487
511 3300042643 Ga0466704_238432 Ga0466704_238432_8659_10122 487
512 3300056790 Ga0562379_0039 Ga0562379_0039_231688_233151 487
513 3300056856 Ga0562375_3454 Ga0562375_3454_8229_9698 489
514 3300042624 Ga0466735_143531 Ga0466735_143531_2824_4296 490
515 iso_pr_bacteria 2896843662 2896844978 491
516 iso_pr_bacteria 8017489919 8017492494 491
517 iso_pr_bacteria 2820416776 2820417314 499
518 iso_pr_bacteria 2820471304 2820471753 499
519 3300010167 Ga0123353_10032186 Ga0123353_100321862 500
520 3300057007 Ga0562374_0006 Ga0562374_0006_468774_470276 500
521 3300056790 Ga0562379_0006 Ga0562379_0006_643158_644681 507
522 iso_pr_bacteria 2515154048 2515334122 522

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1 4 473 0.92

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.