Protein Family IF10750

Metagenome Isolate
283 Members
169 Samples
162 Scaffolds
400.74 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2509276035|2509456152|
Length
442 aa
Sequence
MEIIIPIILAVIVFSVLILFMSAGLISARKKLLPQGDVKIKVNGEKTFEAKPGGTLLGVLSSQSVFLPSACGGGGTCAMCRCQVDNGGGDILPTELNHISRKDAQDNWRLACQVKVRGDMEIRVPEEIFGIQKWECTVVSNYNVASFIKEFVVRLPEGEEMNFDPGGYIQIDVPKITVDYKNIDIEAHPEHHGDNPNKFQDEWDTYKLWDLQMVNDEPQFRAYSMANHPAEGNIVMLNIRIATPPFKFKQVDGKRVWDGYQDINPGVCSSYIFNQKPGDKVVVSGPYGEFHIKPTKKEMVYIGGGAGMAPLRSHLFHLFHTLKTTDRKVSFWYGGRTRRELFYIEQFREIEKQFPNFRFYVALDNPLPEDNWQVKENIEANGDGFKGFIMPVCYEQYLKDHPEPEEIEYYFCGPPMMNKSVIDTLDRLGVPEENISFDDFGG

πŸ“Š Sample Types

Isolate 42.8%
Metagenome 57.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 51.3%
Termitidae 12.2%
Kalotermitidae 9.0%
Elmidae 4.5%
Drosophilidae 3.8%
Termopsidae 2.6%
Rhinotermitidae 1.9%
Talitridae 1.9%
Palinuridae 1.9%
Nephropidae 1.3%
Culicidae 1.3%
Majidae 1.3%
Artemiidae 0.6%
Passalidae 0.6%
Lysianassidae 0.6%
Daphniidae 0.6%
Hodotermitidae 0.6%
Blattidae 0.6%
Plutellidae 0.6%
Penaeidae 0.6%
Curculionidae 0.6%
Harpacticidae 0.6%
Pteromalidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 275
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 2511231129 Vibrio sp. EJY3 Isolate Unclassified
4 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
5 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
6 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
7 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
8 2703719240 Serratia marcescens ano2 Isolate Unclassified
9 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
10 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 640963010 Vibrio harveyi HY01 Isolate Unclassified
17 8022345672 Vibrio sp. 070316B Isolate Unclassified
18 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
19 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
20 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
21 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
22 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
23 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
24 2908136803 Vibrio owensii 1700302 Isolate Unclassified
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
29 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
30 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
31 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
32 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
33 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
36 8022087107 Vibrio sp. OULL4 Isolate Unclassified
37 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
38 2850895757 Vibrio campbellii 170502 Isolate Unclassified
39 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
40 2872471378 Vibrio owensii V180403 Isolate Unclassified
41 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
42 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
48 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
51 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
52 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
53 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
54 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
55 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
56 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
57 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
58 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
59 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
63 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
64 2574179716 Serratia sp. DD3 Isolate Daphniidae
65 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
66 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
67 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
68 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
69 2718217944 Serratia marcescens AS1 Isolate Culicidae
70 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
71 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
72 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
73 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
74 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
75 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
76 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
77 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
78 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
79 2864768727 Aeromonas veronii S00020 Isolate Elmidae
80 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
81 2882250448 Bizionia sp. APA-3 Isolate
82 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
83 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
84 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
85 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
89 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
90 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
91 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
92 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
93 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
94 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
95 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
96 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
97 2703719239 Serratia marcescens ano1 Isolate Unclassified
98 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
99 8051551332 Vibrio vulnificus Vv003 Isolate
100 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
101 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
102 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
103 2912570088 Vibrio parahaemolyticus CHN25 Isolate
104 2998907766 Penaeicola halotolerans LMIT005 Isolate
105 3004667792 Bacteroides sp. 519 Isolate Blattidae
106 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
107 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
108 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
109 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
112 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
113 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
114 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
115 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
116 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
117 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
118 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
119 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
120 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
121 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
122 2585428048 Colwellia sp. NBT2012 Isolate
123 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
124 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
125 2684622551 Vibrio campbellii E1 Isolate Unclassified
126 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
127 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
128 8022096067 Vibrio sp. SALL6 Isolate Unclassified
129 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
130 8051461712 Vibrio vulnificus Vv002 Isolate
131 8060845732 Vibrio vulnificus Vv006 Isolate
132 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
133 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
134 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
135 2864791955 Aeromonas veronii S00030 Isolate Elmidae
136 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
137 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
138 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
139 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
140 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
141 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
142 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
143 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
144 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
145 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
146 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
147 3006242587 Vibrio sp. RE86 Isolate Unclassified
148 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
149 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
150 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
151 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
152 2585427605 Colwellia sp. MT2012 Isolate
153 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
154 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
155 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
156 2791355473 Vibrio barjaei 3062 Isolate Unclassified
157 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
158 8051534459 Vibrio vulnificus Vv004 Isolate
159 2021593000 Sample 264 Metagenome Harpacticidae
160 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
161 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
162 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
163 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
164 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
165 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
166 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
167 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
168 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
169 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_124605 3300042659 Bacteria 7313
2 Ga0466718_157292 3300042617 Bacteria 2199
3 Ga0466726_096410 3300042619 Bacteria 6353
4 Ga0466729_107958 3300042621 Bacteria 3751
5 Ga0466729_130516 3300042621 Bacteria 4443
6 Ga0466706_055805 3300042599 Bacteria 42469
7 Ga0466707_165010 3300042601 Bacteria 11468
8 Ga0466735_217855 3300042624 Bacteria 2494
9 Ga0466704_026184 3300042643 Bacteria 4945
10 Ga0466704_211326 3300042643 Bacteria 9813
11 Ga0466709_263794 3300042648 Bacteria 4001
12 Ga0466708_156244 3300042652 Bacteria 59741
13 Ga0466708_359348 3300042652 Bacteria 27546
14 2227302993 2225789004 Bacteria 29974
15 Ga0072941_1094919 3300005201 Bacteria 8425
16 Ga0466710_117386 3300042613 Bacteria 2314
17 Ga0466715_577348 3300042616 Bacteria 2188
18 Ga0466718_066015 3300042617 Bacteria 2878
19 Ga0466723_082277 3300042618 Bacteria 15970
20 Ga0466723_204091 3300042618 Bacteria 19692
21 Ga0466723_240755 3300042618 Bacteria 5870
22 Ga0123356_10019703 3300010049 Bacteria 6393
23 Ga0123353_10000048 3300010167 Bacteria 132187
24 Ga0466706_109799 3300042599 Bacteria 205088
25 Ga0466700_402159 3300042600 Bacteria 2083
26 Ga0466714_066014 3300042603 Bacteria 5444
27 Ga0466714_116984 3300042603 Bacteria 48613
28 Ga0466716_065389 3300042605 Bacteria 6584
29 Ga0466698_231128 3300042610 Bacteria 6341
30 Ga0466690_206482 3300042590 Bacteria 1996
31 Ga0466692_117651 3300042591 Bacteria 11912
32 Ga0466735_149044 3300042624 Bacteria 1705
33 Ga0466703_071102 3300042636 Bacteria 7949
34 Ga0466709_304202 3300042648 Bacteria 34829
35 Ga0466733_044617 3300042659 Bacteria 6263
36 Ga0466733_193298 3300042659 Bacteria 2904
37 Ga0466723_113602 3300042618 Bacteria 14980
38 Ga0466728_133470 3300042620 Bacteria 14287
39 Ga0123356_10031804 3300010049 Bacteria 4939
40 Ga0466714_135405 3300042603 Bacteria 17983
41 Ga0466690_052977 3300042590 Bacteria 7311
42 Ga0466690_274062 3300042590 Bacteria 7288
43 Ga0466691_204801 3300042593 Bacteria 98819
44 Ga0466695_169365 3300042595 Unclassified 4679
45 Ga0466696_282423 3300042596 Bacteria 7042
46 Ga0466735_170123 3300042624 Bacteria 3230
47 Ga0466735_200867 3300042624 Unclassified 2694
48 Ga0466703_115407 3300042636 Bacteria 9582
49 Ga0466727_201474 3300042655 Bacteria 4015
50 Ga0068302_10003377 3300005071 Bacteria 18657
51 Ga0466711_402154 3300042615 Bacteria 17656
52 Ga0466723_105874 3300042618 Bacteria 6703
53 Ga0466728_181965 3300042620 Bacteria 5621
54 Ga0466729_176010 3300042621 Bacteria 7311
55 Ga0123355_10000066 3300009826 Bacteria 112451
56 Ga0466706_012489 3300042599 Bacteria 11733
57 Ga0466706_060170 3300042599 Bacteria 4114
58 Ga0466706_289603 3300042599 Bacteria 1671
59 Ga0466707_090114 3300042601 Bacteria 4523
60 Ga0466722_079073 3300042609 Bacteria 10083
61 Ga0466698_265668 3300042610 Bacteria 3561
62 Ga0466656_187799 3300042550 Bacteria 11183
63 Ga0466690_131738 3300042590 Bacteria 9296
64 Ga0466691_112123 3300042593 Bacteria 11372
65 Ga0466691_186714 3300042593 Bacteria 3824
66 Ga0466696_093390 3300042596 Bacteria 8249
67 Ga0466703_337667 3300042636 Bacteria 3420
68 Ga0466709_042012 3300042648 Bacteria 35741
69 Ga0466709_358641 3300042648 Bacteria 4902
70 Ga0466709_414440 3300042648 Bacteria 3781
71 Ga0466708_040388 3300042652 Bacteria 5342
72 Ga0466708_139958 3300042652 Bacteria 20161
73 Ga0466705_032181 3300042612 Bacteria 5787
74 Ga0466705_118927 3300042612 Bacteria 2650
75 Ga0466711_187976 3300042615 Bacteria 8132
76 Ga0466715_557528 3300042616 Bacteria 9946
77 Ga0466723_086929 3300042618 Bacteria 10928
78 Ga0466728_307892 3300042620 Bacteria 18841
79 Ga0466728_336785 3300042620 Bacteria 20642
80 Ga0466729_116407 3300042621 Bacteria 45416
81 Ga0123355_10000037 3300009826 Bacteria 130470
82 Ga0466706_036474 3300042599 Bacteria 21604
83 Ga0466714_021925 3300042603 Bacteria 4489
84 Ga0466714_071171 3300042603 Bacteria 8163
85 Ga0466716_060132 3300042605 Bacteria 7699
86 Ga0466719_113450 3300042606 Bacteria 4449
87 Ga0466721_012145 3300042608 Bacteria 9610
88 Ga0466722_066124 3300042609 Bacteria 18397
89 Ga0466691_093774 3300042593 Bacteria 7688
90 Ga0466729_310160 3300042621 Bacteria 2072
91 Ga0466730_043391 3300042625 Bacteria 6387
92 Ga0466709_240386 3300042648 Bacteria 67601
93 Ga0466727_128772 3300042655 Bacteria 4597
94 Ga0063521_1000043 3300003973 Bacteria 109392
95 Ga0063521_1000062 3300003973 Bacteria 94430
96 Ga0068302_10053598 3300005071 Unclassified 3845
97 Ga0466697_213200 3300042611 Bacteria 5007
98 Ga0466705_084120 3300042612 Bacteria 7413
99 Ga0466732_255270 3300042656 Bacteria 2593
100 Ga0466733_043812 3300042659 Bacteria 2039
101 Ga0466733_210826 3300042659 Bacteria 17624
102 Ga0466715_002858 3300042616 Bacteria 3180
103 Ga0466715_279960 3300042616 Bacteria 9218
104 Ga0466723_054721 3300042618 Bacteria 8502
105 Ga0466728_058767 3300042620 Bacteria 6135
106 Ga0123353_10000066 3300010167 Bacteria 114986
107 Ga0123353_10134968 3300010167 Bacteria 3958
108 Ga0466706_059878 3300042599 Bacteria 8521
109 Ga0466714_068131 3300042603 Bacteria 8263
110 Ga0466721_227056 3300042608 Bacteria 1344
111 Ga0264413_157684 3300024493 Bacteria 3217
112 Ga0466690_129026 3300042590 Bacteria 6489
113 Ga0466696_323023 3300042596 Bacteria 35296
114 Ga0466735_055982 3300042624 Bacteria 1423
115 Ga0466703_056798 3300042636 Bacteria 103240
116 Ga0466703_345410 3300042636 Bacteria 11461
117 Ga0466704_318155 3300042643 Bacteria 14579
118 Ga0466708_105553 3300042652 Bacteria 19440
119 Ga0068302_10014386 3300005071 Bacteria 15150
120 Ga0072940_1161574 3300005200 Bacteria 3197
121 Ga0466705_117204 3300042612 Bacteria 13174
122 Ga0466715_470600 3300042616 Bacteria 30941
123 Ga0123353_10000002 3300010167 Bacteria 351672
124 Ga0123353_10011971 3300010167 Bacteria 12277
125 Ga0466700_424946 3300042600 Bacteria 6680
126 Ga0466714_126192 3300042603 Unclassified 3418
127 Ga0466716_069301 3300042605 Bacteria 13539
128 Ga0466719_176219 3300042606 Bacteria 6955
129 Ga0466691_011475 3300042593 Bacteria 15015
130 Ga0466691_040831 3300042593 Bacteria 126917
131 Ga0466691_057372 3300042593 Bacteria 14850
132 Ga0466704_193450 3300042643 Bacteria 17342
133 Ga0466709_011761 3300042648 Bacteria 10258
134 Ga0466727_000915 3300042655 Bacteria 3358
135 Ga0466727_007006 3300042655 Bacteria 16828
136 JGI24699J35502_11134218 3300002509 Bacteria 66161
137 Ga0072941_1069867 3300005201 Bacteria 5763
138 Ga0466705_286694 3300042612 Bacteria 89956
139 Ga0466712_012980 3300042614 Bacteria 18403
140 Ga0466711_186159 3300042615 Bacteria 2021
141 Ga0466715_251858 3300042616 Unclassified 4524
142 Ga0466726_397683 3300042619 Bacteria 1370
143 Ga0123356_10071023 3300010049 Bacteria 3267
144 Ga0466706_267526 3300042599 Bacteria 85127
145 Ga0466713_033466 3300042602 Bacteria 29048
146 Ga0466713_034260 3300042602 Bacteria 72573
147 Ga0466713_056468 3300042602 Bacteria 31687
148 Ga0466714_142503 3300042603 Bacteria 1977
149 Ga0466722_010974 3300042609 Bacteria 6169
150 Ga0466722_028185 3300042609 Bacteria 38347
151 Ga0466722_241873 3300042609 Bacteria 1594
152 Ga0247289_0302 3300035363 Unclassified 8727
153 Ga0466690_109808 3300042590 Bacteria 2082
154 Ga0466696_252099 3300042596 Bacteria 1936
155 Ga0466696_377181 3300042596 Bacteria 59848
156 Ga0466735_015306 3300042624 Bacteria 3454
157 Ga0466730_027937 3300042625 Bacteria 15598
158 Ga0466724_64744 3300042649 Unclassified 10000
159 Ga0466708_029921 3300042652 Bacteria 54741
160 TM1208_contig02258 2021593000 Bacteria 2727
161 Meta3P_1002144 3300002464 Unclassified 7619
162 Ga0063521_1000013 3300003973 Bacteria 168262

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 212 291 0.94
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 302 421 0.87
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 41 116 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00175 GO:0016491 oxidoreductase activity MF
PF00111 GO:0051536 iron-sulfur cluster binding MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.