Protein Family IF10750
Metagenome
Isolate
283
Members
169
Samples
162
Scaffolds
400.74
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2509276035|2509456152|
- Length
- 442 aa
- Sequence
- MEIIIPIILAVIVFSVLILFMSAGLISARKKLLPQGDVKIKVNGEKTFEAKPGGTLLGVLSSQSVFLPSACGGGGTCAMCRCQVDNGGGDILPTELNHISRKDAQDNWRLACQVKVRGDMEIRVPEEIFGIQKWECTVVSNYNVASFIKEFVVRLPEGEEMNFDPGGYIQIDVPKITVDYKNIDIEAHPEHHGDNPNKFQDEWDTYKLWDLQMVNDEPQFRAYSMANHPAEGNIVMLNIRIATPPFKFKQVDGKRVWDGYQDINPGVCSSYIFNQKPGDKVVVSGPYGEFHIKPTKKEMVYIGGGAGMAPLRSHLFHLFHTLKTTDRKVSFWYGGRTRRELFYIEQFREIEKQFPNFRFYVALDNPLPEDNWQVKENIEANGDGFKGFIMPVCYEQYLKDHPEPEEIEYYFCGPPMMNKSVIDTLDRLGVPEENISFDDFGG
Sample Types
Isolate
42.8%
Metagenome
57.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
51.3%
Termitidae
12.2%
Kalotermitidae
9.0%
Elmidae
4.5%
Drosophilidae
3.8%
Termopsidae
2.6%
Rhinotermitidae
1.9%
Talitridae
1.9%
Palinuridae
1.9%
Nephropidae
1.3%
Culicidae
1.3%
Majidae
1.3%
Artemiidae
0.6%
Passalidae
0.6%
Lysianassidae
0.6%
Daphniidae
0.6%
Hodotermitidae
0.6%
Blattidae
0.6%
Plutellidae
0.6%
Penaeidae
0.6%
Curculionidae
0.6%
Harpacticidae
0.6%
Pteromalidae
0.6%
Taxonomy
Archaea
0
Bacteria
275
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 4 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 5 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 6 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 7 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 8 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 9 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 10 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 17 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 18 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 19 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 20 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 21 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 22 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 23 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 24 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 29 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 30 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 31 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 32 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 33 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 37 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 38 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 39 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 40 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 41 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 48 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 51 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 52 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 53 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 54 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 55 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 56 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 57 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 58 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 59 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 60 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 61 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 62 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 63 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 64 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 65 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 66 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 67 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 68 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 69 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 70 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 71 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 72 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 73 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 74 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 75 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 76 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 77 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 78 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 79 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 80 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 81 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 82 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 83 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 84 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 85 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 86 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 87 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 88 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 89 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 90 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 91 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 92 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 93 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 94 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 95 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 96 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 97 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 98 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 99 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 100 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 101 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 102 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 103 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 104 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 105 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 106 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 107 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 108 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 109 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 110 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 111 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 112 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 113 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 114 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 115 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 116 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 117 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 118 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 119 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 120 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 121 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 122 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 123 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 124 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 125 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 126 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 127 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 128 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 129 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 130 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 131 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 132 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 133 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 134 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 135 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 136 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 137 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 138 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 139 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 140 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 141 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 142 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 143 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 144 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 145 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 146 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 147 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 148 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 149 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 150 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 151 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 152 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 153 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 154 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 155 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 156 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 157 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 158 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 159 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 160 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 161 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 162 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 163 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 164 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 165 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 166 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 167 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 168 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 169 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_124605 | 3300042659 | Bacteria | 7313 |
| 2 | Ga0466718_157292 | 3300042617 | Bacteria | 2199 |
| 3 | Ga0466726_096410 | 3300042619 | Bacteria | 6353 |
| 4 | Ga0466729_107958 | 3300042621 | Bacteria | 3751 |
| 5 | Ga0466729_130516 | 3300042621 | Bacteria | 4443 |
| 6 | Ga0466706_055805 | 3300042599 | Bacteria | 42469 |
| 7 | Ga0466707_165010 | 3300042601 | Bacteria | 11468 |
| 8 | Ga0466735_217855 | 3300042624 | Bacteria | 2494 |
| 9 | Ga0466704_026184 | 3300042643 | Bacteria | 4945 |
| 10 | Ga0466704_211326 | 3300042643 | Bacteria | 9813 |
| 11 | Ga0466709_263794 | 3300042648 | Bacteria | 4001 |
| 12 | Ga0466708_156244 | 3300042652 | Bacteria | 59741 |
| 13 | Ga0466708_359348 | 3300042652 | Bacteria | 27546 |
| 14 | 2227302993 | 2225789004 | Bacteria | 29974 |
| 15 | Ga0072941_1094919 | 3300005201 | Bacteria | 8425 |
| 16 | Ga0466710_117386 | 3300042613 | Bacteria | 2314 |
| 17 | Ga0466715_577348 | 3300042616 | Bacteria | 2188 |
| 18 | Ga0466718_066015 | 3300042617 | Bacteria | 2878 |
| 19 | Ga0466723_082277 | 3300042618 | Bacteria | 15970 |
| 20 | Ga0466723_204091 | 3300042618 | Bacteria | 19692 |
| 21 | Ga0466723_240755 | 3300042618 | Bacteria | 5870 |
| 22 | Ga0123356_10019703 | 3300010049 | Bacteria | 6393 |
| 23 | Ga0123353_10000048 | 3300010167 | Bacteria | 132187 |
| 24 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 25 | Ga0466700_402159 | 3300042600 | Bacteria | 2083 |
| 26 | Ga0466714_066014 | 3300042603 | Bacteria | 5444 |
| 27 | Ga0466714_116984 | 3300042603 | Bacteria | 48613 |
| 28 | Ga0466716_065389 | 3300042605 | Bacteria | 6584 |
| 29 | Ga0466698_231128 | 3300042610 | Bacteria | 6341 |
| 30 | Ga0466690_206482 | 3300042590 | Bacteria | 1996 |
| 31 | Ga0466692_117651 | 3300042591 | Bacteria | 11912 |
| 32 | Ga0466735_149044 | 3300042624 | Bacteria | 1705 |
| 33 | Ga0466703_071102 | 3300042636 | Bacteria | 7949 |
| 34 | Ga0466709_304202 | 3300042648 | Bacteria | 34829 |
| 35 | Ga0466733_044617 | 3300042659 | Bacteria | 6263 |
| 36 | Ga0466733_193298 | 3300042659 | Bacteria | 2904 |
| 37 | Ga0466723_113602 | 3300042618 | Bacteria | 14980 |
| 38 | Ga0466728_133470 | 3300042620 | Bacteria | 14287 |
| 39 | Ga0123356_10031804 | 3300010049 | Bacteria | 4939 |
| 40 | Ga0466714_135405 | 3300042603 | Bacteria | 17983 |
| 41 | Ga0466690_052977 | 3300042590 | Bacteria | 7311 |
| 42 | Ga0466690_274062 | 3300042590 | Bacteria | 7288 |
| 43 | Ga0466691_204801 | 3300042593 | Bacteria | 98819 |
| 44 | Ga0466695_169365 | 3300042595 | Unclassified | 4679 |
| 45 | Ga0466696_282423 | 3300042596 | Bacteria | 7042 |
| 46 | Ga0466735_170123 | 3300042624 | Bacteria | 3230 |
| 47 | Ga0466735_200867 | 3300042624 | Unclassified | 2694 |
| 48 | Ga0466703_115407 | 3300042636 | Bacteria | 9582 |
| 49 | Ga0466727_201474 | 3300042655 | Bacteria | 4015 |
| 50 | Ga0068302_10003377 | 3300005071 | Bacteria | 18657 |
| 51 | Ga0466711_402154 | 3300042615 | Bacteria | 17656 |
| 52 | Ga0466723_105874 | 3300042618 | Bacteria | 6703 |
| 53 | Ga0466728_181965 | 3300042620 | Bacteria | 5621 |
| 54 | Ga0466729_176010 | 3300042621 | Bacteria | 7311 |
| 55 | Ga0123355_10000066 | 3300009826 | Bacteria | 112451 |
| 56 | Ga0466706_012489 | 3300042599 | Bacteria | 11733 |
| 57 | Ga0466706_060170 | 3300042599 | Bacteria | 4114 |
| 58 | Ga0466706_289603 | 3300042599 | Bacteria | 1671 |
| 59 | Ga0466707_090114 | 3300042601 | Bacteria | 4523 |
| 60 | Ga0466722_079073 | 3300042609 | Bacteria | 10083 |
| 61 | Ga0466698_265668 | 3300042610 | Bacteria | 3561 |
| 62 | Ga0466656_187799 | 3300042550 | Bacteria | 11183 |
| 63 | Ga0466690_131738 | 3300042590 | Bacteria | 9296 |
| 64 | Ga0466691_112123 | 3300042593 | Bacteria | 11372 |
| 65 | Ga0466691_186714 | 3300042593 | Bacteria | 3824 |
| 66 | Ga0466696_093390 | 3300042596 | Bacteria | 8249 |
| 67 | Ga0466703_337667 | 3300042636 | Bacteria | 3420 |
| 68 | Ga0466709_042012 | 3300042648 | Bacteria | 35741 |
| 69 | Ga0466709_358641 | 3300042648 | Bacteria | 4902 |
| 70 | Ga0466709_414440 | 3300042648 | Bacteria | 3781 |
| 71 | Ga0466708_040388 | 3300042652 | Bacteria | 5342 |
| 72 | Ga0466708_139958 | 3300042652 | Bacteria | 20161 |
| 73 | Ga0466705_032181 | 3300042612 | Bacteria | 5787 |
| 74 | Ga0466705_118927 | 3300042612 | Bacteria | 2650 |
| 75 | Ga0466711_187976 | 3300042615 | Bacteria | 8132 |
| 76 | Ga0466715_557528 | 3300042616 | Bacteria | 9946 |
| 77 | Ga0466723_086929 | 3300042618 | Bacteria | 10928 |
| 78 | Ga0466728_307892 | 3300042620 | Bacteria | 18841 |
| 79 | Ga0466728_336785 | 3300042620 | Bacteria | 20642 |
| 80 | Ga0466729_116407 | 3300042621 | Bacteria | 45416 |
| 81 | Ga0123355_10000037 | 3300009826 | Bacteria | 130470 |
| 82 | Ga0466706_036474 | 3300042599 | Bacteria | 21604 |
| 83 | Ga0466714_021925 | 3300042603 | Bacteria | 4489 |
| 84 | Ga0466714_071171 | 3300042603 | Bacteria | 8163 |
| 85 | Ga0466716_060132 | 3300042605 | Bacteria | 7699 |
| 86 | Ga0466719_113450 | 3300042606 | Bacteria | 4449 |
| 87 | Ga0466721_012145 | 3300042608 | Bacteria | 9610 |
| 88 | Ga0466722_066124 | 3300042609 | Bacteria | 18397 |
| 89 | Ga0466691_093774 | 3300042593 | Bacteria | 7688 |
| 90 | Ga0466729_310160 | 3300042621 | Bacteria | 2072 |
| 91 | Ga0466730_043391 | 3300042625 | Bacteria | 6387 |
| 92 | Ga0466709_240386 | 3300042648 | Bacteria | 67601 |
| 93 | Ga0466727_128772 | 3300042655 | Bacteria | 4597 |
| 94 | Ga0063521_1000043 | 3300003973 | Bacteria | 109392 |
| 95 | Ga0063521_1000062 | 3300003973 | Bacteria | 94430 |
| 96 | Ga0068302_10053598 | 3300005071 | Unclassified | 3845 |
| 97 | Ga0466697_213200 | 3300042611 | Bacteria | 5007 |
| 98 | Ga0466705_084120 | 3300042612 | Bacteria | 7413 |
| 99 | Ga0466732_255270 | 3300042656 | Bacteria | 2593 |
| 100 | Ga0466733_043812 | 3300042659 | Bacteria | 2039 |
| 101 | Ga0466733_210826 | 3300042659 | Bacteria | 17624 |
| 102 | Ga0466715_002858 | 3300042616 | Bacteria | 3180 |
| 103 | Ga0466715_279960 | 3300042616 | Bacteria | 9218 |
| 104 | Ga0466723_054721 | 3300042618 | Bacteria | 8502 |
| 105 | Ga0466728_058767 | 3300042620 | Bacteria | 6135 |
| 106 | Ga0123353_10000066 | 3300010167 | Bacteria | 114986 |
| 107 | Ga0123353_10134968 | 3300010167 | Bacteria | 3958 |
| 108 | Ga0466706_059878 | 3300042599 | Bacteria | 8521 |
| 109 | Ga0466714_068131 | 3300042603 | Bacteria | 8263 |
| 110 | Ga0466721_227056 | 3300042608 | Bacteria | 1344 |
| 111 | Ga0264413_157684 | 3300024493 | Bacteria | 3217 |
| 112 | Ga0466690_129026 | 3300042590 | Bacteria | 6489 |
| 113 | Ga0466696_323023 | 3300042596 | Bacteria | 35296 |
| 114 | Ga0466735_055982 | 3300042624 | Bacteria | 1423 |
| 115 | Ga0466703_056798 | 3300042636 | Bacteria | 103240 |
| 116 | Ga0466703_345410 | 3300042636 | Bacteria | 11461 |
| 117 | Ga0466704_318155 | 3300042643 | Bacteria | 14579 |
| 118 | Ga0466708_105553 | 3300042652 | Bacteria | 19440 |
| 119 | Ga0068302_10014386 | 3300005071 | Bacteria | 15150 |
| 120 | Ga0072940_1161574 | 3300005200 | Bacteria | 3197 |
| 121 | Ga0466705_117204 | 3300042612 | Bacteria | 13174 |
| 122 | Ga0466715_470600 | 3300042616 | Bacteria | 30941 |
| 123 | Ga0123353_10000002 | 3300010167 | Bacteria | 351672 |
| 124 | Ga0123353_10011971 | 3300010167 | Bacteria | 12277 |
| 125 | Ga0466700_424946 | 3300042600 | Bacteria | 6680 |
| 126 | Ga0466714_126192 | 3300042603 | Unclassified | 3418 |
| 127 | Ga0466716_069301 | 3300042605 | Bacteria | 13539 |
| 128 | Ga0466719_176219 | 3300042606 | Bacteria | 6955 |
| 129 | Ga0466691_011475 | 3300042593 | Bacteria | 15015 |
| 130 | Ga0466691_040831 | 3300042593 | Bacteria | 126917 |
| 131 | Ga0466691_057372 | 3300042593 | Bacteria | 14850 |
| 132 | Ga0466704_193450 | 3300042643 | Bacteria | 17342 |
| 133 | Ga0466709_011761 | 3300042648 | Bacteria | 10258 |
| 134 | Ga0466727_000915 | 3300042655 | Bacteria | 3358 |
| 135 | Ga0466727_007006 | 3300042655 | Bacteria | 16828 |
| 136 | JGI24699J35502_11134218 | 3300002509 | Bacteria | 66161 |
| 137 | Ga0072941_1069867 | 3300005201 | Bacteria | 5763 |
| 138 | Ga0466705_286694 | 3300042612 | Bacteria | 89956 |
| 139 | Ga0466712_012980 | 3300042614 | Bacteria | 18403 |
| 140 | Ga0466711_186159 | 3300042615 | Bacteria | 2021 |
| 141 | Ga0466715_251858 | 3300042616 | Unclassified | 4524 |
| 142 | Ga0466726_397683 | 3300042619 | Bacteria | 1370 |
| 143 | Ga0123356_10071023 | 3300010049 | Bacteria | 3267 |
| 144 | Ga0466706_267526 | 3300042599 | Bacteria | 85127 |
| 145 | Ga0466713_033466 | 3300042602 | Bacteria | 29048 |
| 146 | Ga0466713_034260 | 3300042602 | Bacteria | 72573 |
| 147 | Ga0466713_056468 | 3300042602 | Bacteria | 31687 |
| 148 | Ga0466714_142503 | 3300042603 | Bacteria | 1977 |
| 149 | Ga0466722_010974 | 3300042609 | Bacteria | 6169 |
| 150 | Ga0466722_028185 | 3300042609 | Bacteria | 38347 |
| 151 | Ga0466722_241873 | 3300042609 | Bacteria | 1594 |
| 152 | Ga0247289_0302 | 3300035363 | Unclassified | 8727 |
| 153 | Ga0466690_109808 | 3300042590 | Bacteria | 2082 |
| 154 | Ga0466696_252099 | 3300042596 | Bacteria | 1936 |
| 155 | Ga0466696_377181 | 3300042596 | Bacteria | 59848 |
| 156 | Ga0466735_015306 | 3300042624 | Bacteria | 3454 |
| 157 | Ga0466730_027937 | 3300042625 | Bacteria | 15598 |
| 158 | Ga0466724_64744 | 3300042649 | Unclassified | 10000 |
| 159 | Ga0466708_029921 | 3300042652 | Bacteria | 54741 |
| 160 | TM1208_contig02258 | 2021593000 | Bacteria | 2727 |
| 161 | Meta3P_1002144 | 3300002464 | Unclassified | 7619 |
| 162 | Ga0063521_1000013 | 3300003973 | Bacteria | 168262 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00175 | GO:0016491 | oxidoreductase activity | MF |
| PF00111 | GO:0051536 | iron-sulfur cluster binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.