Protein Family IF10637

Metagenome Isolate
259 Members
173 Samples
156 Scaffolds
293.18 Avg Length

🧬 Representative Sequence

ID
3300056857|Ga0562376_1167|Ga0562376_1167_18590_19606
Length
338 aa
Sequence
MPWRALHRPCRIFRGSPHRPASVSAFAEVRDYAVPMSNQAPSSATVSKAVIPVAGLGTRFLPATKAMPKEMLPVVDKPALQYVVEEAVQAGLTDVLMVTGRNKRPLEDHFDRVDGLESALQAKGDDRKLELVQQSSELADIHFVRQGDPLGLGHAVLKGELHVGSEPFAVLLGDDLIDERTPILPEMVEVQQRTGGCVVALMEVPEDQVSLYGCAAVEPTDTDGVVKVTDLVEKPAQEDAPSNLAIIGRYVLAPEIFPALHRTEPGRGNEIQLTDALKSLAADPESNGVYGVVFSGGRFDTGDKLSYIQAVVELASRREDLGADLRAWLRGFVADLDD

📊 Sample Types

Isolate 39.8%
Metagenome 60.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 17.2%
Drosophilidae 16.6%
Termitidae 16.6%
Apidae 15.4%
Formicidae 7.7%
Kalotermitidae 7.7%
Elmidae 4.7%
Tenebrionidae 3.6%
Armadillidiidae 3.0%
Rhinotermitidae 1.8%
Termopsidae 1.8%
Culicidae 1.2%
Curculionidae 0.6%
Nephropidae 0.6%
Sarcophagidae 0.6%
Muscidae 0.6%
Passalidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 243
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2832201259 Rickettsiella grylli TrM1 Isolate Unclassified
2 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
3 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
4 2908241010 Streptomyces sp. HF10 Isolate Termitidae
5 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
6 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
7 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
8 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
9 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
10 8074832014 Commensalibacter melissae M0391 Isolate Apidae
11 8074875073 Commensalibacter sp. M0265 Isolate Apidae
12 8074878724 Commensalibacter sp. M0267 Isolate Apidae
13 8074880551 Commensalibacter sp. M0268 Isolate Apidae
14 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
15 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
16 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
19 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
22 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
23 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
24 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
25 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
26 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
27 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
28 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
29 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
30 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
31 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
35 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
36 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
39 2967491045 Entomobacter blattae G55GP Isolate Unclassified
40 3002394112 Gluconobacter sp. Gdi Isolate Drosophilidae
41 3006156446 Acinetobacter baretiae B10A Isolate Apidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
48 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
49 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
50 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
51 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
52 2593339124 Clostridium sp. 4 Isolate Termitidae
53 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
54 2791354941 Bombella intestini R-52487 Isolate Unclassified
55 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 8067604290 Gluconobacter wancherniae Dm-19 Isolate Drosophilidae
58 8067607133 Gluconobacter wancherniae Dm-15 Isolate Drosophilidae
59 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
60 8074750600 Commensalibacter sp. W8163 Isolate Apidae
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
62 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 2837008993 Oecophyllibacter saccharovorans Ta1 Isolate Formicidae
68 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
69 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
70 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
71 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
72 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
73 8074745029 Commensalibacter melissae M0407 Isolate Apidae
74 8074748739 Commensalibacter sp. W8133 Isolate Apidae
75 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
76 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
77 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
78 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
79 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
80 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
81 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
82 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
83 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
84 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
85 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
86 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
87 2590828839 Clostridium sp. 1 Isolate Termitidae
88 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
89 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
90 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
91 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
92 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
93 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
94 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
95 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
96 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
97 8067598439 Gluconobacter wancherniae Dm-17 Isolate Drosophilidae
98 8074882376 Commensalibacter sp. M0270 Isolate Apidae
99 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
100 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
101 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
102 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
103 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
104 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
105 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
106 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
107 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
108 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
109 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
110 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
111 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
112 2841330038 Sulfitobacter sp. D7 Isolate
113 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
114 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
115 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
116 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
117 2718218026 Phaeobacter porticola P97 Isolate Unclassified
118 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
119 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
120 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
121 8074743123 Commensalibacter melissae M0402 Isolate Apidae
122 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
123 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
124 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
125 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
126 3300007763 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut Metagenome Drosophilidae
127 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
128 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
129 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
130 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
131 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
132 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
133 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
134 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
135 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
136 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
137 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
138 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
139 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
140 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
141 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
142 8074871419 Commensalibacter sp. M0133 Isolate Apidae
143 8074884171 Commensalibacter sp. M0355 Isolate Apidae
144 2987037630 Oecophyllibacter saccharovorans Ha5 Isolate Formicidae
145 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
146 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
147 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
148 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
149 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
150 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
151 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
152 2843073756 Oecophyllibacter saccharovorans Jb2 Isolate Formicidae
153 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
154 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
155 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
156 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
157 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
158 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
159 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
160 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
161 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
162 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
163 8074737057 Commensalibacter sp. M0357 Isolate Apidae
164 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
165 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
166 8074873247 Commensalibacter sp. M0134 Isolate Apidae
167 8074876897 Commensalibacter sp. M0266 Isolate Apidae
168 3006667155 Streptomyces sp. SID9727 Isolate
169 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
170 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
171 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
172 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
173 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_002915 3300056564 Bacteria 5918
2 Ga0562375_1322 3300056856 Bacteria 34684
3 2227627402 2225789004 Bacteria 11529
4 Ga0072941_1005707 3300005201 Bacteria 19358
5 Ga0104019_1002712 3300007150 Bacteria 7562
6 Ga0466726_008389 3300042619 Bacteria 11517
7 Ga0123357_10390791 3300009784 Bacteria 1279
8 Ga0123356_10361291 3300010049 Bacteria 1579
9 Ga0123354_10049392 3300010882 Bacteria 6381
10 Ga0466708_148588 3300042652 Bacteria 2013
11 Ga0466708_243148 3300042652 Bacteria 3476
12 Ga0466725_240843 3300042654 Unclassified 1865
13 Ga0466727_072388 3300042655 Bacteria 1551
14 Ga0466701_088040 3300042598 Bacteria 6330
15 Ga0466707_216228 3300042601 Bacteria 1421
16 Ga0466717_018148 3300042604 Unclassified 1522
17 Ga0466721_045991 3300042608 Bacteria 1090
18 Ga0466697_077413 3300042611 Bacteria 2191
19 Ga0466705_104000 3300042612 Bacteria 8026
20 Ga0562378_1395 3300056814 Bacteria 26576
21 Ga0562374_0012 3300057007 Bacteria 1595062
22 JGI24702J35022_10004513 3300002462 Bacteria 8255
23 CVPL010W_10005258 3300002931 Bacteria 13926
24 Ga0102736_1000146 3300007052 Bacteria 24419
25 Ga0102737_1000061 3300007142 Bacteria 33196
26 Ga0123355_10115283 3300009826 Bacteria 4185
27 Ga0466692_040365 3300042591 Bacteria 62446
28 Ga0466696_354588 3300042596 Bacteria 9039
29 Ga0466734_091889 3300042623 Bacteria 19526
30 Ga0466702_204763 3300042635 Bacteria 3632
31 Ga0466724_31891 3300042649 Bacteria 2838
32 Ga0466707_285869 3300042601 Bacteria 10961
33 Ga0466713_044168 3300042602 Bacteria 23186
34 Ga0466719_422240 3300042606 Bacteria 6640
35 Ga0466722_115936 3300042609 Bacteria 15963
36 Ga0466697_256664 3300042611 Bacteria 2977
37 Ga0562375_0078 3300056856 Bacteria 318030
38 Ga0103265_1005336 3300007068 Bacteria 1783
39 Ga0466726_184070 3300042619 Unclassified 1853
40 Ga0123356_10016093 3300010049 Bacteria 7148
41 Ga0123353_10086348 3300010167 Bacteria 5052
42 Ga0123353_10106391 3300010167 Bacteria 4520
43 Ga0160443_100018 3300012848 Bacteria 423460
44 Ga0160457_1000054 3300012858 Bacteria 181933
45 Ga0466690_231470 3300042590 Unclassified 4201
46 Ga0466694_002821 3300042594 Bacteria 8475
47 Ga0466709_047475 3300042648 Bacteria 4309
48 Ga0466701_096949 3300042598 Bacteria 149718
49 Ga0466713_130482 3300042602 Bacteria 6447
50 Ga0466717_167989 3300042604 Bacteria 6256
51 Ga0466719_465704 3300042606 Bacteria 95222
52 Ga0466705_092987 3300042612 Bacteria 3658
53 Ga0466733_093038 3300042659 Bacteria 2429
54 Ga0562379_0910 3300056790 Bacteria 43374
55 Ga0562376_1167 3300056857 Bacteria 38735
56 Ga0068305_10174234 3300005083 Bacteria 2015
57 Ga0072941_1697100 3300005201 Bacteria 1061
58 Ga0466715_183260 3300042616 Bacteria 25211
59 Ga0466715_434466 3300042616 Bacteria 1868
60 Ga0123355_10298522 3300009826 Bacteria 2200
61 Ga0123356_10164451 3300010049 Bacteria 2221
62 Ga0123356_11024091 3300010049 Bacteria 995
63 Ga0123353_10117588 3300010167 Bacteria 4276
64 Ga0123353_11079938 3300010167 Bacteria 1068
65 Ga0466731_029019 3300042622 Bacteria 5032
66 Ga0466703_039393 3300042636 Bacteria 2471
67 Ga0466703_216282 3300042636 Bacteria 8796
68 Ga0466727_136591 3300042655 Bacteria 7889
69 Ga0466707_099397 3300042601 Bacteria 14327
70 Ga0466713_118751 3300042602 Bacteria 3209
71 Ga0466716_281027 3300042605 Unclassified 5372
72 Ga0466705_192967 3300042612 Bacteria 33002
73 Ga0466733_031526 3300042659 Bacteria 4079
74 Ga0466733_175201 3300042659 Bacteria 7689
75 Ga0562379_4005 3300056790 Unclassified 8392
76 Ga0562378_3588 3300056814 Bacteria 8809
77 Ga0562375_0153 3300056856 Unclassified 202576
78 Ga0102737_1000365 3300007142 Bacteria 15249
79 Ga0103268_1000124 3300007192 Bacteria 25651
80 Ga0105524_101572 3300007733 Bacteria 9284
81 Ga0105004_1004368 3300007763 Bacteria 8035
82 Ga0466710_332451 3300042613 Bacteria 2161
83 Ga0466728_274228 3300042620 Bacteria 10151
84 Ga0123356_10397141 3300010049 Bacteria 1516
85 Ga0123353_10000181 3300010167 Bacteria 80450
86 Ga0123353_10235145 3300010167 Bacteria 2853
87 Ga0123354_10025489 3300010882 Bacteria 9324
88 Ga0160468_101370 3300012819 Bacteria 6156
89 Ga0466695_073968 3300042595 Bacteria 22546
90 Ga0466695_133535 3300042595 Bacteria 3711
91 Ga0466734_088519 3300042623 Bacteria 1702
92 Ga0466709_345527 3300042648 Bacteria 65587
93 Ga0466724_30381 3300042649 Bacteria 18002
94 Ga0466724_51773 3300042649 Bacteria 7886
95 Ga0466719_320006 3300042606 Bacteria 7579
96 Ga0466705_220713 3300042612 Bacteria 1627
97 Ga0562379_0018 3300056790 Bacteria 1119030
98 Ga0562374_0553 3300057007 Bacteria 60647
99 Ga0562374_1263 3300057007 Bacteria 30939
100 CVPL005L_10000001 3300002938 Bacteria 447235
101 Ga0072941_1521133 3300005201 Bacteria 2133
102 Ga0103266_1003638 3300007067 Bacteria 3854
103 Ga0102737_1004998 3300007142 Unclassified 2709
104 Ga0123357_10000073 3300009784 Bacteria 79866
105 Ga0466723_361650 3300042618 Bacteria 13087
106 Ga0466729_172713 3300042621 Bacteria 2087
107 Ga0123355_10007418 3300009826 Unclassified 16430
108 Ga0123355_10085269 3300009826 Bacteria 5027
109 Ga0123356_10006739 3300010049 Unclassified 11573
110 Ga0123353_10228448 3300010167 Bacteria 2904
111 Ga0123353_10787637 3300010167 Bacteria 1315
112 Ga0160471_101353 3300012812 Bacteria 4970
113 Ga0160457_1015932 3300012858 Bacteria 1056
114 Ga0466657_351789 3300042582 Bacteria 55510
115 Ga0466690_026359 3300042590 Bacteria 9362
116 Ga0466691_001050 3300042593 Bacteria 12292
117 Ga0466730_003163 3300042625 Bacteria 80945
118 Ga0466704_403719 3300042643 Bacteria 10396
119 Ga0466727_221212 3300042655 Bacteria 7972
120 Ga0466722_206452 3300042609 Bacteria 3131
121 Ga0466722_237249 3300042609 Bacteria 156667
122 Ga0466722_248791 3300042609 Bacteria 7834
123 Ga0562374_0549 3300057007 Bacteria 61100
124 Ga0103261_1003838 3300007083 Bacteria 2305
125 Ga0103260_1010262 3300007139 Bacteria 1298
126 Ga0104019_1030581 3300007150 Bacteria 6680
127 Ga0466715_530650 3300042616 Bacteria 14492
128 Ga0466726_029942 3300042619 Unclassified 1119
129 Ga0123356_10457689 3300010049 Bacteria 1425
130 Ga0123353_10595027 3300010167 Bacteria 1583
131 Ga0123353_10901181 3300010167 Unclassified 1204
132 Ga0466690_182897 3300042590 Bacteria 5063
133 Ga0466692_031153 3300042591 Bacteria 26388
134 Ga0466724_24188 3300042649 Bacteria 438343
135 Ga0466724_61258 3300042649 Bacteria 49653
136 Ga0466725_026708 3300042654 Bacteria 12170
137 Ga0466697_023292 3300042611 Bacteria 2650
138 Ga0466697_080552 3300042611 Bacteria 12485
139 Ga0562378_1972 3300056814 Unclassified 19210
140 Ga0562375_0047 3300056856 Bacteria 487855
141 JGI24705J35276_12224388 3300002504 Bacteria 2606
142 Ga0068302_10001864 3300005071 Unclassified 2908
143 Ga0104051_1000363 3300007078 Bacteria 3655
144 Ga0103268_1000538 3300007192 Bacteria 11309
145 Ga0466726_070623 3300042619 Unclassified 1542
146 Ga0466728_030841 3300042620 Bacteria 8786
147 Ga0466729_123526 3300042621 Bacteria 33019
148 Ga0123356_10014620 3300010049 Bacteria 7544
149 Ga0123356_10016105 3300010049 Bacteria 7143
150 Ga0123356_10823058 3300010049 Bacteria 1100
151 Ga0123354_10150517 3300010882 Unclassified 2822
152 Ga0160467_100666 3300012829 Bacteria 26438
153 Ga0415639_171047 3300038395 Bacteria 7691
154 Ga0466696_059327 3300042596 Bacteria 9420
155 Ga0466699_392553 3300042597 Bacteria 1783
156 Ga0466704_149671 3300042643 Bacteria 33574

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042654 Ga0466725_240843 Ga0466725_240843_1007_1729 240
2 3300042635 Ga0466702_204763 Ga0466702_204763_391_1176 261
3 3300012858 Ga0160457_1015932 Ga0160457_10159321 270
4 3300007142 Ga0102737_1004998 Ga0102737_10049982 274
5 3300002931 CVPL010W_10005258 CVPL010W_100052583 275
6 3300042649 Ga0466724_24188 Ga0466724_24188_407652_408518 275
7 3300042654 Ga0466725_026708 Ga0466725_026708_4772_5638 275
8 3300007052 Ga0102736_1000146 Ga0102736_100014610 276
9 3300007192 Ga0103268_1000124 Ga0103268_10001244 276
10 3300042612 Ga0466705_092987 Ga0466705_092987_2150_3028 276
11 3300005201 Ga0072941_1697100 Ga0072941_16971001 277
12 3300007083 Ga0103261_1003838 Ga0103261_10038383 281
13 3300007139 Ga0103260_1010262 Ga0103260_10102622 281
14 3300007142 Ga0102737_1000061 Ga0102737_100006114 281
15 3300042598 Ga0466701_096949 Ga0466701_096949_76456_77343 281
16 3300007142 Ga0102737_1000365 Ga0102737_100036517 282
17 iso_pr_bacteria 2963630348 2963631681 282
18 3300010882 Ga0123354_10049392 Ga0123354_100493924 284
19 3300042618 Ga0466723_361650 Ga0466723_361650_4283_5170 285
20 3300042623 Ga0466734_088519 Ga0466734_088519_238_1095 285
21 3300042602 Ga0466713_130482 Ga0466713_130482_144_1004 286
22 3300042622 Ga0466731_029019 Ga0466731_029019_2102_2962 286
23 3300056564 Ga0530661_002915 Ga0530661_002915_467_1327 286
24 3300042602 Ga0466713_044168 Ga0466713_044168_246_1109 287
25 3300042609 Ga0466722_248791 Ga0466722_248791_4466_5329 287
26 3300010049 Ga0123356_10397141 Ga0123356_103971412 288
27 3300042595 Ga0466695_073968 Ga0466695_073968_14579_15445 288
28 3300042619 Ga0466726_029942 Ga0466726_029942_48_914 288
29 iso_pr_bacteria 2724678956 2724786741 288
30 3300005071 Ga0068302_10001864 Ga0068302_100018644 289
31 iso_pr_bacteria 2619619079 2620603384 289
32 iso_pr_bacteria 2791354941 2792067039 289
33 iso_pr_bacteria 2864843793 2864845629 289
34 iso_pr_bacteria 8067598439 8067599886 289
35 iso_pr_bacteria 8067604290 8067606393 289
36 iso_pr_bacteria 8067607133 8067609334 289
37 3300009826 Ga0123355_10007418 Ga0123355_1000741811 290
38 3300009826 Ga0123355_10085269 Ga0123355_100852695 290
39 3300009826 Ga0123355_10115283 Ga0123355_101152832 290
40 3300010049 Ga0123356_10006739 Ga0123356_100067398 290
41 3300038395 Ga0415639_171047 Ga0415639_171047_1934_2806 290
42 3300042611 Ga0466697_023292 Ga0466697_023292_1629_2501 290
43 3300042611 Ga0466697_077413 Ga0466697_077413_278_1150 290
44 iso_pr_bacteria 2820870086 2820870330 290
45 iso_pr_bacteria 2820873081 2820873414 290
46 iso_pr_bacteria 2828301124 2828301716 290
47 iso_pr_bacteria 2864804954 2864807094 290
48 iso_pr_bacteria 2864840607 2864842752 290
49 iso_pr_bacteria 2864863795 2864865815 290
50 iso_pr_bacteria 2864955722 2864958599 290
51 3300009784 Ga0123357_10390791 Ga0123357_103907912 291
52 3300010049 Ga0123356_10016093 Ga0123356_100160938 291
53 3300010167 Ga0123353_10000181 Ga0123353_1000018143 291
54 3300012858 Ga0160457_1000054 Ga0160457_100005415 291
55 3300042604 Ga0466717_018148 Ga0466717_018148_355_1230 291
56 3300042616 Ga0466715_530650 Ga0466715_530650_6039_6914 291
57 3300042619 Ga0466726_070623 Ga0466726_070623_51_926 291
58 3300042621 Ga0466729_172713 Ga0466729_172713_1065_1940 291
59 3300042625 Ga0466730_003163 Ga0466730_003163_6225_7100 291
60 3300042649 Ga0466724_30381 Ga0466724_30381_16297_17172 291
61 3300042649 Ga0466724_31891 Ga0466724_31891_1133_2008 291
62 3300042649 Ga0466724_51773 Ga0466724_51773_5017_5892 291
63 3300042649 Ga0466724_61258 Ga0466724_61258_25094_25969 291
64 iso_pr_bacteria 2651870343 2654486705 291
65 iso_pr_bacteria 2756170272 2756776329 291
66 iso_pr_bacteria 2858105562 2858106094 291
67 iso_pr_bacteria 2864874997 2864877222 291
68 iso_pr_bacteria 2864973726 2864975164 291
69 iso_pr_bacteria 2868683769 2868684543 291
70 iso_pr_bacteria 3006156446 3006157264 291
71 iso_pr_bacteria 3006190525 3006193901 291
72 iso_pr_bacteria 8021899934 8021900754 291
73 iso_pr_bacteria 8116947750 8116952290 291
74 3300005201 Ga0072941_1005707 Ga0072941_10057073 292
75 3300007078 Ga0104051_1000363 Ga0104051_10003632 292
76 3300007150 Ga0104019_1002712 Ga0104019_10027125 292
77 3300009826 Ga0123355_10298522 Ga0123355_102985221 292
78 3300010049 Ga0123356_10016105 Ga0123356_100161057 292
79 3300010049 Ga0123356_10164451 Ga0123356_101644512 292
80 3300042590 Ga0466690_182897 Ga0466690_182897_2275_3153 292
81 3300042590 Ga0466690_231470 Ga0466690_231470_253_1131 292
82 3300042591 Ga0466692_031153 Ga0466692_031153_9573_10451 292
83 3300042593 Ga0466691_001050 Ga0466691_001050_10627_11505 292
84 3300042602 Ga0466713_118751 Ga0466713_118751_2119_2997 292
85 3300042605 Ga0466716_281027 Ga0466716_281027_4322_5200 292
86 3300042609 Ga0466722_237249 Ga0466722_237249_140480_141358 292
87 3300042619 Ga0466726_184070 Ga0466726_184070_606_1484 292
88 3300042620 Ga0466728_030841 Ga0466728_030841_6499_7377 292
89 3300042643 Ga0466704_403719 Ga0466704_403719_263_1141 292
90 3300042652 Ga0466708_243148 Ga0466708_243148_1586_2464 292
91 3300042655 Ga0466727_072388 Ga0466727_072388_10_888 292
92 3300042655 Ga0466727_221212 Ga0466727_221212_1570_2448 292
93 iso_pr_bacteria 2517487021 2517563935 292
94 iso_pr_bacteria 2590828839 2593253403 292
95 iso_pr_bacteria 2681813507 2684380253 292
96 iso_pr_bacteria 2820050117 2820052340 292
97 iso_pr_bacteria 2820080004 2820081590 292
98 iso_pr_bacteria 2820101058 2820102487 292
99 iso_pr_bacteria 2820155744 2820156197 292
100 iso_pr_bacteria 2967491045 2967493116 292
101 iso_pr_bacteria 3002394112 3002395672 292
102 2225789004 2227627402 2228209620 293
103 3300002504 JGI24705J35276_12224388 JGI24705J35276_122243882 293
104 3300005083 Ga0068305_10174234 Ga0068305_101742342 293
105 3300007150 Ga0104019_1030581 Ga0104019_10305814 293
106 3300007763 Ga0105004_1004368 Ga0105004_10043687 293
107 3300009784 Ga0123357_10000073 Ga0123357_1000007366 293
108 3300010882 Ga0123354_10025489 Ga0123354_1002548910 293
109 3300042590 Ga0466690_026359 Ga0466690_026359_2638_3519 293
110 3300042596 Ga0466696_354588 Ga0466696_354588_7027_7908 293
111 3300042601 Ga0466707_216228 Ga0466707_216228_203_1084 293
112 3300042606 Ga0466719_320006 Ga0466719_320006_1917_2798 293
113 3300042612 Ga0466705_220713 Ga0466705_220713_219_1100 293
114 3300042616 Ga0466715_183260 Ga0466715_183260_6203_7084 293
115 3300042619 Ga0466726_008389 Ga0466726_008389_9175_10056 293
116 3300042623 Ga0466734_091889 Ga0466734_091889_16984_17865 293
117 3300042636 Ga0466703_039393 Ga0466703_039393_636_1517 293
118 3300042636 Ga0466703_216282 Ga0466703_216282_6375_7256 293
119 3300042648 Ga0466709_047475 Ga0466709_047475_1453_2334 293
120 3300042652 Ga0466708_148588 Ga0466708_148588_220_1101 293
121 3300042655 Ga0466727_136591 Ga0466727_136591_3463_4344 293
122 iso_pr_bacteria 2513237393 2514726343 293
123 iso_pr_bacteria 2562617066 2562865614 293
124 iso_pr_bacteria 2820142992 2820143220 293
125 iso_pr_bacteria 2832201259 2832201894 293
126 iso_pr_bacteria 2864976888 2864980234 293
127 3300010882 Ga0123354_10150517 Ga0123354_101505173 294
128 3300042595 Ga0466695_133535 Ga0466695_133535_361_1245 294
129 3300042601 Ga0466707_099397 Ga0466707_099397_8027_8911 294
130 3300042601 Ga0466707_285869 Ga0466707_285869_2925_3809 294
131 3300042606 Ga0466719_465704 Ga0466719_465704_4193_5077 294
132 3300042609 Ga0466722_115936 Ga0466722_115936_10492_11376 294
133 3300042613 Ga0466710_332451 Ga0466710_332451_1219_2103 294
134 iso_pr_bacteria 2597490292 2598961918 294
135 iso_pr_bacteria 2756170209 2756539904 294
136 iso_pr_bacteria 2816332478 2818027452 294
137 iso_pr_bacteria 2833052049 2833052192 294
138 iso_pr_bacteria 2834852038 2834854340 294
139 iso_pr_bacteria 2837008993 2837009928 294
140 iso_pr_bacteria 2843073756 2843074169 294
141 iso_pr_bacteria 2854518031 2854518463 294
142 iso_pr_bacteria 2854536247 2854537763 294
143 iso_pr_bacteria 2854548700 2854549475 294
144 iso_pr_bacteria 2854576727 2854578872 294
145 iso_pr_bacteria 2858084324 2858084529 294
146 iso_pr_bacteria 2858089842 2858090856 294
147 iso_pr_bacteria 2858102877 2858104906 294
148 iso_pr_bacteria 2858110640 2858111579 294
149 iso_pr_bacteria 2858119979 2858121327 294
150 iso_pr_bacteria 2858129007 2858129117 294
151 iso_pr_bacteria 2884203697 2884203876 294
152 iso_pr_bacteria 2891591111 2891591285 294
153 iso_pr_bacteria 2891605396 2891605573 294
154 iso_pr_bacteria 2891610497 2891610665 294
155 iso_pr_bacteria 2891614855 2891615023 294
156 iso_pr_bacteria 2891675627 2891675798 294
157 iso_pr_bacteria 2891690481 2891690652 294
158 iso_pr_bacteria 2987037630 2987037749 294
159 iso_pr_bacteria 8074737057 8074738777 294
160 iso_pr_bacteria 8074743123 8074744858 294
161 iso_pr_bacteria 8074745029 8074746719 294
162 iso_pr_bacteria 8074746876 8074748575 294
163 iso_pr_bacteria 8074748739 8074750437 294
164 iso_pr_bacteria 8074750600 8074752375 294
165 iso_pr_bacteria 8074832014 8074833694 294
166 iso_pr_bacteria 8074867669 8074869433 294
167 iso_pr_bacteria 8074869529 8074871277 294
168 iso_pr_bacteria 8074871419 8074873109 294
169 iso_pr_bacteria 8074873247 8074874935 294
170 iso_pr_bacteria 8074875073 8074876755 294
171 iso_pr_bacteria 8074876897 8074878597 294
172 iso_pr_bacteria 8074878724 8074880424 294
173 iso_pr_bacteria 8074880551 8074882232 294
174 iso_pr_bacteria 8074882376 8074884065 294
175 iso_pr_bacteria 8074884171 8074885871 294
176 3300002462 JGI24702J35022_10004513 JGI24702J35022_100045134 295
177 3300007068 Ga0103265_1005336 Ga0103265_10053362 295
178 3300010049 Ga0123356_10457689 Ga0123356_104576891 295
179 3300010049 Ga0123356_10823058 Ga0123356_108230581 295
180 3300010167 Ga0123353_10117588 Ga0123353_101175883 295
181 3300010167 Ga0123353_10901181 Ga0123353_109011812 295
182 3300012829 Ga0160467_100666 Ga0160467_1006668 295
183 3300042606 Ga0466719_422240 Ga0466719_422240_1866_2753 295
184 3300042609 Ga0466722_206452 Ga0466722_206452_1049_1936 295
185 3300042612 Ga0466705_104000 Ga0466705_104000_3997_4884 295
186 3300042612 Ga0466705_192967 Ga0466705_192967_12568_13455 295
187 3300042643 Ga0466704_149671 Ga0466704_149671_29780_30667 295
188 3300042648 Ga0466709_345527 Ga0466709_345527_58910_59797 295
189 3300042659 Ga0466733_031526 Ga0466733_031526_2414_3301 295
190 3300007733 Ga0105524_101572 Ga0105524_1015726 296
191 3300010049 Ga0123356_11024091 Ga0123356_110240911 296
192 3300010167 Ga0123353_10086348 Ga0123353_100863483 296
193 3300010167 Ga0123353_10106391 Ga0123353_101063913 296
194 3300010167 Ga0123353_10235145 Ga0123353_102351452 296
195 3300010167 Ga0123353_10595027 Ga0123353_105950271 296
196 3300012819 Ga0160468_101370 Ga0160468_1013703 296
197 3300042598 Ga0466701_088040 Ga0466701_088040_2521_3411 296
198 3300042621 Ga0466729_123526 Ga0466729_123526_11147_12037 296
199 3300042659 Ga0466733_175201 Ga0466733_175201_4136_5026 296
200 iso_pr_bacteria 2617271320 2619532518 296
201 iso_pr_bacteria 2786546124 2786627004 296
202 iso_pr_bacteria 2843864159 2843865866 296
203 iso_pr_bacteria 2854520951 2854522747 296
204 iso_pr_bacteria 2868677537 2868679170 296
205 iso_pr_bacteria 651324000 651475044 296
206 3300007192 Ga0103268_1000538 Ga0103268_10005382 297
207 3300010049 Ga0123356_10361291 Ga0123356_103612912 297
208 3300012812 Ga0160471_101353 Ga0160471_1013533 297
209 3300042591 Ga0466692_040365 Ga0466692_040365_15472_16365 297
210 3300057007 Ga0562374_0012 Ga0562374_0012_967256_968170 297
211 3300057007 Ga0562374_1263 Ga0562374_1263_19888_20802 297
212 iso_pr_bacteria 2711768164 2712503096 297
213 iso_pr_bacteria 2718218026 2719803048 297
214 iso_pr_bacteria 2806310572 2806766054 297
215 iso_pr_bacteria 2816332503 2818126149 297
216 iso_pr_bacteria 2816332545 2818334037 297
217 iso_pr_bacteria 2835143510 2835146969 297
218 iso_pr_bacteria 2841330038 2841330075 297
219 iso_pr_bacteria 8067483258 8067483639 297
220 iso_pr_bacteria 8067483258 8067486647 297
221 3300007067 Ga0103266_1003638 Ga0103266_10036382 298
222 3300042608 Ga0466721_045991 Ga0466721_045991_110_1006 298
223 iso_pr_bacteria 2820050117 2820051511 298
224 3300010167 Ga0123353_10787637 Ga0123353_107876371 299
225 3300042582 Ga0466657_351789 Ga0466657_351789_32692_33591 299
226 3300042594 Ga0466694_002821 Ga0466694_002821_7192_8091 299
227 3300042611 Ga0466697_256664 Ga0466697_256664_2025_2924 299
228 iso_pr_bacteria 2918390780 2918393376 299
229 3300005201 Ga0072941_1521133 Ga0072941_15211332 300
230 3300012848 Ga0160443_100018 Ga0160443_100018194 300
231 3300042611 Ga0466697_080552 Ga0466697_080552_8007_8909 300
232 3300042616 Ga0466715_434466 Ga0466715_434466_134_1036 300
233 3300042620 Ga0466728_274228 Ga0466728_274228_8019_8921 300
234 3300056790 Ga0562379_0018 Ga0562379_0018_1054529_1055431 300
235 3300056790 Ga0562379_4005 Ga0562379_4005_290_1192 300
236 3300056814 Ga0562378_1395 Ga0562378_1395_14053_14955 300
237 3300056814 Ga0562378_1972 Ga0562378_1972_12306_13208 300
238 3300056814 Ga0562378_3588 Ga0562378_3588_6234_7136 300
239 3300056856 Ga0562375_0078 Ga0562375_0078_152860_153762 300
240 3300056856 Ga0562375_0153 Ga0562375_0153_135170_136072 300
241 3300057007 Ga0562374_0549 Ga0562374_0549_44313_45215 300
242 3300057007 Ga0562374_0553 Ga0562374_0553_26740_27642 300
243 iso_pr_bacteria 2515154104 2515589342 300
244 iso_pr_bacteria 3006667155 3006671626 300
245 iso_pr_bacteria 8012935351 8012938818 300
246 3300042597 Ga0466699_392553 Ga0466699_392553_460_1365 301
247 3300056856 Ga0562375_1322 Ga0562375_1322_20216_21124 302
248 iso_pr_bacteria 2908241010 2908243514 302
249 3300056790 Ga0562379_0910 Ga0562379_0910_35042_35953 303
250 3300002938 CVPL005L_10000001 CVPL005L_10000001224 305
251 3300042596 Ga0466696_059327 Ga0466696_059327_2438_3355 305
252 3300056856 Ga0562375_0047 Ga0562375_0047_96853_97791 305
253 iso_pr_bacteria 2593339124 2595064718 306
254 3300010167 Ga0123353_10228448 Ga0123353_102284482 307
255 3300010167 Ga0123353_11079938 Ga0123353_110799382 307
256 3300010049 Ga0123356_10014620 Ga0123356_100146203 310
257 3300042659 Ga0466733_093038 Ga0466733_093038_1356_2321 321
258 3300042604 Ga0466717_167989 Ga0466717_167989_707_1690 327
259 3300056857 Ga0562376_1167 Ga0562376_1167_18590_19606 338

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00483 NTP_transferase Nucleotidyl transferase 48 315 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.