Protein Family IF10634

Metagenome Isolate
206 Members
120 Samples
152 Scaffolds
233.5 Avg Length

🧬 Representative Sequence

ID
3300056857|Ga0562376_0505|Ga0562376_0505_26730_27575
Length
281 aa
Sequence
MRPVSARSSTVTARPCPSKRPPSTTSAEAEGPTVCIPPTDDRRIIVTIDQRVRALITDTRERVSELHAQLPFWGLVVWTAGNVSERVVVDPSGSPGDEDLLVIKPSGVRYDELSGDMMVVCDLEGNLVEELSTGGLTPSSDTAAHAYVYRNMPQVGGVVHTHSTYATAWAARGEEIPCVLTMMADEFGGPVPVGPFAIIGDDSIGRGIVETLSDSRSPAVLMRNHGPFTIGATGAEAVKAAVMVEEVAKTVHVSRQLGEPLPIEAATIDRLYDRYQNVYGQ

📊 Sample Types

Isolate 26.2%
Metagenome 73.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.3%
Termitidae 20.0%
Kalotermitidae 10.0%
Culicidae 8.2%
Tenebrionidae 7.3%
Armadillidiidae 5.5%
Formicidae 4.5%
Scarabaeidae 3.6%
Apidae 3.6%
Cerambycidae 1.8%
Hydrophilidae 1.8%
Curculionidae 1.8%
Pyralidae 0.9%
Thomisidae 0.9%
Hodotermitidae 0.9%
Termopsidae 0.9%
Rhinotermitidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 190
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
2 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
3 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
4 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
5 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
6 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
7 2931430189 Tessaracoccus palaemonis J1M15 Isolate
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
12 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
13 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
14 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
15 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
16 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
17 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2505679068 Isoptericola variabilis 225 Isolate Unclassified
21 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
22 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
23 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
24 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
25 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
26 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
27 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
28 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
29 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 8102982778 Erwinia sp. S63 Isolate Curculionidae
33 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
34 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
41 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
42 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
43 2900368070 Nocardia aurantia RB56 Isolate Termitidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
46 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
47 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
48 2504756063 Isoptericola variabilis J5 Isolate Unclassified
49 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
50 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
51 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
52 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
53 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
54 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
55 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
56 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
57 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
58 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
59 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
60 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
61 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
62 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
63 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
67 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
68 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
69 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
70 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
71 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 3002678670 Agromyces sp. G127AT Isolate Unclassified
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
76 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
77 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
78 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
82 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
83 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
84 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
85 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
86 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
87 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
88 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
89 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
90 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
91 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
92 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
93 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
94 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
95 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
96 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
97 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
98 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
99 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
100 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
101 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
102 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
103 648276708 Pantoea sp. aB Isolate Unclassified
104 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
105 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
106 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
107 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
108 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
109 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
110 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
111 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
112 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
113 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
114 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
115 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
116 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
117 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
118 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
119 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
120 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562375_0293 3300056856 Bacteria 126554
2 Ga0123356_10006147 3300010049 Bacteria 12176
3 Ga0123353_10478440 3300010167 Bacteria 1823
4 Ga0160442_100300 3300012806 Bacteria 27660
5 Ga0160448_100001 3300012854 Bacteria 878844
6 Ga0160457_1004456 3300012858 Bacteria 2241
7 Ga0466723_157554 3300042618 Bacteria 8809
8 Ga0466723_262363 3300042618 Bacteria 3053
9 Ga0466728_204775 3300042620 Bacteria 1000
10 Ga0466713_079439 3300042602 Bacteria 20377
11 Ga0466719_156423 3300042606 Bacteria 6411
12 Ga0466704_266161 3300042643 Bacteria 1419
13 Ga0466704_325446 3300042643 Bacteria 2264
14 AglaG_contig22684 2084038013 Bacteria 1549
15 Ga0562379_0068 3300056790 Unclassified 438584
16 Ga0562379_1758 3300056790 Unclassified 22193
17 Ga0562378_2242 3300056814 Bacteria 16862
18 Ga0562376_0551 3300056857 Bacteria 65914
19 Ga0562374_0278 3300057007 Bacteria 99329
20 Ga0123357_10006231 3300009784 Bacteria 14490
21 Ga0123356_10267255 3300010049 Bacteria 1798
22 Ga0160456_102227 3300012820 Bacteria 3770
23 Ga0160434_102253 3300012850 Bacteria 3366
24 Ga0160430_104045 3300012852 Bacteria 3790
25 Ga0415639_208391 3300038395 Bacteria 2148
26 Ga0466693_121857 3300042592 Bacteria 33009
27 Ga0466715_531886 3300042616 Bacteria 37554
28 Ga0466720_208637 3300042607 Bacteria 1676
29 Ga0466704_210731 3300042643 Bacteria 8276
30 Ga0466705_205467 3300042612 Bacteria 4365
31 Ga0562375_2757 3300056856 Unclassified 18631
32 Ga0562375_6174 3300056856 Bacteria 5584
33 Ga0562376_1976 3300056857 Unclassified 26569
34 Ga0562374_1671 3300057007 Unclassified 24638
35 Ga0160441_100253 3300012825 Unclassified 52094
36 Ga0160459_101987 3300012831 Bacteria 3662
37 Ga0160447_101630 3300012849 Bacteria 8551
38 Ga0466696_374158 3300042596 Bacteria 2013
39 Ga0466700_141056 3300042600 Bacteria 5366
40 Ga0466714_024759 3300042603 Bacteria 6403
41 Ga0123357_10000211 3300009784 Bacteria 54763
42 Ga0562379_0280 3300056790 Bacteria 130842
43 Ga0562378_0455 3300056814 Unclassified 70604
44 Ga0562376_0265 3300056857 Unclassified 105056
45 Ga0562374_0248 3300057007 Bacteria 108733
46 Ga0562374_0415 3300057007 Bacteria 75571
47 Ga0123355_10322777 3300009826 Unclassified 2078
48 Ga0123353_10003322 3300010167 Bacteria 20296
49 Ga0160454_100020 3300012798 Bacteria 314645
50 Ga0160444_103743 3300012841 Bacteria 2135
51 Ga0160430_100221 3300012852 Bacteria 41444
52 Ga0160448_108436 3300012854 Bacteria 2357
53 Ga0160457_1006126 3300012858 Bacteria 1797
54 Ga0160436_1006137 3300012861 Unclassified 2801
55 Ga0466691_056195 3300042593 Bacteria 4112
56 Ga0466718_036776 3300042617 Bacteria 5483
57 Ga0466713_143380 3300042602 Bacteria 10621
58 Ga0466717_171292 3300042604 Unclassified 1158
59 Ga0466717_216905 3300042604 Bacteria 1005
60 Ga0466697_019988 3300042611 Bacteria 20243
61 Ga0466730_058197 3300042625 Bacteria 1248
62 Ga0466703_026338 3300042636 Bacteria 53423
63 Ga0466727_269894 3300042655 Bacteria 1178
64 Ga0068305_10163251 3300005083 Bacteria 1845
65 Ga0072940_1158016 3300005200 Bacteria 1279
66 Ga0562377_1739 3300056842 Bacteria 20305
67 Ga0562376_0505 3300056857 Bacteria 69929
68 Ga0562374_0069 3300057007 Bacteria 334102
69 Ga0123357_10085188 3300009784 Bacteria 4138
70 Ga0123357_10105709 3300009784 Bacteria 3611
71 Ga0123356_10433156 3300010049 Bacteria 1460
72 Ga0123354_10009942 3300010882 Bacteria 14621
73 Ga0160469_101889 3300012824 Bacteria 4685
74 Ga0160435_1001688 3300012857 Bacteria 5535
75 Ga0160457_1007029 3300012858 Bacteria 1655
76 Ga0466657_161494 3300042582 Bacteria 3265
77 Ga0466693_213801 3300042592 Bacteria 4231
78 Ga0466691_135440 3300042593 Bacteria 6229
79 Ga0466696_049801 3300042596 Bacteria 5161
80 Ga0466705_488651 3300042612 Bacteria 2299
81 Ga0466723_209795 3300042618 Bacteria 2026
82 Ga0466713_110517 3300042602 Bacteria 51188
83 Ga0466713_152046 3300042602 Unclassified 2468
84 Ga0466704_005591 3300042643 Bacteria 4792
85 AustNasuHG_c1000396 3300000089 Bacteria 15166
86 Ga0068305_10163250 3300005083 Bacteria 912
87 Ga0123357_10001375 3300009784 Bacteria 25747
88 Ga0466733_204026 3300042659 Bacteria 3185
89 Ga0562375_3200 3300056856 Unclassified 16072
90 Ga0123356_10001060 3300010049 Bacteria 30467
91 Ga0123356_10016708 3300010049 Bacteria 6997
92 Ga0123353_10185898 3300010167 Unclassified 3286
93 Ga0123354_10067471 3300010882 Bacteria 5210
94 Ga0123354_10337948 3300010882 Bacteria 1362
95 Ga0160456_104607 3300012820 Bacteria 1783
96 Ga0160469_103928 3300012824 Bacteria 1869
97 Ga0160455_102185 3300012837 Bacteria 4382
98 Ga0160472_100002 3300012839 Bacteria 878838
99 Ga0160443_100119 3300012848 Bacteria 125007
100 Ga0160447_103341 3300012849 Bacteria 5171
101 Ga0160436_1000222 3300012861 Bacteria 27741
102 Ga0466657_172348 3300042582 Bacteria 10849
103 Ga0466696_336114 3300042596 Bacteria 2652
104 Ga0466728_262451 3300042620 Bacteria 2108
105 Ga0466706_155092 3300042599 Bacteria 2729
106 Ga0466713_030768 3300042602 Bacteria 254028
107 AustNasuHG_c1024302 3300000089 Bacteria 1921
108 JGI24705J35276_12227529 3300002504 Bacteria 3019
109 Ga0466705_139101 3300042612 Bacteria 7419
110 Ga0530661_001163 3300056564 Bacteria 14569
111 Ga0562377_0204 3300056842 Bacteria 154479
112 Ga0123357_10215508 3300009784 Bacteria 2144
113 Ga0123357_10331201 3300009784 Bacteria 1487
114 Ga0123354_10001795 3300010882 Bacteria 27049
115 Ga0123354_10221876 3300010882 Bacteria 2005
116 Ga0160453_103700 3300012814 Bacteria 3063
117 Ga0160440_100038 3300012815 Bacteria 193167
118 Ga0160441_100412 3300012825 Bacteria 35339
119 Ga0160452_100013 3300012834 Bacteria 343612
120 Ga0160452_106449 3300012834 Bacteria 1624
121 Ga0160434_101211 3300012850 Unclassified 5045
122 Ga0160435_1003264 3300012857 Unclassified 3854
123 Ga0160457_1000048 3300012858 Bacteria 195641
124 Ga0466723_010712 3300042618 Bacteria 5968
125 Ga0466707_295929 3300042601 Bacteria 1180
126 Ga0466707_366045 3300042601 Bacteria 3592
127 Ga0466713_058184 3300042602 Bacteria 2357
128 Ga0466713_061580 3300042602 Bacteria 1185
129 Ga0466716_543051 3300042605 Bacteria 8749
130 Ga0466724_10428 3300042649 Bacteria 343216
131 AustNasuHG_c1010800 3300000089 Bacteria 3173
132 Ga0072940_1032841 3300005200 Bacteria 1031
133 Ga0562379_0056 3300056790 Bacteria 479351
134 Ga0562378_0009 3300056814 Bacteria 1179729
135 Ga0123356_10897180 3300010049 Bacteria 1058
136 Ga0123354_10256127 3300010882 Bacteria 1760
137 Ga0160464_100094 3300012805 Bacteria 101996
138 Ga0160466_104653 3300012809 Bacteria 1945
139 Ga0160446_100041 3300012835 Bacteria 137551
140 Ga0466705_492506 3300042612 Bacteria 3662
141 Ga0466711_157875 3300042615 Bacteria 2768
142 Ga0466723_131311 3300042618 Bacteria 54026
143 Ga0466729_005104 3300042621 Bacteria 7657
144 Ga0466707_157302 3300042601 Bacteria 1145
145 Ga0466713_042107 3300042602 Bacteria 17325
146 Ga0466713_112973 3300042602 Bacteria 1417
147 Ga0466714_063291 3300042603 Bacteria 4762
148 Ga0466731_236044 3300042622 Bacteria 1156
149 Ga0466730_083135 3300042625 Bacteria 3390
150 Ga0466704_393730 3300042643 Bacteria 8542
151 Ga0466727_055996 3300042655 Bacteria 8529
152 Ga0123357_10000738 3300009784 Bacteria 32853

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_139101 Ga0466705_139101_6292_6969 207
2 3300042618 Ga0466723_131311 Ga0466723_131311_48382_49059 214
3 3300042606 Ga0466719_156423 Ga0466719_156423_2044_2721 215
4 3300042593 Ga0466691_056195 Ga0466691_056195_861_1514 217
5 3300042601 Ga0466707_295929 Ga0466707_295929_458_1111 217
6 3300042602 Ga0466713_042107 Ga0466713_042107_5752_6414 220
7 3300042602 Ga0466713_058184 Ga0466713_058184_659_1321 220
8 3300005083 Ga0068305_10163251 Ga0068305_101632512 221
9 iso_pr_bacteria 2820922474 2820923789 221
10 iso_pr_bacteria 2900368070 2900371765 221
11 3300010049 Ga0123356_10001060 Ga0123356_1000106016 222
12 3300010049 Ga0123356_10433156 Ga0123356_104331562 222
13 3300042592 Ga0466693_121857 Ga0466693_121857_1852_2520 222
14 3300042592 Ga0466693_213801 Ga0466693_213801_3424_4092 222
15 3300042600 Ga0466700_141056 Ga0466700_141056_983_1651 222
16 3300042618 Ga0466723_209795 Ga0466723_209795_332_1000 222
17 iso_pr_bacteria 2820914081 2820914784 222
18 3300009784 Ga0123357_10331201 Ga0123357_103312012 223
19 3300010049 Ga0123356_10006147 Ga0123356_100061472 223
20 3300010049 Ga0123356_10897180 Ga0123356_108971802 223
21 3300010882 Ga0123354_10001795 Ga0123354_100017952 223
22 3300010882 Ga0123354_10067471 Ga0123354_100674713 223
23 3300038395 Ga0415639_208391 Ga0415639_208391_1059_1730 223
24 3300042604 Ga0466717_171292 Ga0466717_171292_302_973 223
25 3300042612 Ga0466705_205467 Ga0466705_205467_3096_3767 223
26 3300042621 Ga0466729_005104 Ga0466729_005104_6750_7421 223
27 3300042625 Ga0466730_058197 Ga0466730_058197_493_1164 223
28 iso_pr_bacteria 2731957681 2732701065 223
29 iso_pr_bacteria 2820807258 2820807940 223
30 iso_pr_bacteria 2820825283 2820827095 223
31 3300009826 Ga0123355_10322777 Ga0123355_103227771 224
32 3300010049 Ga0123356_10016708 Ga0123356_100167084 224
33 3300010049 Ga0123356_10267255 Ga0123356_102672552 224
34 3300010882 Ga0123354_10009942 Ga0123354_100099426 224
35 3300012835 Ga0160446_100041 Ga0160446_10004177 224
36 3300042596 Ga0466696_374158 Ga0466696_374158_903_1577 224
37 3300042602 Ga0466713_112973 Ga0466713_112973_310_984 224
38 3300042620 Ga0466728_204775 Ga0466728_204775_100_774 224
39 3300042655 Ga0466727_269894 Ga0466727_269894_483_1157 224
40 iso_pr_bacteria 2820814774 2820816543 224
41 3300042593 Ga0466691_135440 Ga0466691_135440_2305_2982 225
42 3300042601 Ga0466707_366045 Ga0466707_366045_2137_2814 225
43 3300042616 Ga0466715_531886 Ga0466715_531886_4571_5248 225
44 3300042620 Ga0466728_262451 Ga0466728_262451_249_926 225
45 iso_pr_bacteria 2630969010 2634123561 225
46 3300009784 Ga0123357_10000211 Ga0123357_1000021132 226
47 3300009784 Ga0123357_10006231 Ga0123357_100062312 226
48 3300009784 Ga0123357_10085188 Ga0123357_100851882 226
49 3300010882 Ga0123354_10221876 Ga0123354_102218761 226
50 3300010882 Ga0123354_10337948 Ga0123354_103379482 226
51 3300042599 Ga0466706_155092 Ga0466706_155092_495_1175 226
52 3300042607 Ga0466720_208637 Ga0466720_208637_299_979 226
53 3300056842 Ga0562377_1739 Ga0562377_1739_5179_5937 226
54 iso_pr_bacteria 2820829137 2820829996 226
55 3300010167 Ga0123353_10478440 Ga0123353_104784402 227
56 3300010882 Ga0123354_10256127 Ga0123354_102561272 227
57 3300042602 Ga0466713_030768 Ga0466713_030768_114245_114928 227
58 3300042602 Ga0466713_061580 Ga0466713_061580_197_880 227
59 3300042602 Ga0466713_079439 Ga0466713_079439_18518_19201 227
60 3300042602 Ga0466713_152046 Ga0466713_152046_133_816 227
61 3300042604 Ga0466717_216905 Ga0466717_216905_183_866 227
62 3300042605 Ga0466716_543051 Ga0466716_543051_8018_8701 227
63 3300042615 Ga0466711_157875 Ga0466711_157875_1441_2124 227
64 3300042643 Ga0466704_325446 Ga0466704_325446_1444_2127 227
65 iso_pr_bacteria 2820809073 2820811114 227
66 iso_pr_bacteria 2820820509 2820821340 227
67 3300042622 Ga0466731_236044 Ga0466731_236044_259_945 228
68 iso_pr_bacteria 2772190761 2772883955 228
69 iso_pr_bacteria 2820818506 2820818734 228
70 iso_pr_bacteria 2856882415 2856883562 228
71 iso_pr_bacteria 2856954254 2856958498 228
72 iso_pr_bacteria 2856960404 2856961563 228
73 iso_pr_bacteria 2856973192 2856977806 228
74 iso_pr_bacteria 2859970369 2859972716 228
75 3300002504 JGI24705J35276_12227529 JGI24705J35276_122275292 229
76 3300005083 Ga0068305_10163250 Ga0068305_101632501 229
77 3300009784 Ga0123357_10000738 Ga0123357_100007384 229
78 3300010167 Ga0123353_10003322 Ga0123353_100033224 229
79 3300042582 Ga0466657_161494 Ga0466657_161494_1967_2656 229
80 3300042596 Ga0466696_336114 Ga0466696_336114_774_1463 229
81 3300042601 Ga0466707_157302 Ga0466707_157302_85_774 229
82 3300042602 Ga0466713_143380 Ga0466713_143380_3589_4278 229
83 3300042643 Ga0466704_005591 Ga0466704_005591_2430_3119 229
84 iso_pr_bacteria 2918394494 2918395910 229
85 iso_pr_bacteria 8030347546 8030350193 229
86 3300009784 Ga0123357_10001375 Ga0123357_100013757 230
87 3300042596 Ga0466696_049801 Ga0466696_049801_200_892 230
88 3300042602 Ga0466713_110517 Ga0466713_110517_34526_35218 230
89 3300042603 Ga0466714_024759 Ga0466714_024759_5116_5808 230
90 3300042603 Ga0466714_063291 Ga0466714_063291_3423_4115 230
91 iso_pr_bacteria 2597490239 2598798740 230
92 iso_pr_bacteria 2600255079 2600868662 230
93 iso_pr_bacteria 2645727657 2646404791 230
94 iso_pr_bacteria 2645727657 2646405857 230
95 iso_pr_bacteria 2788500098 2789513870 230
96 iso_pr_bacteria 2820897376 2820898968 230
97 iso_pr_bacteria 2824199081 2824199917 230
98 iso_pr_bacteria 2824199081 2824200225 230
99 iso_pr_bacteria 2865982043 2865983613 230
100 iso_pr_bacteria 2865983822 2865985334 230
101 3300042582 Ga0466657_172348 Ga0466657_172348_1609_2304 231
102 3300042617 Ga0466718_036776 Ga0466718_036776_2661_3356 231
103 3300042618 Ga0466723_010712 Ga0466723_010712_1211_1906 231
104 3300042655 Ga0466727_055996 Ga0466727_055996_3508_4203 231
105 iso_pr_bacteria 2820845766 2820848381 231
106 iso_pr_bacteria 2820894511 2820897304 231
107 3300009784 Ga0123357_10105709 Ga0123357_101057092 232
108 3300009784 Ga0123357_10215508 Ga0123357_102155082 232
109 3300010167 Ga0123353_10185898 Ga0123353_101858983 232
110 3300042643 Ga0466704_266161 Ga0466704_266161_271_969 232
111 iso_pr_bacteria 2619619082 2620609637 232
112 iso_pr_bacteria 2837204985 2837205352 232
113 iso_pr_bacteria 2873586004 2873586451 232
114 iso_pr_bacteria 648276708 648768095 232
115 iso_pr_bacteria 8102982778 8102985083 232
116 3300000089 AustNasuHG_c1024302 AustNasuHG_10243022 233
117 3300005200 Ga0072940_1158016 Ga0072940_11580161 233
118 3300012831 Ga0160459_101987 Ga0160459_1019873 233
119 3300012834 Ga0160452_100013 Ga0160452_100013166 233
120 3300012839 Ga0160472_100002 Ga0160472_100002641 233
121 3300012857 Ga0160435_1003264 Ga0160435_10032642 233
122 3300012858 Ga0160457_1004456 Ga0160457_10044562 233
123 3300012858 Ga0160457_1007029 Ga0160457_10070292 233
124 3300012861 Ga0160436_1000222 Ga0160436_100022217 233
125 3300042618 Ga0466723_262363 Ga0466723_262363_1281_1982 233
126 3300042612 Ga0466705_492506 Ga0466705_492506_2509_3213 234
127 iso_pr_bacteria 2504756063 2504977617 234
128 iso_pr_bacteria 2505679068 2505951891 234
129 iso_pr_bacteria 2847305884 2847307966 234
130 3300000089 AustNasuHG_c1010800 AustNasuHG_10108002 235
131 3300000089 AustNasuHG_c1000396 AustNasuHG_10003962 236
132 3300005200 Ga0072940_1032841 Ga0072940_10328412 236
133 3300012820 Ga0160456_102227 Ga0160456_1022272 236
134 3300012848 Ga0160443_100119 Ga0160443_10011978 236
135 3300056790 Ga0562379_0280 Ga0562379_0280_53017_53727 236
136 3300056790 Ga0562379_1758 Ga0562379_1758_4394_5104 236
137 3300056814 Ga0562378_0455 Ga0562378_0455_43155_43865 236
138 3300056856 Ga0562375_3200 Ga0562375_3200_13986_14696 236
139 3300056856 Ga0562375_6174 Ga0562375_6174_2608_3318 236
140 3300056857 Ga0562376_0265 Ga0562376_0265_14992_15702 236
141 3300056857 Ga0562376_0551 Ga0562376_0551_52763_53473 236
142 3300056857 Ga0562376_1976 Ga0562376_1976_5308_6018 236
143 3300057007 Ga0562374_0415 Ga0562374_0415_48041_48751 236
144 iso_pr_bacteria 2820857933 2820858536 236
145 iso_pr_bacteria 8069511479 8069513910 236
146 3300012806 Ga0160442_100300 Ga0160442_1003008 237
147 3300012849 Ga0160447_103341 Ga0160447_1033412 237
148 3300012861 Ga0160436_1006137 Ga0160436_10061373 237
149 3300056814 Ga0562378_0009 Ga0562378_0009_410738_411451 237
150 3300057007 Ga0562374_0248 Ga0562374_0248_102535_103248 237
151 3300042618 Ga0466723_157554 Ga0466723_157554_3076_3840 238
152 iso_pr_bacteria 2861945162 2861947554 238
153 3300012837 Ga0160455_102185 Ga0160455_1021852 239
154 3300042649 Ga0466724_10428 Ga0466724_10428_98148_98867 239
155 3300056790 Ga0562379_0056 Ga0562379_0056_245382_246101 239
156 3300056790 Ga0562379_0068 Ga0562379_0068_136684_137403 239
157 3300056856 Ga0562375_2757 Ga0562375_2757_14728_15447 239
158 iso_pr_bacteria 2816332114 2816396438 239
159 iso_pr_bacteria 2820944107 2820944555 239
160 iso_pr_bacteria 2873558832 2873559578 239
161 iso_pr_bacteria 2931430189 2931431916 239
162 3300012805 Ga0160464_100094 Ga0160464_10009425 240
163 3300012841 Ga0160444_103743 Ga0160444_1037432 240
164 3300012852 Ga0160430_100221 Ga0160430_10022112 240
165 3300012854 Ga0160448_100001 Ga0160448_100001226 240
166 3300012857 Ga0160435_1001688 Ga0160435_10016882 240
167 iso_pr_bacteria 2884613238 2884614353 240
168 iso_pr_bacteria 8067987626 8067991269 240
169 3300056842 Ga0562377_0204 Ga0562377_0204_67609_68382 241
170 3300012815 Ga0160440_100038 Ga0160440_10003855 242
171 3300012825 Ga0160441_100253 Ga0160441_10025341 242
172 3300012850 Ga0160434_102253 Ga0160434_1022533 242
173 3300056856 Ga0562375_0293 Ga0562375_0293_17160_17888 242
174 3300012825 Ga0160441_100412 Ga0160441_1004128 243
175 3300042611 Ga0466697_019988 Ga0466697_019988_2500_3231 243
176 3300012849 Ga0160447_101630 Ga0160447_1016307 244
177 3300012850 Ga0160434_101211 Ga0160434_1012112 244
178 iso_pr_bacteria 2918394494 2918394507 244
179 3300012820 Ga0160456_104607 Ga0160456_1046072 245
180 3300042625 Ga0466730_083135 Ga0466730_083135_294_1031 245
181 3300012814 Ga0160453_103700 Ga0160453_1037003 246
182 3300012834 Ga0160452_106449 Ga0160452_1064492 246
183 3300042612 Ga0466705_488651 Ga0466705_488651_1229_1969 246
184 iso_pr_bacteria 3002678670 3002680819 246
185 3300012798 Ga0160454_100020 Ga0160454_100020255 249
186 3300012809 Ga0160466_104653 Ga0160466_1046532 249
187 3300012824 Ga0160469_101889 Ga0160469_1018893 249
188 3300012858 Ga0160457_1000048 Ga0160457_1000048118 249
189 3300012854 Ga0160448_108436 Ga0160448_1084363 251
190 3300042643 Ga0466704_210731 Ga0466704_210731_4922_5677 251
191 3300042643 Ga0466704_393730 Ga0466704_393730_5412_6167 251
192 3300042636 Ga0466703_026338 Ga0466703_026338_37204_37989 252
193 3300012824 Ga0160469_103928 Ga0160469_1039282 254
194 3300056814 Ga0562378_2242 Ga0562378_2242_5270_6037 255
195 3300057007 Ga0562374_1671 Ga0562374_1671_21790_22557 255
196 3300012858 Ga0160457_1006126 Ga0160457_10061262 256
197 3300056564 Ga0530661_001163 Ga0530661_001163_1837_2607 256
198 iso_pr_bacteria 2883361506 2883364495 256
199 iso_pr_bacteria 2884351759 2884355270 256
200 2084038013 AglaG_contig22684 AglaG_06568620 260
201 3300057007 Ga0562374_0069 Ga0562374_0069_7973_8755 260
202 3300057007 Ga0562374_0278 Ga0562374_0278_67172_67954 260
203 3300012852 Ga0160430_104045 Ga0160430_1040453 261
204 3300042659 Ga0466733_204026 Ga0466733_204026_1620_2432 263
205 iso_pr_bacteria 2681812870 2682010390 276
206 3300056857 Ga0562376_0505 Ga0562376_0505_26730_27575 281

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00596 Aldolase_II Class II Aldolase and Adducin N-terminal domain 62 250 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.