Protein Family IF10594

Metagenome Isolate
234 Members
191 Samples
114 Scaffolds
360.78 Avg Length

🧬 Representative Sequence

ID
3300056856|Ga0562375_0164|Ga0562375_0164_169271_170437
Length
388 aa
Sequence
MTGSPMTESAAAPASRAADRTYRIAVIAGDGIGTEVMPEGLRSLRAAADRFGFRLEIEEFDWASAGYWQAHGAMLPDDWKDTLSGFDAIFFGAVGWPDVVPDHVSLWGSLLQFRRHFDQYVNLRPVKLLAGVPSPLAGRRPGDVDFFVVRENTEGEYSSVGGKMFEGTDRETVIQETVMTRTGVDRVLRYAFELADRRGGGPGSTGRPQRRHLTSATKSNGIAITMPYWDERVAAMAESYPEVEVDQFHIDILTANFVMHPDWFDVVVASNLFGDILSDLGPACTGTIGIAPSANINPEGAFPSLFEPVHGSAPDIAGRGIANPVGQIWSGALMLDHLGEAEAAAAVQAAFEAVLAGGDAEVLTPDMGGRGTTAALGAAVAEAIAGGR

📊 Sample Types

Isolate 51.3%
Metagenome 48.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 27.5%
Formicidae 14.8%
Unclassified 9.3%
Drosophilidae 7.7%
Termitidae 7.1%
Culicidae 5.5%
Armadillidiidae 4.9%
Kalotermitidae 4.4%
Tenebrionidae 3.3%
Curculionidae 3.3%
Calliphoridae 2.7%
Elmidae 2.2%
Rhinotermitidae 1.1%
Crambidae 1.1%
Cerambycidae 1.1%
Scarabaeidae 0.5%
Trigoniulidae 0.5%
Alydidae 0.5%
Apidae 0.5%
Berytidae 0.5%
Thripidae 0.5%
Pteromalidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 209
Eukaryota 0
Viruses 0
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
3 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
4 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
5 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
10 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
11 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
12 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
13 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
14 8067598439 Gluconobacter wancherniae Dm-17 Isolate Drosophilidae
15 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
16 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
17 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
18 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
19 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
20 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
21 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
22 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
23 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
24 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
25 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
28 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
29 2511231129 Vibrio sp. EJY3 Isolate Unclassified
30 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
31 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
32 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
33 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 648276708 Pantoea sp. aB Isolate Unclassified
40 649989992 Pseudonocardia sp. P1 Isolate Formicidae
41 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
42 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
43 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
44 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
45 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
46 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
47 8102102351 Caballeronia sp. INML1 Isolate Coreidae
48 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
49 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
50 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
51 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
52 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
53 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
54 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
57 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
58 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
59 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
60 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
61 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
62 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
63 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
64 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
66 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
67 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
68 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
69 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
70 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
71 2603880165 Burkholderiales A1 Isolate Unclassified
72 2603880172 Burkholderiales C Isolate Unclassified
73 2834038347 Gluconobacter sp. DsW_058 Isolate Drosophilidae
74 2836714267 Shimwellia blattae NCTC10965 Isolate
75 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
76 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
77 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 637000219 Pseudomonas entomophila L48 Isolate Unclassified
80 8067604290 Gluconobacter wancherniae Dm-19 Isolate Drosophilidae
81 8067607133 Gluconobacter wancherniae Dm-15 Isolate Drosophilidae
82 8071322446 Escherichia coli PN122 Isolate Calliphoridae
83 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
84 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
85 8102124461 Caballeronia sp. INML3B Isolate Coreidae
86 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
87 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
88 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
89 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
90 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
91 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
92 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
93 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
94 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
95 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
96 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
97 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
98 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
99 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
100 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
101 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
102 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
103 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
104 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
105 8071343737 Escherichia coli PN119 Isolate Calliphoridae
106 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
107 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
108 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
109 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
110 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
111 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
112 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
113 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
114 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
115 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
116 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
117 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
118 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
119 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
120 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
121 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
122 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
123 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
124 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
125 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
126 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
127 8071333649 Escherichia coli PN108 Isolate Calliphoridae
128 8071338694 Escherichia coli PN87 Isolate Calliphoridae
129 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
130 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
131 8102117041 Caballeronia sp. INML3 Isolate Coreidae
132 8102131453 Caballeronia sp. INML5 Isolate Coreidae
133 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
134 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
135 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
136 8102982778 Erwinia sp. S63 Isolate Curculionidae
137 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
138 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
139 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
140 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
141 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
142 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
143 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
144 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
145 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
146 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
147 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
148 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
149 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
150 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
151 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
152 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
153 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
154 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
155 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
156 8069748016 Caballeronia sp. LP003 Isolate Coreidae
157 8099192374 Erwinia typographi IC4 Isolate Curculionidae
158 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
159 8102109360 Caballeronia sp. INML2 Isolate Coreidae
160 8102145433 Caballeronia sp. LP006 Isolate Coreidae
161 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
162 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
163 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
164 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
165 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
166 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
167 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
168 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
169 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
170 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
171 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
172 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
173 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
174 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
175 8023757577 Caballeronia peredens LP006 Isolate Coreidae
176 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
177 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
178 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
179 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
180 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
181 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
182 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
183 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
184 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
185 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
186 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
187 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
188 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
189 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
190 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
191 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10358985 3300009826 Unclassified 1921
2 Ga0160466_103238 3300012809 Unclassified 2763
3 Ga0466722_088417 3300042609 Bacteria 3254
4 Ga0466709_177544 3300042648 Bacteria 6412
5 Ga0160432_100091 3300012818 Bacteria 90719
6 Ga0160459_100099 3300012831 Bacteria 86490
7 Ga0160444_102035 3300012841 Bacteria 3244
8 Ga0160443_101404 3300012848 Bacteria 8236
9 Ga0466701_015224 3300042598 Bacteria 55559
10 DPOL_contig15831 2035918003 Unclassified 4223
11 CVPL005W_1001408 3300002934 Bacteria 6396
12 CVPL005L_10001488 3300002938 Bacteria 27016
13 Ga0102737_1010955 3300007142 Bacteria 1515
14 Ga0466724_12222 3300042649 Bacteria 23620
15 Ga0160469_100065 3300012824 Bacteria 179297
16 Ga0160472_100163 3300012839 Bacteria 91922
17 Ga0160433_100349 3300012846 Bacteria 27261
18 Ga0160447_101292 3300012849 Unclassified 9875
19 DPOL_contig04748 2035918003 Bacteria 3938
20 CVPL010W_10000563 3300002931 Bacteria 46161
21 CVPL010W_10015848 3300002931 Unclassified 5198
22 CVPL005W_1000001 3300002934 Bacteria 147007
23 Ga0103260_1001768 3300007139 Unclassified 3800
24 Ga0562376_0562 3300056857 Bacteria 65365
25 Ga0160454_100411 3300012798 Bacteria 20837
26 Ga0466711_074124 3300042615 Bacteria 12614
27 Ga0466729_156504 3300042621 Bacteria 6004
28 Ga0466730_072298 3300042625 Bacteria 12550
29 Ga0466724_38821 3300042649 Unclassified 2256
30 Ga0160459_100379 3300012831 Unclassified 19017
31 Ga0160455_100019 3300012837 Bacteria 453457
32 Ga0160472_100141 3300012839 Bacteria 108090
33 Ga0160472_103617 3300012839 Bacteria 2986
34 DPOL_contig00844 2035918003 Bacteria 20285
35 Ga0103266_1000075 3300007067 Bacteria 36270
36 Ga0103266_1001062 3300007067 Bacteria 5337
37 Ga0102737_1012291 3300007142 Bacteria 1403
38 Ga0530661_000871 3300056564 Bacteria 18773
39 Ga0562374_0855 3300057007 Unclassified 42781
40 Ga0123356_10215190 3300010049 Bacteria 1974
41 Ga0466734_069082 3300042623 Bacteria 4864
42 Ga0466734_095707 3300042623 Bacteria 1439
43 Ga0466704_439988 3300042643 Unclassified 2818
44 Ga0466724_19399 3300042649 Bacteria 81793
45 Ga0160456_100139 3300012820 Unclassified 67071
46 Ga0160467_100950 3300012829 Unclassified 16581
47 Ga0160446_100043 3300012835 Bacteria 135017
48 Ga0466696_216263 3300042596 Bacteria 5070
49 Ga0562375_0611 3300056856 Bacteria 67999
50 Ga0562376_2631 3300056857 Bacteria 20795
51 Ga0466717_199318 3300042604 Bacteria 1291
52 Ga0466730_040865 3300042625 Bacteria 27737
53 Ga0466724_52085 3300042649 Bacteria 154897
54 Ga0160469_100086 3300012824 Bacteria 152231
55 Ga0160458_100627 3300012832 Bacteria 12431
56 Ga0160452_100026 3300012834 Bacteria 235637
57 Ga0160455_100066 3300012837 Bacteria 189860
58 Ga0160443_108446 3300012848 Bacteria 1235
59 Ga0160436_1004870 3300012861 Bacteria 3171
60 Ga0466701_005914 3300042598 Bacteria 55661
61 JGI24705J35276_12237133 3300002504 Bacteria 9932
62 CVPL010W_10016857 3300002931 Bacteria 5964
63 Ga0102739_1006991 3300007095 Bacteria 2831
64 Ga0562379_0119 3300056790 Bacteria 250541
65 Ga0562378_0066 3300056814 Unclassified 303224
66 Ga0160465_100490 3300012803 Bacteria 19013
67 Ga0466722_172087 3300042609 Bacteria 19231
68 Ga0466723_207182 3300042618 Bacteria 14429
69 Ga0466724_65308 3300042649 Bacteria 117345
70 Ga0160440_100101 3300012815 Bacteria 94359
71 Ga0160468_100594 3300012819 Bacteria 13518
72 Ga0160472_100105 3300012839 Bacteria 135252
73 Ga0160445_100101 3300012847 Unclassified 85437
74 Ga0160445_100218 3300012847 Unclassified 42339
75 Ga0160448_100796 3300012854 Bacteria 10629
76 FGTW_contig00404 2065487013 Unclassified 7075
77 Ga0063521_1000089 3300003973 Bacteria 74123
78 Ga0102736_1000349 3300007052 Bacteria 9784
79 Ga0103264_1000490 3300007188 Bacteria 39758
80 Ga0123357_10138879 3300009784 Bacteria 2995
81 Ga0160465_101566 3300012803 Unclassified 6390
82 Ga0466701_045275 3300042598 Bacteria 4351
83 Ga0466701_094372 3300042598 Bacteria 2534
84 Ga0466721_255138 3300042608 Bacteria 1537
85 Ga0466729_106852 3300042621 Bacteria 7536
86 Ga0466724_11717 3300042649 Bacteria 15309
87 Ga0466725_468907 3300042654 Bacteria 2994
88 Ga0160446_100868 3300012835 Unclassified 8421
89 Ga0160472_101103 3300012839 Unclassified 9131
90 Ga0160444_100098 3300012841 Unclassified 110248
91 Ga0160430_101806 3300012852 Bacteria 7468
92 Ga0466690_120650 3300042590 Unclassified 1499
93 CVPL010W_10010628 3300002931 Unclassified 7930
94 CVPL010L_1000040 3300002932 Bacteria 43162
95 Ga0103261_1006445 3300007083 Bacteria 1703
96 Ga0102739_1002069 3300007095 Bacteria 3167
97 Ga0104049_1025182 3300007103 Unclassified 1467
98 Ga0562375_0164 3300056856 Bacteria 195314
99 Ga0562376_0456 3300056857 Bacteria 75575
100 Ga0123356_10021731 3300010049 Bacteria 6057
101 Ga0160471_100620 3300012812 Bacteria 9106
102 Ga0466716_041914 3300042605 Bacteria 1944
103 Ga0466705_476479 3300042612 Bacteria 3288
104 Ga0466718_114185 3300042617 Bacteria 1790
105 Ga0466734_016069 3300042623 Bacteria 26526
106 Ga0466734_061715 3300042623 Bacteria 5422
107 Ga0160470_100644 3300012813 Unclassified 11777
108 Ga0160443_100528 3300012848 Unclassified 24722
109 Ga0160448_100031 3300012854 Bacteria 141009
110 Ga0466657_037189 3300042582 Bacteria 3436
111 Ga0466696_440195 3300042596 Bacteria 2017
112 CVPL010W_10006857 3300002931 Bacteria 11473
113 Ga0102740_1000665 3300007140 Bacteria 9309
114 Ga0103267_1023746 3300007190 Bacteria 2032

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012837 Ga0160455_100066 Ga0160455_100066169 301
2 3300042617 Ga0466718_114185 Ga0466718_114185_45_962 305
3 iso_pr_bacteria 8116947750 8116952075 323
4 3300010049 Ga0123356_10215190 Ga0123356_102151901 329
5 iso_pr_bacteria 649989992 650094909 333
6 3300042604 Ga0466717_199318 Ga0466717_199318_186_1262 339
7 3300007095 Ga0102739_1006991 Ga0102739_10069912 348
8 3300007067 Ga0103266_1000075 Ga0103266_10000758 350
9 3300042649 Ga0466724_12222 Ga0466724_12222_5148_6212 354
10 iso_pr_bacteria 2597489902 2597920157 354
11 iso_pr_bacteria 2850131454 2850135141 354
12 3300003973 Ga0063521_1000089 Ga0063521_100008942 355
13 3300012803 Ga0160465_100490 Ga0160465_1004904 355
14 3300012847 Ga0160445_100101 Ga0160445_10010117 355
15 3300012848 Ga0160443_100528 Ga0160443_10052817 355
16 3300042590 Ga0466690_120650 Ga0466690_120650_201_1268 355
17 3300042598 Ga0466701_094372 Ga0466701_094372_132_1199 355
18 3300042621 Ga0466729_156504 Ga0466729_156504_469_1536 355
19 3300042654 Ga0466725_468907 Ga0466725_468907_1869_2936 355
20 3300056564 Ga0530661_000871 Ga0530661_000871_966_2033 355
21 iso_pr_bacteria 2529292851 2530235787 355
22 iso_pr_bacteria 2597490292 2598959841 355
23 iso_pr_bacteria 2855798354 2855799355 355
24 iso_pr_bacteria 2858084324 2858085636 355
25 iso_pr_bacteria 2858089842 2858091995 355
26 iso_pr_bacteria 2896187957 2896190094 355
27 3300007188 Ga0103264_1000490 Ga0103264_100049031 356
28 3300009784 Ga0123357_10138879 Ga0123357_101388792 356
29 3300009826 Ga0123355_10358985 Ga0123355_103589852 356
30 3300010049 Ga0123356_10021731 Ga0123356_100217313 356
31 3300012848 Ga0160443_108446 Ga0160443_1084462 356
32 3300042596 Ga0466696_216263 Ga0466696_216263_2202_3272 356
33 3300042609 Ga0466722_172087 Ga0466722_172087_10148_11218 356
34 3300042612 Ga0466705_476479 Ga0466705_476479_646_1716 356
35 3300042618 Ga0466723_207182 Ga0466723_207182_571_1641 356
36 3300042643 Ga0466704_439988 Ga0466704_439988_1463_2533 356
37 3300042649 Ga0466724_11717 Ga0466724_11717_257_1327 356
38 3300042649 Ga0466724_38821 Ga0466724_38821_1037_2107 356
39 3300056857 Ga0562376_0562 Ga0562376_0562_33764_34834 356
40 iso_pr_bacteria 2603880165 2606013482 356
41 iso_pr_bacteria 2603880172 2606033850 356
42 iso_pr_bacteria 2619619082 2620611741 356
43 iso_pr_bacteria 2841260384 2841263230 356
44 iso_pr_bacteria 2871760914 2871764635 356
45 iso_pr_bacteria 648276708 648770576 356
46 iso_pr_bacteria 8101676404 8101678438 356
47 iso_pr_bacteria 8101680043 8101682164 356
48 iso_pr_bacteria 8101683685 8101683990 356
49 iso_pr_bacteria 8102982778 8102987597 356
50 3300002931 CVPL010W_10010628 CVPL010W_100106288 357
51 3300002931 CVPL010W_10016857 CVPL010W_100168573 357
52 3300007095 Ga0102739_1002069 Ga0102739_10020693 357
53 3300007139 Ga0103260_1001768 Ga0103260_10017683 357
54 3300007140 Ga0102740_1000665 Ga0102740_10006653 357
55 3300012854 Ga0160448_100031 Ga0160448_10003112 357
56 3300042615 Ga0466711_074124 Ga0466711_074124_1298_2371 357
57 3300042621 Ga0466729_106852 Ga0466729_106852_3064_4137 357
58 iso_pr_bacteria 2511231129 2511730877 357
59 iso_pr_bacteria 2547132042 2547178292 357
60 iso_pr_bacteria 2718217924 2719368593 357
61 iso_pr_bacteria 2834038347 2834040296 357
62 iso_pr_bacteria 2856882415 2856885421 357
63 iso_pr_bacteria 2856954254 2856956376 357
64 iso_pr_bacteria 2856960404 2856963404 357
65 iso_pr_bacteria 2856973192 2856975947 357
66 iso_pr_bacteria 2859970369 2859970689 357
67 iso_pr_bacteria 8024031916 8024032318 357
68 iso_pr_bacteria 8067598439 8067600896 357
69 iso_pr_bacteria 8067604290 8067606674 357
70 iso_pr_bacteria 8067607133 8067609652 357
71 iso_pr_bacteria 8116627632 8116631559 357
72 3300002504 JGI24705J35276_12237133 JGI24705J35276_122371333 358
73 3300012835 Ga0160446_100868 Ga0160446_1008685 358
74 3300012839 Ga0160472_100105 Ga0160472_10010518 358
75 3300012854 Ga0160448_100796 Ga0160448_10079611 358
76 3300042608 Ga0466721_255138 Ga0466721_255138_128_1204 358
77 iso_pr_bacteria 2671180625 2673532145 358
78 iso_pr_bacteria 2675903497 2678194694 358
79 iso_pr_bacteria 2681813507 2684382689 358
80 iso_pr_bacteria 2856671350 2856676836 358
81 iso_pr_bacteria 2856947901 2856951812 358
82 iso_pr_bacteria 2856966858 2856968253 358
83 iso_pr_bacteria 2859977607 2859978212 358
84 2035918003 DPOL_contig00844 DPOLB_1577450 359
85 3300007142 Ga0102737_1010955 Ga0102737_10109552 359
86 3300012841 Ga0160444_102035 Ga0160444_1020353 359
87 3300042625 Ga0466730_072298 Ga0466730_072298_959_2038 359
88 iso_pr_bacteria 2847708326 2847712720 359
89 iso_pr_bacteria 8001394582 8001397109 359
90 iso_pr_bacteria 8099192374 8099192713 359
91 2035918003 DPOL_contig04748 DPOLB_908700 360
92 3300012818 Ga0160432_100091 Ga0160432_10009175 360
93 3300012839 Ga0160472_100141 Ga0160472_10014172 360
94 3300012846 Ga0160433_100349 Ga0160433_1003495 360
95 3300012849 Ga0160447_101292 Ga0160447_1012921 360
96 3300012861 Ga0160436_1004870 Ga0160436_10048702 360
97 3300042623 Ga0466734_095707 Ga0466734_095707_36_1118 360
98 iso_pr_bacteria 2938192669 2938192766 360
99 2065487013 FGTW_contig00404 FGTW_03491060 361
100 3300002931 CVPL010W_10000563 CVPL010W_1000056325 361
101 3300002931 CVPL010W_10015848 CVPL010W_100158483 361
102 3300002934 CVPL005W_1000001 CVPL005W_1000001106 361
103 3300002934 CVPL005W_1001408 CVPL005W_10014085 361
104 3300007052 Ga0102736_1000349 Ga0102736_10003496 361
105 3300007083 Ga0103261_1006445 Ga0103261_10064453 361
106 3300007103 Ga0104049_1025182 Ga0104049_10251822 361
107 3300007190 Ga0103267_1023746 Ga0103267_10237462 361
108 3300012803 Ga0160465_101566 Ga0160465_1015666 361
109 3300012809 Ga0160466_103238 Ga0160466_1032383 361
110 3300042582 Ga0466657_037189 Ga0466657_037189_2004_3089 361
111 3300042598 Ga0466701_045275 Ga0466701_045275_1312_2397 361
112 3300042623 Ga0466734_069082 Ga0466734_069082_2607_3692 361
113 3300056857 Ga0562376_0456 Ga0562376_0456_7530_8615 361
114 iso_pr_bacteria 2778261152 2779038120 361
115 iso_pr_bacteria 2778261153 2779042191 361
116 iso_pr_bacteria 2816332114 2816399849 361
117 iso_pr_bacteria 2864751016 2864752931 361
118 iso_pr_bacteria 2864993140 2864997439 361
119 iso_pr_bacteria 2873468275 2873472575 361
120 iso_pr_bacteria 2990166910 2990170678 361
121 iso_pr_bacteria 8011357093 8011361408 361
122 iso_pr_bacteria 8028002147 8028003748 361
123 iso_pr_bacteria 8071322446 8071327345 361
124 iso_pr_bacteria 8071333649 8071338352 361
125 iso_pr_bacteria 8071338694 8071338746 361
126 iso_pr_bacteria 8071343737 8071345964 361
127 iso_pr_bacteria 8073124432 8073125793 361
128 3300002932 CVPL010L_1000040 CVPL010L_100004033 362
129 3300012812 Ga0160471_100620 Ga0160471_1006205 362
130 3300012813 Ga0160470_100644 Ga0160470_1006443 362
131 3300012815 Ga0160440_100101 Ga0160440_10010168 362
132 3300012831 Ga0160459_100099 Ga0160459_10009974 362
133 3300012839 Ga0160472_101103 Ga0160472_1011038 362
134 3300012839 Ga0160472_103617 Ga0160472_1036171 362
135 3300012852 Ga0160430_101806 Ga0160430_1018066 362
136 3300042605 Ga0466716_041914 Ga0466716_041914_505_1593 362
137 3300056857 Ga0562376_2631 Ga0562376_2631_4239_5327 362
138 3300057007 Ga0562374_0855 Ga0562374_0855_23907_24995 362
139 iso_pr_bacteria 2518645556 2518834310 362
140 iso_pr_bacteria 8012935351 8012937748 362
141 3300012819 Ga0160468_100594 Ga0160468_1005947 363
142 3300012820 Ga0160456_100139 Ga0160456_10013948 363
143 3300012824 Ga0160469_100065 Ga0160469_10006597 363
144 3300012837 Ga0160455_100019 Ga0160455_100019344 363
145 3300012841 Ga0160444_100098 Ga0160444_10009876 363
146 3300012847 Ga0160445_100218 Ga0160445_10021816 363
147 3300042598 Ga0466701_005914 Ga0466701_005914_30243_31334 363
148 3300042623 Ga0466734_016069 Ga0466734_016069_10575_11666 363
149 3300042649 Ga0466724_65308 Ga0466724_65308_17509_18600 363
150 3300056790 Ga0562379_0119 Ga0562379_0119_53189_54280 363
151 3300056814 Ga0562378_0066 Ga0562378_0066_245202_246293 363
152 iso_pr_bacteria 2724678956 2724791821 363
153 iso_pr_bacteria 2836714267 2836715735 363
154 iso_pr_bacteria 2864739902 2864743920 363
155 iso_pr_bacteria 3007478678 3007483472 363
156 iso_pr_bacteria 637000219 638001161 363
157 iso_pr_bacteria 8025650824 8025657847 363
158 iso_pr_bacteria 8025678175 8025681707 363
159 iso_pr_bacteria 8025694439 8025698322 363
160 iso_pr_bacteria 8102208438 8102215461 363
161 iso_pr_bacteria 8102216467 8102220350 363
162 iso_pr_bacteria 8102239244 8102242774 363
163 3300012798 Ga0160454_100411 Ga0160454_10041113 364
164 3300012834 Ga0160452_100026 Ga0160452_10002619 364
165 3300012848 Ga0160443_101404 Ga0160443_1014047 364
166 iso_pr_bacteria 2518285616 2518641884 364
167 3300002938 CVPL005L_10001488 CVPL005L_1000148818 365
168 3300007142 Ga0102737_1012291 Ga0102737_10122911 365
169 3300012832 Ga0160458_100627 Ga0160458_10062711 366
170 3300042649 Ga0466724_19399 Ga0466724_19399_77632_78732 366
171 3300042649 Ga0466724_52085 Ga0466724_52085_45963_47063 366
172 3300012839 Ga0160472_100163 Ga0160472_10016344 367
173 3300042648 Ga0466709_177544 Ga0466709_177544_385_1488 367
174 iso_pr_bacteria 8023724303 8023724619 367
175 iso_pr_bacteria 8023757577 8023757893 367
176 iso_pr_bacteria 8023764196 8023772419 367
177 iso_pr_bacteria 8024001094 8024006487 367
178 iso_pr_bacteria 8024037630 8024042216 367
179 iso_pr_bacteria 8025716094 8025719406 367
180 iso_pr_bacteria 8025740903 8025744164 367
181 iso_pr_bacteria 8025747911 8025751183 367
182 iso_pr_bacteria 8025756023 8025759295 367
183 iso_pr_bacteria 8069748016 8069751669 367
184 iso_pr_bacteria 8069755105 8069758377 367
185 iso_pr_bacteria 8069763219 8069766480 367
186 iso_pr_bacteria 8101951471 8101957067 367
187 iso_pr_bacteria 8101960468 8101966058 367
188 iso_pr_bacteria 8101967387 8101972976 367
189 iso_pr_bacteria 8101974301 8101979900 367
190 iso_pr_bacteria 8101981714 8101987096 367
191 iso_pr_bacteria 8101988189 8101993860 367
192 iso_pr_bacteria 8101994502 8102000096 367
193 iso_pr_bacteria 8102001125 8102006689 367
194 iso_pr_bacteria 8102007614 8102013506 367
195 iso_pr_bacteria 8102014801 8102020645 367
196 iso_pr_bacteria 8102026984 8102032684 367
197 iso_pr_bacteria 8102033761 8102039560 367
198 iso_pr_bacteria 8102041249 8102046793 367
199 iso_pr_bacteria 8102047609 8102053388 367
200 iso_pr_bacteria 8102060671 8102066828 367
201 iso_pr_bacteria 8102067727 8102073233 367
202 iso_pr_bacteria 8102074813 8102080651 367
203 iso_pr_bacteria 8102087471 8102093711 367
204 iso_pr_bacteria 8102102351 8102108339 367
205 iso_pr_bacteria 8102109360 8102115155 367
206 iso_pr_bacteria 8102117041 8102122775 367
207 iso_pr_bacteria 8102124461 8102130183 367
208 iso_pr_bacteria 8102131453 8102135730 367
209 iso_pr_bacteria 8102138357 8102143825 367
210 iso_pr_bacteria 8102145433 8102145749 367
211 iso_pr_bacteria 8102152052 8102160275 367
212 iso_pr_bacteria 8102161003 8102161281 367
213 iso_pr_bacteria 8102186987 8102190297 367
214 iso_pr_bacteria 8102264549 8102270074 367
215 iso_pr_bacteria 8102271933 8102277465 367
216 iso_pr_bacteria 8102279326 8102284929 367
217 iso_pr_bacteria 8102286609 8102292513 367
218 iso_pr_bacteria 8102312426 8102317925 367
219 2035918003 DPOL_contig15831 DPOLB_1898660 368
220 3300012824 Ga0160469_100086 Ga0160469_10008654 368
221 3300012831 Ga0160459_100379 Ga0160459_10037913 368
222 iso_pr_bacteria 2519899622 2520389113 368
223 3300007067 Ga0103266_1001062 Ga0103266_10010625 369
224 3300012835 Ga0160446_100043 Ga0160446_10004352 369
225 3300042625 Ga0466730_040865 Ga0466730_040865_9193_10305 370
226 3300042598 Ga0466701_015224 Ga0466701_015224_44894_46009 371
227 3300042623 Ga0466734_061715 Ga0466734_061715_1368_2489 373
228 iso_pr_bacteria 8021535516 8021539879 373
229 3300056856 Ga0562375_0611 Ga0562375_0611_40479_41609 376
230 3300002931 CVPL010W_10006857 CVPL010W_100068572 378
231 3300012829 Ga0160467_100950 Ga0160467_10095014 380
232 3300042609 Ga0466722_088417 Ga0466722_088417_386_1531 381
233 3300042596 Ga0466696_440195 Ga0466696_440195_596_1744 382
234 3300056856 Ga0562375_0164 Ga0562375_0164_169271_170437 388

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 24 378 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.