Protein Family IF10551

Metagenome Isolate
244 Members
185 Samples
118 Scaffolds
242.42 Avg Length

🧬 Representative Sequence

ID
3300056842|Ga0562377_0078|Ga0562377_0078_8207_9022
Length
271 aa
Sequence
VEIFSKYYKYDIIFKKCGGNFVAGHSKWANIKHRKGRQDAQRAKIFTRIGKELTIAAKLGGGDTGFNPRLRLAVDKAKAANMPKDNMERAIKKGTGELEGVDYQEIRYEGYGPGGVAFLVDVVTDNKNRSASTVRMNFSRNDGNLGETGSVSFLFNRKGIFEFKKEGITEDMLMETALDAGAEDVVEKSESWLVITEPNDFDAVKEVFDTNNLKYEEGEITMHPATEIEITDEETAKKLMKLYDDLEENEDVQEIYSNFDISDEIMAKLED

📊 Sample Types

Isolate 51.6%
Metagenome 48.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 44.2%
Unclassified 11.6%
Formicidae 9.9%
Termitidae 7.7%
Kalotermitidae 6.1%
Elmidae 3.3%
Culicidae 2.2%
Armadillidiidae 2.2%
Curculionidae 1.7%
Largidae 1.1%
Berytidae 1.1%
Nephropidae 1.1%
Hydrophilidae 1.1%
Ixodidae 1.1%
Drosophilidae 1.1%
Alydidae 1.1%
Passalidae 1.1%
Calliphoridae 0.6%
Hodotermitidae 0.6%
Crambidae 0.6%
Tenebrionidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 230
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
3 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
4 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
5 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
6 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
14 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
15 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
16 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
17 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
18 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
19 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
20 8100455565 Delftia sp. S67 Isolate Curculionidae
21 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
22 8102102351 Caballeronia sp. INML1 Isolate Coreidae
23 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
24 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
25 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
26 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
27 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
28 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
29 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
30 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
34 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
35 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
36 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
37 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
38 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
39 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
40 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
41 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
42 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
43 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
44 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
45 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
46 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
47 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
48 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
49 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
50 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
51 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
52 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
53 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
57 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
58 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
59 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
60 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
61 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
62 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
63 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
64 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
65 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
66 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
67 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
68 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
69 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
70 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
71 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
72 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
73 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
74 2603880165 Burkholderiales A1 Isolate Unclassified
75 2603880170 Burkholderiales A2 Isolate Unclassified
76 2603880172 Burkholderiales C Isolate Unclassified
77 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
78 2802429587 Spiroplasma eriocheiris CCTCC 'M 207170' Isolate Unclassified
79 2558860181 Spiroplasma mirum ATCC 29335 Isolate Ixodidae
80 2558860251 Spiroplasma mirum SMCA Isolate Ixodidae
81 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
82 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
83 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
84 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
85 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
86 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
87 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
88 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
89 8102124461 Caballeronia sp. INML3B Isolate Coreidae
90 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
91 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
92 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
93 2864937364 Acidovorax soli S00198 Isolate Elmidae
94 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
95 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
96 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
97 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
98 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
99 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
100 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
101 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
102 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
103 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
104 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
105 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
106 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
107 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
108 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
109 8102117041 Caballeronia sp. INML3 Isolate Coreidae
110 8102131453 Caballeronia sp. INML5 Isolate Coreidae
111 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
112 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
113 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
114 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
115 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
116 2841330038 Sulfitobacter sp. D7 Isolate
117 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
118 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
119 2718218026 Phaeobacter porticola P97 Isolate Unclassified
120 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
121 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
122 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
123 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
124 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
125 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
126 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
127 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
128 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
129 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
130 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
131 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
132 8100449422 Delftia sp. S66 Isolate Curculionidae
133 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
134 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
135 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
136 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
137 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
138 2868169047 Comamonas aquatica S00077 Isolate Elmidae
139 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
140 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
141 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
142 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
143 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
144 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
145 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
146 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
147 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
148 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
149 8023757577 Caballeronia peredens LP006 Isolate Coreidae
150 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
151 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
152 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
153 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
154 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
155 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
156 8100461708 Delftia sp. S65 Isolate Curculionidae
157 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
158 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
159 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
160 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
161 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
162 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
163 2832201259 Rickettsiella grylli TrM1 Isolate Unclassified
164 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
165 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
166 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
167 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
168 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
169 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
170 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
171 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
172 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
173 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
174 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
175 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
176 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
177 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
178 8069748016 Caballeronia sp. LP003 Isolate Coreidae
179 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
180 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
181 8102109360 Caballeronia sp. INML2 Isolate Coreidae
182 8102145433 Caballeronia sp. LP006 Isolate Coreidae
183 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
184 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
185 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0102738_1000179 3300007141 Bacteria 14742
2 Ga0103264_1000467 3300007188 Bacteria 42232
3 Ga0103267_1000719 3300007190 Bacteria 22558
4 Ga0103268_1000373 3300007192 Bacteria 14211
5 Ga0466734_065066 3300042623 Bacteria 5791
6 Ga0466734_163010 3300042623 Bacteria 2989
7 Ga0466730_052567 3300042625 Bacteria 9022
8 Ga0466730_067983 3300042625 Bacteria 4731
9 Ga0466703_101688 3300042636 Bacteria 41897
10 Ga0466724_14509 3300042649 Bacteria 10744
11 Ga0466725_063726 3300042654 Bacteria 2466
12 Ga0466693_085023 3300042592 Bacteria 1806
13 Ga0466696_138365 3300042596 Bacteria 6651
14 Ga0466701_029299 3300042598 Bacteria 5010
15 Ga0466705_256586 3300042612 Bacteria 9209
16 Ga0466733_182039 3300042659 Bacteria 10236
17 CVPL010W_10033814 3300002931 Bacteria 1845
18 Ga0102737_1000153 3300007142 Bacteria 22554
19 Ga0123357_10000047 3300009784 Bacteria 99859
20 Ga0466711_339210 3300042615 Bacteria 1281
21 Ga0466728_015710 3300042620 Bacteria 22492
22 Ga0466725_375654 3300042654 Bacteria 10809
23 Ga0123353_10003549 3300010167 Bacteria 19751
24 Ga0123353_10048719 3300010167 Bacteria 6748
25 Ga0466701_026306 3300042598 Unclassified 1731
26 Ga0562377_0078 3300056842 Bacteria 380003
27 CVPL005W_1000124 3300002934 Bacteria 32767
28 CVPL005L_10001011 3300002938 Bacteria 31524
29 Ga0103263_101474 3300007042 Unclassified 3044
30 Ga0102736_1001803 3300007052 Bacteria 6201
31 Ga0102740_1000929 3300007140 Bacteria 8210
32 Ga0103264_1000148 3300007188 Bacteria 54758
33 Ga0103264_1006549 3300007188 Bacteria 7709
34 Ga0105005_1105635 3300007505 Bacteria 2590
35 Ga0466715_092219 3300042616 Bacteria 17508
36 Ga0466730_046718 3300042625 Bacteria 68019
37 Ga0466730_097282 3300042625 Bacteria 177552
38 Ga0466703_090547 3300042636 Bacteria 47834
39 Ga0466704_369941 3300042643 Bacteria 2093
40 Ga0123356_10622157 3300010049 Bacteria 1245
41 Ga0160472_101439 3300012839 Unclassified 6997
42 Ga0160472_106227 3300012839 Unclassified 1800
43 Ga0160448_111486 3300012854 Bacteria 1803
44 Ga0160457_1000028 3300012858 Bacteria 284184
45 Ga0466701_037076 3300042598 Bacteria 58845
46 Ga0466701_099665 3300042598 Bacteria 2650
47 CVPL005L_10000024 3300002938 Bacteria 117333
48 Ga0103261_1003283 3300007083 Unclassified 3807
49 Ga0103261_1005002 3300007083 Bacteria 1972
50 Ga0102734_1000668 3300007129 Bacteria 9490
51 Ga0103260_1001904 3300007139 Bacteria 3622
52 Ga0104048_1169924 3300007143 Bacteria 1818
53 Ga0103268_1001083 3300007192 Bacteria 7196
54 Ga0466703_225365 3300042636 Bacteria 4076
55 Ga0123353_10003017 3300010167 Bacteria 21064
56 Ga0160468_102224 3300012819 Bacteria 3552
57 Ga0160447_113544 3300012849 Bacteria 1599
58 Ga0466696_278148 3300042596 Unclassified 1218
59 Ga0466706_020002 3300042599 Bacteria 1602
60 Ga0466707_065918 3300042601 Bacteria 1579
61 2227476832 2225789004 Unclassified 879
62 CVPL010W_10005960 3300002931 Bacteria 12756
63 Ga0102736_1000999 3300007052 Bacteria 13339
64 Ga0103264_1000206 3300007188 Bacteria 33853
65 Ga0103264_1000240 3300007188 Bacteria 40495
66 Ga0466705_497846 3300042612 Bacteria 10930
67 Ga0466711_494637 3300042615 Bacteria 3244
68 Ga0466715_076381 3300042616 Bacteria 36547
69 Ga0466703_071861 3300042636 Bacteria 17885
70 Ga0466709_024540 3300042648 Bacteria 5558
71 Ga0466724_52883 3300042649 Bacteria 459297
72 Ga0123353_10000321 3300010167 Bacteria 59258
73 Ga0160464_100002 3300012805 Bacteria 416329
74 Ga0160464_100182 3300012805 Bacteria 64573
75 Ga0160444_100110 3300012841 Bacteria 96308
76 Ga0466716_506237 3300042605 Bacteria 10992
77 Ga0466733_163823 3300042659 Bacteria 1745
78 CVPL010W_10006354 3300002931 Bacteria 21839
79 Ga0103266_1000110 3300007067 Bacteria 28918
80 Ga0103261_1010467 3300007083 Unclassified 1296
81 Ga0102739_1005775 3300007095 Bacteria 1681
82 Ga0102737_1000367 3300007142 Bacteria 15226
83 Ga0103264_1000004 3300007188 Bacteria 153563
84 Ga0466723_157817 3300042618 Bacteria 5999
85 Ga0466725_431499 3300042654 Bacteria 1547
86 Ga0123356_10445434 3300010049 Bacteria 1442
87 Ga0160471_106597 3300012812 Unclassified 1445
88 Ga0160430_107181 3300012852 Bacteria 2271
89 Ga0415639_147602 3300038395 Bacteria 3503
90 Ga0466657_269597 3300042582 Bacteria 13405
91 Ga0466701_079388 3300042598 Bacteria 130298
92 Ga0466716_083991 3300042605 Bacteria 7024
93 CVPL010W_10004026 3300002931 Bacteria 35308
94 CVPL010W_10016857 3300002931 Bacteria 5964
95 Ga0103266_1000251 3300007067 Bacteria 18949
96 Ga0102737_1000194 3300007142 Unclassified 20732
97 Ga0105005_1010989 3300007505 Unclassified 2601
98 Ga0160468_100034 3300012819 Bacteria 232419
99 Ga0160467_100035 3300012829 Bacteria 221416
100 Ga0160430_104189 3300012852 Bacteria 3675
101 IMNBL1DRAFT_c0012344 3300000062 Bacteria 3913
102 Ga0103265_1003730 3300007068 Bacteria 2222
103 Ga0102739_1003337 3300007095 Unclassified 2367
104 Ga0105005_1109943 3300007505 Unclassified 2586
105 Ga0466711_402580 3300042615 Bacteria 1737
106 Ga0466718_017004 3300042617 Bacteria 2571
107 Ga0466734_044547 3300042623 Bacteria 23470
108 Ga0466703_311596 3300042636 Bacteria 21197
109 Ga0466704_533642 3300042643 Bacteria 39754
110 Ga0466724_46819 3300042649 Bacteria 306737
111 Ga0466725_054435 3300042654 Bacteria 2049
112 Ga0160452_100076 3300012834 Bacteria 131624
113 Ga0160472_100119 3300012839 Bacteria 124226
114 Ga0160447_100179 3300012849 Bacteria 39549
115 Ga0160447_102060 3300012849 Bacteria 7326
116 Ga0415639_206063 3300038395 Bacteria 1407
117 Ga0466701_004830 3300042598 Unclassified 5379
118 Ga0466719_147235 3300042606 Bacteria 2494

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012841 Ga0160444_100110 Ga0160444_10011031 221
2 3300007143 Ga0104048_1169924 Ga0104048_11699242 222
3 3300038395 Ga0415639_206063 Ga0415639_206063_563_1276 222
4 3300042601 Ga0466707_065918 Ga0466707_065918_162_899 222
5 3300009784 Ga0123357_10000047 Ga0123357_1000004727 223
6 3300042598 Ga0466701_026306 Ga0466701_026306_830_1549 223
7 3300042625 Ga0466730_067983 Ga0466730_067983_2985_3704 223
8 3300012812 Ga0160471_106597 Ga0160471_1065972 224
9 3300012849 Ga0160447_102060 Ga0160447_1020605 224
10 3300042606 Ga0466719_147235 Ga0466719_147235_261_983 224
11 3300007505 Ga0105005_1010989 Ga0105005_10109892 225
12 3300007505 Ga0105005_1105635 Ga0105005_11056352 225
13 3300007505 Ga0105005_1109943 Ga0105005_11099432 225
14 3300012849 Ga0160447_113544 Ga0160447_1135442 227
15 3300042582 Ga0466657_269597 Ga0466657_269597_1583_2311 227
16 3300042649 Ga0466724_14509 Ga0466724_14509_1694_2413 227
17 3300012852 Ga0160430_104189 Ga0160430_1041894 229
18 3300042623 Ga0466734_065066 Ga0466734_065066_2143_2868 229
19 3300042623 Ga0466734_163010 Ga0466734_163010_63_788 229
20 3300042654 Ga0466725_054435 Ga0466725_054435_180_905 229
21 3300012805 Ga0160464_100002 Ga0160464_100002306 231
22 3300042654 Ga0466725_375654 Ga0466725_375654_3315_4040 231
23 3300002931 CVPL010W_10004026 CVPL010W_1000402612 234
24 3300042616 Ga0466715_092219 Ga0466715_092219_794_1522 234
25 3300012839 Ga0160472_106227 Ga0160472_1062271 235
26 3300012852 Ga0160430_107181 Ga0160430_1071812 235
27 3300042596 Ga0466696_138365 Ga0466696_138365_4456_5163 235
28 3300002938 CVPL005L_10001011 CVPL005L_100010115 236
29 3300007083 Ga0103261_1003283 Ga0103261_10032834 237
30 3300007192 Ga0103268_1001083 Ga0103268_10010838 237
31 3300042615 Ga0466711_402580 Ga0466711_402580_128_874 237
32 3300010049 Ga0123356_10622157 Ga0123356_106221571 238
33 iso_pr_bacteria 2832201259 2832201677 238
34 3300042592 Ga0466693_085023 Ga0466693_085023_977_1696 239
35 3300042598 Ga0466701_004830 Ga0466701_004830_1271_1990 239
36 3300042598 Ga0466701_029299 Ga0466701_029299_900_1619 239
37 3300042598 Ga0466701_037076 Ga0466701_037076_48872_49591 239
38 3300042625 Ga0466730_046718 Ga0466730_046718_20839_21558 239
39 3300042625 Ga0466730_097282 Ga0466730_097282_96064_96783 239
40 3300042636 Ga0466703_225365 Ga0466703_225365_1418_2170 239
41 3300042636 Ga0466703_311596 Ga0466703_311596_10109_10855 239
42 3300042649 Ga0466724_46819 Ga0466724_46819_226872_227591 239
43 3300042649 Ga0466724_52883 Ga0466724_52883_218079_218798 239
44 iso_pr_bacteria 2864870719 2864874305 239
45 iso_pr_bacteria 2864937364 2864938353 239
46 iso_pr_bacteria 2864960361 2864963956 239
47 iso_pr_bacteria 2868169047 2868169859 239
48 iso_pr_bacteria 2873565274 2873566859 239
49 iso_pr_bacteria 2873571580 2873576134 239
50 iso_pr_bacteria 8100449422 8100451028 239
51 iso_pr_bacteria 8100455565 8100458617 239
52 iso_pr_bacteria 8100461708 8100462777 239
53 3300002931 CVPL010W_10005960 CVPL010W_100059609 240
54 3300007042 Ga0103263_101474 Ga0103263_1014742 240
55 3300007067 Ga0103266_1000110 Ga0103266_100011026 240
56 3300007095 Ga0102739_1003337 Ga0102739_10033373 240
57 3300007190 Ga0103267_1000719 Ga0103267_10007192 240
58 3300007192 Ga0103268_1000373 Ga0103268_100037310 240
59 3300042612 Ga0466705_497846 Ga0466705_497846_6212_6961 240
60 iso_pr_bacteria 2834230000 2834230906 241
61 iso_pr_bacteria 2864755708 2864757430 241
62 iso_pr_bacteria 2864968865 2864971063 241
63 iso_pr_bacteria 8024031916 8024032663 241
64 3300007188 Ga0103264_1000467 Ga0103264_100046720 242
65 3300012839 Ga0160472_100119 Ga0160472_100119120 242
66 3300042598 Ga0466701_079388 Ga0466701_079388_93773_94501 242
67 3300042625 Ga0466730_052567 Ga0466730_052567_1190_1918 242
68 3300042643 Ga0466704_533642 Ga0466704_533642_4105_4833 242
69 3300042659 Ga0466733_163823 Ga0466733_163823_911_1639 242
70 iso_pr_bacteria 2597489944 2598057041 242
71 iso_pr_bacteria 2802429587 2805847960 242
72 iso_pr_bacteria 2820071837 2820072417 242
73 iso_pr_bacteria 2963630348 2963633220 242
74 iso_pr_bacteria 3003869270 3003871629 242
75 iso_pr_bacteria 3003878002 3003880448 242
76 iso_pr_bacteria 8023724303 8023729041 242
77 iso_pr_bacteria 8023747282 8023752155 242
78 iso_pr_bacteria 8023752828 8023755576 242
79 iso_pr_bacteria 8023757577 8023762315 242
80 iso_pr_bacteria 8023764196 8023768461 242
81 iso_pr_bacteria 8024001094 8024002039 242
82 iso_pr_bacteria 8024014383 8024015238 242
83 iso_pr_bacteria 8024019580 8024021521 242
84 iso_pr_bacteria 8024025509 8024027412 242
85 iso_pr_bacteria 8024037630 8024038491 242
86 iso_pr_bacteria 8024044713 8024045597 242
87 iso_pr_bacteria 8025650824 8025651689 242
88 iso_pr_bacteria 8025658853 8025660058 242
89 iso_pr_bacteria 8025666332 8025667213 242
90 iso_pr_bacteria 8025671076 8025671971 242
91 iso_pr_bacteria 8025678175 8025679060 242
92 iso_pr_bacteria 8025685901 8025687202 242
93 iso_pr_bacteria 8025694439 8025695392 242
94 iso_pr_bacteria 8025701579 8025705044 242
95 iso_pr_bacteria 8025708040 8025708969 242
96 iso_pr_bacteria 8025716094 8025717267 242
97 iso_pr_bacteria 8025723035 8025723884 242
98 iso_pr_bacteria 8025728939 8025729851 242
99 iso_pr_bacteria 8025735396 8025738045 242
100 iso_pr_bacteria 8025740903 8025741760 242
101 iso_pr_bacteria 8025747911 8025748871 242
102 iso_pr_bacteria 8025756023 8025756983 242
103 iso_pr_bacteria 8069748016 8069750998 242
104 iso_pr_bacteria 8069755105 8069756065 242
105 iso_pr_bacteria 8069763219 8069764076 242
106 iso_pr_bacteria 8069770227 8069775100 242
107 iso_pr_bacteria 8069775773 8069778521 242
108 iso_pr_bacteria 8078130113 8078130967 242
109 iso_pr_bacteria 8101951471 8101952363 242
110 iso_pr_bacteria 8101960468 8101961362 242
111 iso_pr_bacteria 8101967387 8101968280 242
112 iso_pr_bacteria 8101974301 8101975200 242
113 iso_pr_bacteria 8101981714 8101982668 242
114 iso_pr_bacteria 8101988189 8101989225 242
115 iso_pr_bacteria 8101994502 8101995671 242
116 iso_pr_bacteria 8102001125 8102001938 242
117 iso_pr_bacteria 8102007614 8102008508 242
118 iso_pr_bacteria 8102014801 8102015711 242
119 iso_pr_bacteria 8102020860 8102022114 242
120 iso_pr_bacteria 8102026984 8102027985 242
121 iso_pr_bacteria 8102033761 8102034896 242
122 iso_pr_bacteria 8102041249 8102042141 242
123 iso_pr_bacteria 8102047609 8102048649 242
124 iso_pr_bacteria 8102054868 8102055793 242
125 iso_pr_bacteria 8102060671 8102061798 242
126 iso_pr_bacteria 8102067727 8102068703 242
127 iso_pr_bacteria 8102074813 8102075863 242
128 iso_pr_bacteria 8102081745 8102082802 242
129 iso_pr_bacteria 8102087471 8102088433 242
130 iso_pr_bacteria 8102094248 8102095466 242
131 iso_pr_bacteria 8102102351 8102103239 242
132 iso_pr_bacteria 8102109360 8102110263 242
133 iso_pr_bacteria 8102117041 8102117895 242
134 iso_pr_bacteria 8102124461 8102125518 242
135 iso_pr_bacteria 8102131453 8102131787 242
136 iso_pr_bacteria 8102138357 8102139201 242
137 iso_pr_bacteria 8102145433 8102150171 242
138 iso_pr_bacteria 8102152052 8102156317 242
139 iso_pr_bacteria 8102161003 8102165773 242
140 iso_pr_bacteria 8102169119 8102171768 242
141 iso_pr_bacteria 8102174626 8102175538 242
142 iso_pr_bacteria 8102181083 8102181932 242
143 iso_pr_bacteria 8102186987 8102188161 242
144 iso_pr_bacteria 8102193924 8102194852 242
145 iso_pr_bacteria 8102201977 8102205442 242
146 iso_pr_bacteria 8102208438 8102209303 242
147 iso_pr_bacteria 8102216467 8102217420 242
148 iso_pr_bacteria 8102223607 8102224502 242
149 iso_pr_bacteria 8102230706 8102232007 242
150 iso_pr_bacteria 8102239244 8102240128 242
151 iso_pr_bacteria 8102246966 8102247847 242
152 iso_pr_bacteria 8102251710 8102252915 242
153 iso_pr_bacteria 8102264549 8102265551 242
154 iso_pr_bacteria 8102271933 8102273013 242
155 iso_pr_bacteria 8102279326 8102280202 242
156 iso_pr_bacteria 8102286609 8102287724 242
157 iso_pr_bacteria 8102312426 8102313020 242
158 2225789004 2227476832 2227929808 243
159 3300002934 CVPL005W_1000124 CVPL005W_100012430 243
160 3300007141 Ga0102738_1000179 Ga0102738_10001794 243
161 3300007188 Ga0103264_1000148 Ga0103264_100014840 243
162 3300012834 Ga0160452_100076 Ga0160452_100076126 243
163 3300012849 Ga0160447_100179 Ga0160447_10017928 243
164 3300042598 Ga0466701_099665 Ga0466701_099665_328_1059 243
165 3300042616 Ga0466715_076381 Ga0466715_076381_31525_32256 243
166 iso_pr_bacteria 2518285616 2518643256 243
167 iso_pr_bacteria 2603880165 2606013481 243
168 iso_pr_bacteria 2848339753 2848339952 243
169 iso_pr_bacteria 2855798354 2855799357 243
170 3300000062 IMNBL1DRAFT_c0012344 IMNBL1DRAFT_00123443 244
171 3300002931 CVPL010W_10016857 CVPL010W_100168574 244
172 3300042605 Ga0466716_083991 Ga0466716_083991_4449_5183 244
173 3300042648 Ga0466709_024540 Ga0466709_024540_4168_4902 244
174 3300042654 Ga0466725_431499 Ga0466725_431499_457_1191 244
175 iso_pr_bacteria 2558860181 2559092676 244
176 iso_pr_bacteria 2558860251 2559327605 244
177 3300042620 Ga0466728_015710 Ga0466728_015710_2980_3717 245
178 3300042636 Ga0466703_090547 Ga0466703_090547_42846_43583 245
179 iso_pr_bacteria 2775506951 2776479208 245
180 3300007052 Ga0102736_1000999 Ga0102736_100099910 246
181 3300007067 Ga0103266_1000251 Ga0103266_100025116 246
182 3300007068 Ga0103265_1003730 Ga0103265_10037302 246
183 3300007095 Ga0102739_1005775 Ga0102739_10057752 246
184 3300007188 Ga0103264_1006549 Ga0103264_10065493 246
185 iso_pr_bacteria 2603880170 2606027993 246
186 iso_pr_bacteria 2687453742 2689988781 246
187 iso_pr_bacteria 2687453753 2690037414 246
188 iso_pr_bacteria 2711768164 2712502730 246
189 iso_pr_bacteria 2718218026 2719801714 246
190 iso_pr_bacteria 2806310572 2806768263 246
191 iso_pr_bacteria 2816332503 2818123554 246
192 iso_pr_bacteria 2816332545 2818336822 246
193 iso_pr_bacteria 2839785767 2839786304 246
194 iso_pr_bacteria 2841330038 2841332593 246
195 3300002931 CVPL010W_10006354 CVPL010W_1000635425 247
196 3300002931 CVPL010W_10033814 CVPL010W_100338142 247
197 3300002938 CVPL005L_10000024 CVPL005L_100000244 247
198 3300007052 Ga0102736_1001803 Ga0102736_10018036 247
199 3300007083 Ga0103261_1005002 Ga0103261_10050023 247
200 3300007142 Ga0102737_1000153 Ga0102737_10001532 247
201 3300007142 Ga0102737_1000367 Ga0102737_100036717 247
202 3300007188 Ga0103264_1000206 Ga0103264_100020618 247
203 3300007188 Ga0103264_1000240 Ga0103264_100024021 247
204 3300042623 Ga0466734_044547 Ga0466734_044547_18383_19126 247
205 iso_pr_bacteria 2603880172 2606034335 247
206 iso_pr_bacteria 2619619079 2620606264 247
207 iso_pr_bacteria 2820457604 2820458826 247
208 3300007188 Ga0103264_1000004 Ga0103264_1000004118 248
209 3300010049 Ga0123356_10445434 Ga0123356_104454343 248
210 3300010167 Ga0123353_10048719 Ga0123353_100487193 248
211 3300042618 Ga0466723_157817 Ga0466723_157817_4570_5316 248
212 3300042654 Ga0466725_063726 Ga0466725_063726_1669_2415 248
213 iso_pr_bacteria 2852431164 2852435746 248
214 3300007129 Ga0102734_1000668 Ga0102734_10006687 249
215 3300038395 Ga0415639_147602 Ga0415639_147602_2414_3163 249
216 iso_pr_bacteria 2820183396 2820184269 249
217 iso_pr_bacteria 2835143510 2835145081 249
218 3300007083 Ga0103261_1010467 Ga0103261_10104672 250
219 3300007139 Ga0103260_1001904 Ga0103260_10019042 250
220 3300007140 Ga0102740_1000929 Ga0102740_10009296 250
221 3300007142 Ga0102737_1000194 Ga0102737_10001941 250
222 3300010167 Ga0123353_10000321 Ga0123353_1000032118 250
223 3300010167 Ga0123353_10003549 Ga0123353_100035494 250
224 3300042596 Ga0466696_278148 Ga0466696_278148_410_1162 250
225 3300042612 Ga0466705_256586 Ga0466705_256586_179_931 250
226 3300042615 Ga0466711_339210 Ga0466711_339210_137_889 250
227 3300042615 Ga0466711_494637 Ga0466711_494637_432_1184 250
228 3300042636 Ga0466703_071861 Ga0466703_071861_9910_10662 250
229 3300042636 Ga0466703_101688 Ga0466703_101688_4460_5212 250
230 3300042643 Ga0466704_369941 Ga0466704_369941_372_1124 250
231 iso_pr_bacteria 646311952 646430576 250
232 3300012858 Ga0160457_1000028 Ga0160457_100002826 251
233 3300042659 Ga0466733_182039 Ga0466733_182039_4076_4843 255
234 3300042605 Ga0466716_506237 Ga0466716_506237_3129_3902 257
235 3300042617 Ga0466718_017004 Ga0466718_017004_1688_2476 262
236 3300012805 Ga0160464_100182 Ga0160464_10018222 264
237 3300012819 Ga0160468_100034 Ga0160468_10003448 264
238 3300012819 Ga0160468_102224 Ga0160468_1022242 264
239 3300012829 Ga0160467_100035 Ga0160467_100035114 264
240 3300012839 Ga0160472_101439 Ga0160472_1014398 264
241 3300012854 Ga0160448_111486 Ga0160448_1114862 264
242 3300042599 Ga0466706_020002 Ga0466706_020002_309_1109 266
243 3300010167 Ga0123353_10003017 Ga0123353_100030175 269
244 3300056842 Ga0562377_0078 Ga0562377_0078_8207_9022 271

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20772 TACO1_YebC_N TACO1/YebC protein N-terminal domain 26 97 0.98
PF01709 Transcrip_reg TACO1/YebC second and third domain 103 259 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.