Protein Family IF10545

Metagenome Isolate
183 Members
116 Samples
127 Scaffolds
340.11 Avg Length

🧬 Representative Sequence

ID
3300056842|Ga0562377_0063|Ga0562377_0063_162046_163233
Length
395 aa
Sequence
MSIFQLSLSILFSLLLFIKVFLLILYLNLQKDVIIYEKSLTMISVICYNILKIRSDRMTIDWANLGFDYIKTPFRYLSIWKDGQWDQGKLTEDNTLHINEGSAALHYGQQCFEGLKAYRCKDGSINLFRVDQNAKRMNRSAKQLLMPEVPEEKFIQAVEEVVRANSEFVPPYGSGATLYIRPLLIGIGEGIGVQPAPEYLFTVFCMPVGAYFKGGLTPTNFVVSEYDRAAPQGTGAIKVGGNYAASLYPGKLAKERHFSDCIYLDPATHTKIEEVGSANFFGITKDNRFVTPLSPSILPSITKYSLLYLAEHHLGMEAVEEDVYLDSLDKFTEAGACGTAAVISPIGGIQVGDDFHVFYSETEVGPVTQKLYDTLTKIQLGDIEAPAGWIRNIKN

📊 Sample Types

Isolate 30.6%
Metagenome 69.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.5%
Unclassified 17.6%
Kalotermitidae 10.8%
Tenebrionidae 7.8%
Drosophilidae 5.9%
Scarabaeidae 4.9%
Curculionidae 2.9%
Elmidae 2.9%
Rhinotermitidae 2.9%
Termopsidae 2.9%
Apidae 2.0%
Blattidae 2.0%
Stratiomyidae 1.0%
Gomphidae 1.0%
Libellulidae 1.0%
Hydrophilidae 1.0%
Cerambycidae 1.0%
Vespidae 1.0%
Sarcophagidae 1.0%
Bombycidae 1.0%
Hodotermitidae 1.0%
Formicidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
2 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
7 8007223943 Enterococcus sp. MSG2901 Isolate
8 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
9 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
15 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
16 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
17 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
18 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
19 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
20 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
21 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
22 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
23 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 8114555646 Enterococcus sp. DIV1094 Isolate
31 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
32 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
33 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
37 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
38 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
39 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
40 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
41 2590828840 Clostridium sp. 2 Isolate Termitidae
42 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
43 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
44 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
45 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
51 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
52 8007237282 Enterococcus sp. DIV0212c Isolate
53 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
54 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
57 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
58 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
59 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
60 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
61 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
62 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
63 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
64 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
65 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
66 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
67 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
68 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
69 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
70 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
71 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
72 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
73 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
74 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
75 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
76 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
77 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
78 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
79 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
80 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
81 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
82 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
83 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
84 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
85 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
86 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
87 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
88 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
89 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
90 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
91 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
92 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
93 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
94 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
95 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
96 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
97 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
98 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
99 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
100 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
101 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
102 2593339124 Clostridium sp. 4 Isolate Termitidae
103 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
104 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
105 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
106 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
107 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
108 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
109 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 8108568626 Enterococcus sp. DIV1094 Isolate
112 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
113 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
114 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
115 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
116 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0014 3300056790 Bacteria 1325122
2 Ga0562375_0201 3300056856 Bacteria 169177
3 Ga0562375_1619 3300056856 Unclassified 29325
4 Ga0466701_059773 3300042598 Bacteria 11360
5 Ga0466719_400369 3300042606 Bacteria 5602
6 Ga0466720_035894 3300042607 Bacteria 4232
7 Ga0466712_115267 3300042614 Bacteria 1636
8 Ga0466715_091994 3300042616 Bacteria 112451
9 Ga0466718_092441 3300042617 Bacteria 32224
10 Ga0466702_084727 3300042635 Bacteria 31799
11 Ga0466702_191984 3300042635 Bacteria 1730
12 Ga0466703_221241 3300042636 Bacteria 10286
13 Ga0123357_10335615 3300009784 Bacteria 1470
14 Ga0123356_10005132 3300010049 Bacteria 13414
15 SPBB_contig10488 2044078006 Bacteria 139292
16 JGI24700J35501_10930903 3300002508 Bacteria 38981
17 Ga0068302_10009967 3300005071 Unclassified 8369
18 Ga0562374_0659 3300057007 Bacteria 52209
19 Ga0562374_0931 3300057007 Bacteria 40155
20 Ga0466701_079511 3300042598 Bacteria 6378
21 Ga0466706_028935 3300042599 Bacteria 40791
22 Ga0466705_502533 3300042612 Bacteria 8242
23 Ga0466710_226644 3300042613 Bacteria 1574
24 Ga0466715_258463 3300042616 Bacteria 28150
25 Ga0466703_168718 3300042636 Bacteria 3445
26 Ga0466704_320623 3300042643 Bacteria 11414
27 Ga0466727_228045 3300042655 Bacteria 5387
28 Ga0123357_10254659 3300009784 Unclassified 1870
29 Ga0466692_179022 3300042591 Bacteria 7995
30 Ga0072941_1002486 3300005201 Bacteria 46319
31 Ga0072941_1086793 3300005201 Bacteria 6529
32 Ga0123357_10001038 3300009784 Bacteria 28515
33 Ga0466705_286694 3300042612 Bacteria 89956
34 Ga0562377_0063 3300056842 Bacteria 461046
35 Ga0562377_0373 3300056842 Unclassified 83266
36 Ga0562375_0301 3300056856 Bacteria 123351
37 Ga0562375_1311 3300056856 Unclassified 34879
38 Ga0562374_0006 3300057007 Bacteria 2178283
39 Ga0466700_478677 3300042600 Bacteria 44650
40 Ga0466711_182931 3300042615 Bacteria 5894
41 Ga0466726_030368 3300042619 Bacteria 4685
42 Ga0466703_018268 3300042636 Bacteria 2276
43 Ga0466704_028038 3300042643 Bacteria 8092
44 Ga0123355_10222578 3300009826 Bacteria 2711
45 Ga0123356_10216277 3300010049 Bacteria 1969
46 Ga0264413_114889 3300024493 Bacteria 19681
47 JGI24698J34947_10030178 3300002449 Bacteria 2861
48 Ga0068302_10015776 3300005071 Bacteria 1705
49 Ga0104050_1000274 3300007153 Bacteria 1952
50 Ga0466697_168128 3300042611 Bacteria 8488
51 Ga0466733_105728 3300042659 Bacteria 55485
52 Ga0562379_1431 3300056790 Bacteria 27299
53 Ga0562378_0004 3300056814 Bacteria 2423881
54 Ga0466700_346138 3300042600 Bacteria 85747
55 Ga0466707_330441 3300042601 Bacteria 6048
56 Ga0466713_140716 3300042602 Bacteria 27446
57 Ga0466702_144352 3300042635 Bacteria 3965
58 Ga0466702_152782 3300042635 Bacteria 1434
59 Ga0466724_20253 3300042649 Bacteria 42482
60 Ga0123353_10604262 3300010167 Bacteria 1567
61 AglaG_contig17681 2084038013 Bacteria 12660
62 JGI24698J34947_10063810 3300002449 Bacteria 1804
63 JGI24695J34938_10015462 3300002450 Bacteria 3917
64 Ga0072941_1027298 3300005201 Bacteria 45039
65 Ga0072941_1217220 3300005201 Bacteria 2067
66 Ga0466732_290410 3300042656 Bacteria 4801
67 Ga0562378_0003 3300056814 Bacteria 2474150
68 Ga0562378_0668 3300056814 Bacteria 51149
69 Ga0562376_2172 3300056857 Bacteria 24553
70 Ga0466705_461507 3300042612 Bacteria 4974
71 Ga0466718_047926 3300042617 Bacteria 5313
72 Ga0466726_344696 3300042619 Bacteria 87368
73 Ga0466709_084188 3300042648 Bacteria 5019
74 Ga0466708_021463 3300042652 Bacteria 4913
75 Ga0123356_10061062 3300010049 Bacteria 3519
76 Ga0264413_127036 3300024493 Unclassified 10580
77 Nasutiter_Contig02421 2030936001 Bacteria 4179
78 HBC_ctgsDRAFT_1000070 3300000333 Bacteria 26032
79 JGI24695J34938_10013556 3300002450 Bacteria 4274
80 Ga0072940_1092147 3300005200 Bacteria 3413
81 Ga0072940_1234061 3300005200 Bacteria 2840
82 Ga0105553_1036539 3300007767 Bacteria 7245
83 Ga0562374_0145 3300057007 Bacteria 168686
84 Ga0466706_233747 3300042599 Bacteria 2960
85 Ga0466713_060305 3300042602 Bacteria 8341
86 Ga0466713_129121 3300042602 Bacteria 7495
87 Ga0466722_252821 3300042609 Bacteria 235840
88 Ga0466715_489311 3300042616 Bacteria 15153
89 Ga0466724_08980 3300042649 Bacteria 3298
90 Ga0123357_10208851 3300009784 Bacteria 2200
91 Ga0123354_10240901 3300010882 Unclassified 1861
92 Ga0466691_090807 3300042593 Bacteria 6537
93 Ga0466699_014657 3300042597 Bacteria 5098
94 Ga0466701_004898 3300042598 Bacteria 2228
95 DPO_contig06910 2032320009 Bacteria 17392
96 DPO_contig06911 2032320009 Unclassified 13465
97 Ga0466732_392954 3300042656 Bacteria 18734
98 Ga0562379_5374 3300056790 Unclassified 4348
99 Ga0562375_0013 3300056856 Bacteria 1229523
100 Ga0562374_0008 3300057007 Bacteria 1999653
101 Ga0466701_026062 3300042598 Bacteria 3161
102 Ga0466722_182659 3300042609 Bacteria 26051
103 Ga0466722_242098 3300042609 Bacteria 2409
104 Ga0466715_206410 3300042616 Bacteria 29967
105 Ga0466723_136025 3300042618 Bacteria 5131
106 Ga0123354_10145699 3300010882 Bacteria 2900
107 Ga0123354_10170795 3300010882 Bacteria 2532
108 Ga0466657_277839 3300042582 Bacteria 5111
109 Ga0466690_059913 3300042590 Bacteria 43148
110 AustNasuHG_c1003562 3300000089 Bacteria 5626
111 JGI24702J35022_10123144 3300002462 Bacteria 1434
112 JGI24700J35501_10860748 3300002508 Bacteria 2099
113 Ga0072941_1017195 3300005201 Unclassified 7106
114 Ga0530661_003342 3300056564 Bacteria 5299
115 Ga0562379_0051 3300056790 Bacteria 505432
116 Ga0562374_2397 3300057007 Bacteria 16551
117 Ga0466701_045352 3300042598 Bacteria 6411
118 Ga0466706_025624 3300042599 Bacteria 47672
119 Ga0466720_061685 3300042607 Bacteria 25501
120 Ga0466724_30737 3300042649 Bacteria 3730
121 Ga0123357_10104810 3300009784 Bacteria 3629
122 Ga0123356_10663510 3300010049 Bacteria 1210
123 Ga0123354_10172394 3300010882 Bacteria 2511
124 Ga0466691_037573 3300042593 Bacteria 71526
125 Ga0466691_214266 3300042593 Bacteria 3621
126 Ga0072941_1156619 3300005201 Bacteria 3069
127 Ga0074263_101426 3300005485 Bacteria 5070

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_014657 Ga0466699_014657_4197_5069 290
2 3300042598 Ga0466701_079511 Ga0466701_079511_3311_4186 291
3 3300000333 HBC_ctgsDRAFT_1000070 HBC_ctgsDRAFT_100007011 318
4 3300010049 Ga0123356_10216277 Ga0123356_102162772 323
5 3300042635 Ga0466702_144352 Ga0466702_144352_658_1632 324
6 3300042656 Ga0466732_392954 Ga0466732_392954_3143_4120 325
7 3300042609 Ga0466722_242098 Ga0466722_242098_355_1380 330
8 3300056790 Ga0562379_0051 Ga0562379_0051_455761_456771 330
9 3300056814 Ga0562378_0668 Ga0562378_0668_39515_40525 330
10 3300010882 Ga0123354_10240901 Ga0123354_102409013 335
11 iso_pr_bacteria 8007211731 8007213230 335
12 iso_pr_bacteria 8007215774 8007219361 335
13 iso_pr_bacteria 8007220153 8007222186 335
14 iso_pr_bacteria 8114544644 8114545421 336
15 3300042593 Ga0466691_037573 Ga0466691_037573_56337_57350 337
16 3300056564 Ga0530661_003342 Ga0530661_003342_2636_3649 337
17 3300056790 Ga0562379_0014 Ga0562379_0014_780116_781129 337
18 3300056856 Ga0562375_1619 Ga0562375_1619_22393_23406 337
19 3300057007 Ga0562374_0145 Ga0562374_0145_36721_37734 337
20 iso_pr_bacteria 2881375749 2881376502 337
21 iso_pr_bacteria 8002299145 8002304110 337
22 iso_pr_bacteria 8007223943 8007224374 337
23 iso_pr_bacteria 8018750880 8018751926 337
24 iso_pr_bacteria 8018754795 8018756444 337
25 iso_pr_bacteria 8038268975 8038270875 337
26 iso_pr_bacteria 8108568626 8108571195 337
27 iso_pr_bacteria 8114555646 8114558215 337
28 3300002450 JGI24695J34938_10013556 JGI24695J34938_100135563 338
29 3300002450 JGI24695J34938_10015462 JGI24695J34938_100154622 338
30 3300007767 Ga0105553_1036539 Ga0105553_103653911 338
31 3300042591 Ga0466692_179022 Ga0466692_179022_4614_5630 338
32 3300042593 Ga0466691_090807 Ga0466691_090807_2323_3339 338
33 3300042593 Ga0466691_214266 Ga0466691_214266_350_1366 338
34 3300042602 Ga0466713_140716 Ga0466713_140716_3024_4040 338
35 3300042606 Ga0466719_400369 Ga0466719_400369_1405_2421 338
36 3300042609 Ga0466722_182659 Ga0466722_182659_13816_14832 338
37 3300042612 Ga0466705_461507 Ga0466705_461507_2392_3408 338
38 3300042612 Ga0466705_502533 Ga0466705_502533_1624_2640 338
39 3300042615 Ga0466711_182931 Ga0466711_182931_1159_2175 338
40 3300042616 Ga0466715_258463 Ga0466715_258463_14979_15995 338
41 3300042616 Ga0466715_489311 Ga0466715_489311_13586_14602 338
42 3300042618 Ga0466723_136025 Ga0466723_136025_1653_2669 338
43 3300042619 Ga0466726_030368 Ga0466726_030368_388_1404 338
44 3300042636 Ga0466703_168718 Ga0466703_168718_197_1213 338
45 3300042636 Ga0466703_221241 Ga0466703_221241_3779_4795 338
46 3300042643 Ga0466704_028038 Ga0466704_028038_5694_6710 338
47 3300042648 Ga0466709_084188 Ga0466709_084188_3357_4373 338
48 3300042652 Ga0466708_021463 Ga0466708_021463_3190_4206 338
49 3300042655 Ga0466727_228045 Ga0466727_228045_15_1031 338
50 3300056814 Ga0562378_0004 Ga0562378_0004_454612_455628 338
51 3300056856 Ga0562375_0013 Ga0562375_0013_455611_456627 338
52 3300056856 Ga0562375_1311 Ga0562375_1311_13271_14287 338
53 3300056857 Ga0562376_2172 Ga0562376_2172_5549_6565 338
54 iso_pr_bacteria 2940218408 2940218408 338
55 iso_pr_bacteria 2940261461 2940261462 338
56 iso_pr_bacteria 8007237282 8007240560 338
57 iso_pr_bacteria 8012939035 8012939386 338
58 iso_pr_bacteria 8018798118 8018800160 338
59 iso_pr_bacteria 8018802046 8018804965 338
60 iso_pr_bacteria 8108576847 8108577192 338
61 iso_pr_bacteria 8114537524 8114538179 338
62 iso_pr_bacteria 8114541043 8114541618 338
63 iso_pr_bacteria 8114549044 8114549389 338
64 2032320009 DPO_contig06910 DPOB_307050 339
65 2032320009 DPO_contig06911 DPOB_308280 339
66 2044078006 SPBB_contig10488 SPBB_1105340 339
67 3300002462 JGI24702J35022_10123144 JGI24702J35022_101231441 339
68 3300005071 Ga0068302_10015776 Ga0068302_100157762 339
69 3300005201 Ga0072941_1027298 Ga0072941_102729822 339
70 3300042582 Ga0466657_277839 Ga0466657_277839_511_1530 339
71 3300042598 Ga0466701_026062 Ga0466701_026062_14_1033 339
72 3300042598 Ga0466701_045352 Ga0466701_045352_880_1899 339
73 3300042598 Ga0466701_059773 Ga0466701_059773_5704_6723 339
74 3300042602 Ga0466713_060305 Ga0466713_060305_5881_6900 339
75 3300042609 Ga0466722_252821 Ga0466722_252821_229139_230158 339
76 3300042649 Ga0466724_30737 Ga0466724_30737_2589_3608 339
77 3300042656 Ga0466732_290410 Ga0466732_290410_689_1708 339
78 3300042659 Ga0466733_105728 Ga0466733_105728_42256_43275 339
79 3300056790 Ga0562379_1431 Ga0562379_1431_22530_23549 339
80 3300056856 Ga0562375_0201 Ga0562375_0201_85663_86682 339
81 iso_pr_bacteria 2517487021 2517563478 339
82 iso_pr_bacteria 2740892547 2743914750 339
83 iso_pr_bacteria 2775507073 2777017062 339
84 iso_pr_bacteria 2820783511 2820784657 339
85 iso_pr_bacteria 2820792843 2820794916 339
86 iso_pr_bacteria 2820795054 2820795828 339
87 iso_pr_bacteria 2825804107 2825806336 339
88 iso_pr_bacteria 2834951433 2834952445 339
89 iso_pr_bacteria 2864745180 2864748869 339
90 iso_pr_bacteria 2864853652 2864858586 339
91 iso_pr_bacteria 2864926767 2864933521 339
92 iso_pr_bacteria 2873581347 2873583491 339
93 iso_pr_bacteria 2990166910 2990171212 339
94 iso_pr_bacteria 647533136 647747784 339
95 iso_pr_bacteria 8018794549 8018796880 339
96 iso_pr_bacteria 8077780672 8077782253 339
97 iso_pr_bacteria 8100157865 8100159140 339
98 3300005200 Ga0072940_1234061 Ga0072940_12340613 340
99 3300009784 Ga0123357_10001038 Ga0123357_100010382 340
100 3300009784 Ga0123357_10104810 Ga0123357_101048103 340
101 3300009784 Ga0123357_10208851 Ga0123357_102088511 340
102 3300009784 Ga0123357_10254659 Ga0123357_102546592 340
103 3300010049 Ga0123356_10005132 Ga0123356_100051322 340
104 3300010049 Ga0123356_10061062 Ga0123356_100610624 340
105 3300010049 Ga0123356_10663510 Ga0123356_106635101 340
106 3300010882 Ga0123354_10145699 Ga0123354_101456992 340
107 3300010882 Ga0123354_10170795 Ga0123354_101707952 340
108 3300042598 Ga0466701_004898 Ga0466701_004898_885_1907 340
109 3300042599 Ga0466706_028935 Ga0466706_028935_14343_15365 340
110 3300042600 Ga0466700_478677 Ga0466700_478677_43465_44487 340
111 3300042607 Ga0466720_035894 Ga0466720_035894_52_1074 340
112 3300042607 Ga0466720_061685 Ga0466720_061685_19401_20423 340
113 3300042616 Ga0466715_206410 Ga0466715_206410_24747_25769 340
114 3300042635 Ga0466702_084727 Ga0466702_084727_6026_7048 340
115 3300042635 Ga0466702_152782 Ga0466702_152782_72_1094 340
116 3300042635 Ga0466702_191984 Ga0466702_191984_598_1620 340
117 3300056790 Ga0562379_5374 Ga0562379_5374_1336_2358 340
118 3300056842 Ga0562377_0373 Ga0562377_0373_64646_65668 340
119 3300057007 Ga0562374_0008 Ga0562374_0008_1655149_1656171 340
120 iso_pr_bacteria 2622736579 2623393554 340
121 iso_pr_bacteria 2791354930 2792023425 340
122 iso_pr_bacteria 2820411483 2820412443 340
123 2030936001 Nasutiter_Contig02421 Nasutiterm_820490 341
124 3300000089 AustNasuHG_c1003562 AustNasuHG_10035623 341
125 3300005201 Ga0072941_1002486 Ga0072941_10024862 341
126 3300005201 Ga0072941_1156619 Ga0072941_11566191 341
127 3300005201 Ga0072941_1217220 Ga0072941_12172202 341
128 3300005485 Ga0074263_101426 Ga0074263_1014263 341
129 3300009784 Ga0123357_10335615 Ga0123357_103356152 341
130 3300010882 Ga0123354_10172394 Ga0123354_101723941 341
131 3300024493 Ga0264413_114889 Ga0264413_11488915 341
132 3300024493 Ga0264413_127036 Ga0264413_1270363 341
133 3300042590 Ga0466690_059913 Ga0466690_059913_14607_15632 341
134 3300042600 Ga0466700_346138 Ga0466700_346138_58430_59455 341
135 3300042617 Ga0466718_047926 Ga0466718_047926_2619_3644 341
136 3300042643 Ga0466704_320623 Ga0466704_320623_7496_8521 341
137 3300042649 Ga0466724_20253 Ga0466724_20253_11594_12619 341
138 iso_pr_bacteria 2634166424 2635616644 341
139 3300005201 Ga0072941_1017195 Ga0072941_10171955 342
140 3300005201 Ga0072941_1086793 Ga0072941_10867933 342
141 3300007153 Ga0104050_1000274 Ga0104050_10002742 342
142 3300010167 Ga0123353_10604262 Ga0123353_106042621 342
143 3300042602 Ga0466713_129121 Ga0466713_129121_2916_3944 342
144 3300042612 Ga0466705_286694 Ga0466705_286694_42853_43881 342
145 3300042613 Ga0466710_226644 Ga0466710_226644_144_1172 342
146 3300042614 Ga0466712_115267 Ga0466712_115267_190_1218 342
147 3300042616 Ga0466715_091994 Ga0466715_091994_95534_96562 342
148 3300042617 Ga0466718_092441 Ga0466718_092441_10846_11874 342
149 iso_pr_bacteria 2590828840 2593258319 342
150 iso_pr_bacteria 2593339124 2595064259 342
151 iso_pr_bacteria 2820301196 2820302639 342
152 iso_pr_bacteria 2881902429 2881902513 342
153 3300002449 JGI24698J34947_10030178 JGI24698J34947_100301783 343
154 3300002449 JGI24698J34947_10063810 JGI24698J34947_100638102 343
155 3300002508 JGI24700J35501_10860748 JGI24700J35501_108607482 343
156 3300002508 JGI24700J35501_10930903 JGI24700J35501_1093090327 343
157 3300009826 Ga0123355_10222578 Ga0123355_102225783 343
158 3300057007 Ga0562374_2397 Ga0562374_2397_12702_13733 343
159 iso_pr_bacteria 2758568557 2760421581 343
160 iso_pr_bacteria 2758568559 2760425600 343
161 iso_pr_bacteria 2758568560 2760426837 343
162 iso_pr_bacteria 2758568561 2760428491 343
163 iso_pr_bacteria 2808606958 2811758597 343
164 iso_pr_bacteria 2902668162 2902670705 343
165 3300042599 Ga0466706_025624 Ga0466706_025624_42268_43302 344
166 3300042619 Ga0466726_344696 Ga0466726_344696_58661_59695 344
167 iso_pr_bacteria 2651870343 2654486032 344
168 3300005071 Ga0068302_10009967 Ga0068302_100099676 345
169 3300042599 Ga0466706_233747 Ga0466706_233747_634_1695 345
170 iso_pr_bacteria 2756170272 2756775288 346
171 iso_pr_bacteria 2834540479 2834541374 346
172 2084038013 AglaG_contig17681 AglaG_01037450 347
173 3300057007 Ga0562374_0931 Ga0562374_0931_29940_30983 347
174 3300042649 Ga0466724_08980 Ga0466724_08980_1797_2861 354
175 3300056856 Ga0562375_0301 Ga0562375_0301_73761_74828 355
176 3300056814 Ga0562378_0003 Ga0562378_0003_1656885_1657955 356
177 3300057007 Ga0562374_0006 Ga0562374_0006_1989036_1990106 356
178 3300042611 Ga0466697_168128 Ga0466697_168128_150_1226 358
179 3300042636 Ga0466703_018268 Ga0466703_018268_193_1314 358
180 3300005200 Ga0072940_1092147 Ga0072940_10921473 362
181 3300042601 Ga0466707_330441 Ga0466707_330441_3919_5037 372
182 3300056842 Ga0562377_0063 Ga0562377_0063_162046_163233 395
183 3300057007 Ga0562374_0659 Ga0562374_0659_1690_2877 395

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01063 Aminotran_4 Amino-transferase class IV 110 347 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01063 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.