Protein Family IF10486

Metagenome Isolate
232 Members
179 Samples
95 Scaffolds
209.97 Avg Length

🧬 Representative Sequence

ID
3300056814|Ga0562378_1419|Ga0562378_1419_16600_17328
Length
242 aa
Sequence
MLRSFFEGARDNARLYPSLICFKIKEKPKETFKMGKFQVIDHPLIQHKLTMIRDKNCGTKVFREVVDEIAMLMAYEVSRDMPLEDVVIETPIEESTQKTLSGKKVAIVPILRAGLGMVDGILELIPAAKVGHIGMYRDEETLEPHEYFVKLPEDIDTRQLFIVDPMLATGGSAIMAIDALKKRGASNMKFVCLVAAPEGVKALQDAHPDVDIYTASLDDRLNEHGYIVPGLGDAGDRLFGTK

📊 Sample Types

Isolate 59.0%
Metagenome 41.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 22.1%
Apidae 14.1%
Drosophilidae 13.5%
Termitidae 10.4%
Tenebrionidae 5.5%
Halictidae 5.5%
Scarabaeidae 3.7%
Formicidae 2.5%
Rhinotermitidae 2.5%
Kalotermitidae 2.5%
Elmidae 1.8%
Termopsidae 1.8%
Blattidae 1.2%
Pteromalidae 1.2%
Dytiscidae 1.2%
Noctuidae 1.2%
Ixodidae 1.2%
Vespidae 0.6%
Bombycidae 0.6%
Hodotermitidae 0.6%
Syrphidae 0.6%
Pyrrhocoridae 0.6%
Rhaphidophoridae 0.6%
Cimicidae 0.6%
Gomphidae 0.6%
Libellulidae 0.6%
Cerambycidae 0.6%
Hydrophilidae 0.6%
Stratiomyidae 0.6%
Passalidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 216
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
3 2590828839 Clostridium sp. 1 Isolate Termitidae
4 2595698193 Melissococcus plutonius B5 Isolate Apidae
5 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
6 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
7 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
8 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
9 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
10 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
11 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
12 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
13 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
14 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
15 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
16 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
17 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
18 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
19 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
20 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
21 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
22 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
23 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
32 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
33 2595698199 Melissococcus plutonius 60 Isolate Apidae
34 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
35 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
36 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
37 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
38 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
39 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
46 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
47 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
48 8007237282 Enterococcus sp. DIV0212c Isolate
49 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
50 8017489919 Lactobacillus brevis EF Isolate Unclassified
51 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
52 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
53 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
54 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
55 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
56 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
59 2576861450 Candidatus Hepatoplasma crinochetorum Av Isolate Unclassified
60 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
61 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
62 2541047151 Spiroplasma melliferum IPMB4A Isolate Apidae
63 2554235381 Spiroplasma syrphidicola EA-1 Isolate Syrphidae
64 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
65 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
66 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
67 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
68 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
69 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
70 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
71 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
72 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
73 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
74 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
75 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
76 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
77 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
78 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
79 2558860181 Spiroplasma mirum ATCC 29335 Isolate Ixodidae
80 2558860251 Spiroplasma mirum SMCA Isolate Ixodidae
81 2593339124 Clostridium sp. 4 Isolate Termitidae
82 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
83 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
84 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
85 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
86 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
87 2802429587 Spiroplasma eriocheiris CCTCC 'M 207170' Isolate Unclassified
88 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
89 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
90 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
91 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
92 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
93 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
94 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
95 8076013101 Spiroplasma poulsonii sHy/REF Isolate Drosophilidae
96 8108568626 Enterococcus sp. DIV1094 Isolate
97 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
98 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
99 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
100 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
101 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
102 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
103 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
104 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
105 2595698195 Melissococcus plutonius 119 Isolate Apidae
106 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
107 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
108 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
109 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
110 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
111 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
112 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
113 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
114 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
115 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
116 8007223943 Enterococcus sp. MSG2901 Isolate
117 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
118 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
119 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
120 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
121 8067289520 Spiroplasma poulsonii MSRO_BK Isolate Drosophilidae
122 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
123 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
124 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
125 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
126 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
127 2595698197 Melissococcus plutonius H6 Isolate Apidae
128 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
129 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
130 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
131 2554235371 Spiroplasma chrysopicola DF-1 Isolate Unclassified
132 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
133 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
134 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
135 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
136 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
137 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
138 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
139 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
140 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
141 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
142 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
143 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
144 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
145 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
146 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
147 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
148 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
149 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
150 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
151 2595698198 Melissococcus plutonius L9 Isolate Apidae
152 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
153 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
154 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
155 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
156 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
157 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
158 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
159 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
160 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
161 8100317081 Spiroplasma sp. Moj Isolate Drosophilidae
162 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
163 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
164 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
165 8114555646 Enterococcus sp. DIV1094 Isolate
166 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
167 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
168 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
169 2627853628 Melissococcus plutonius 82 Isolate Apidae
170 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
171 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
172 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
173 2806310699 Spiroplasma melliferum KC3 Isolate Unclassified
174 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
175 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
176 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
177 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
178 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
179 8100315503 Spiroplasma sp. hyd1 Isolate Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562374_0037 3300057007 Bacteria 679104
2 Ga0068305_10198350 3300005083 Bacteria 1674
3 Ga0466702_444147 3300042635 Bacteria 77354
4 Ga0466724_27464 3300042649 Bacteria 7882
5 Ga0466727_346481 3300042655 Bacteria 130939
6 Ga0466715_592523 3300042616 Bacteria 13774
7 Ga0466706_062262 3300042599 Bacteria 11458
8 Ga0466706_131878 3300042599 Bacteria 11748
9 Ga0123355_10000785 3300009826 Bacteria 43452
10 Ga0123355_10059723 3300009826 Bacteria 6159
11 Ga0562379_1572 3300056790 Unclassified 24966
12 Ga0562378_1419 3300056814 Bacteria 26134
13 Ga0562377_0088 3300056842 Bacteria 335236
14 Ga0562375_0005 3300056856 Bacteria 2472444
15 Ga0562374_0570 3300057007 Bacteria 59068
16 2227462972 2225789004 Bacteria 5347
17 HBC_ctgsDRAFT_1000119 3300000333 Bacteria 19395
18 JGI24703J35330_11748773 3300002501 Bacteria 33693
19 JGI24703J35330_11748844 3300002501 Bacteria 47873
20 Ga0052191_101012 3300003097 Unclassified 792
21 Ga0068302_10002066 3300005071 Bacteria 11736
22 Ga0105005_1021284 3300007505 Bacteria 2981
23 Ga0466715_517274 3300042616 Unclassified 1039
24 Ga0466707_337460 3300042601 Bacteria 15574
25 Ga0466719_298555 3300042606 Bacteria 20171
26 Ga0123355_10763059 3300009826 Bacteria 1090
27 Ga0466733_063707 3300042659 Bacteria 3775
28 Ga0562379_0011 3300056790 Bacteria 1623141
29 Ga0562379_3157 3300056790 Bacteria 11645
30 Ga0562375_0482 3300056856 Unclassified 82858
31 AglaG_contig08166 2084038013 Bacteria 3951
32 2227358563 2225789004 Bacteria 106790
33 JGI24696J40584_12939425 3300002834 Bacteria 1652
34 Ga0466728_322142 3300042620 Bacteria 36825
35 Ga0466656_306940 3300042550 Bacteria 2470
36 Ga0466706_043674 3300042599 Bacteria 1475
37 Ga0466706_117512 3300042599 Bacteria 2829
38 Ga0466722_197654 3300042609 Bacteria 6261
39 Ga0562378_2405 3300056814 Unclassified 15653
40 Ga0562377_0135 3300056842 Bacteria 217276
41 Ga0562375_0037 3300056856 Bacteria 606076
42 Ga0562376_0458 3300056857 Unclassified 75512
43 JGI24697J35500_11257564 3300002507 Bacteria 2806
44 Ga0103268_1009462 3300007192 Unclassified 2019
45 Ga0466724_07482 3300042649 Bacteria 1167
46 Ga0466715_193860 3300042616 Bacteria 24563
47 Ga0466706_032498 3300042599 Bacteria 1704
48 Ga0466707_145225 3300042601 Bacteria 1233
49 Ga0466714_077834 3300042603 Bacteria 1324
50 Ga0123355_10105588 3300009826 Unclassified 4419
51 Ga0123355_10409565 3300009826 Bacteria 1742
52 Ga0466732_022324 3300042656 Bacteria 1634
53 Ga0530661_000083 3300056564 Bacteria 88780
54 Ga0562379_0060 3300056790 Bacteria 473002
55 JGI24697J35500_11074524 3300002507 Bacteria 1094
56 JGI24700J35501_10917863 3300002508 Unclassified 4199
57 Ga0068305_10009364 3300005083 Unclassified 49869
58 Ga0466734_085075 3300042623 Bacteria 3890
59 Ga0466726_200285 3300042619 Bacteria 2532
60 Ga0466692_173785 3300042591 Bacteria 1017
61 Ga0466706_115763 3300042599 Bacteria 2251
62 Ga0466707_262391 3300042601 Unclassified 12360
63 Ga0562379_0005 3300056790 Bacteria 2649770
64 2227080786 2225789004 Bacteria 144239
65 JGI24703J35330_11745267 3300002501 Bacteria 4504
66 Ga0466726_396373 3300042619 Bacteria 6332
67 Ga0466729_135137 3300042621 Bacteria 7852
68 Ga0466706_041685 3300042599 Bacteria 6807
69 Ga0466706_114359 3300042599 Bacteria 22008
70 Ga0466706_220681 3300042599 Unclassified 1714
71 Ga0466700_198485 3300042600 Bacteria 27616
72 Ga0466707_073279 3300042601 Bacteria 1810
73 Ga0466713_096101 3300042602 Unclassified 1520
74 Ga0123353_10000179 3300010167 Bacteria 80899
75 Ga0562377_1572 3300056842 Bacteria 22495
76 CwormDRAF_NODE_4886_len_762_cov_170_439636 2035265002 Unclassified 792
77 JGI24703J35330_11701798 3300002501 Bacteria 2037
78 Ga0052191_100791 3300003097 Bacteria 1861
79 Ga0466731_079561 3300042622 Unclassified 1991
80 Ga0466706_273111 3300042599 Bacteria 3512
81 Ga0466714_051891 3300042603 Bacteria 5063
82 Ga0466733_186893 3300042659 Bacteria 4692
83 Ga0530661_012791 3300056564 Bacteria 2340
84 Ga0562377_0060 3300056842 Bacteria 477040
85 Ga0562375_0013 3300056856 Bacteria 1229523
86 Ga0562375_0025 3300056856 Bacteria 749171
87 Ga0562374_0008 3300057007 Bacteria 1999653
88 HBC_ctgsDRAFT_1024180 3300000333 Unclassified 1490
89 Ga0072941_1009320 3300005201 Bacteria 98392
90 Ga0466726_131279 3300042619 Bacteria 16467
91 Ga0255572_1000024 3300026175 Bacteria 128087
92 Ga0466707_302602 3300042601 Bacteria 8610
93 Ga0466707_381389 3300042601 Bacteria 2486
94 Ga0123355_10000867 3300009826 Bacteria 41773
95 Ga0123355_10001841 3300009826 Bacteria 29692

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005083 Ga0068305_10198350 Ga0068305_101983501 200
2 3300042601 Ga0466707_073279 Ga0466707_073279_301_918 205
3 2225789004 2227462972 2227897475 207
4 3300042659 Ga0466733_063707 Ga0466733_063707_2569_3192 207
5 iso_pr_bacteria 2541047151 2542000250 207
6 iso_pr_bacteria 2554235371 2555765320 207
7 iso_pr_bacteria 2554235381 2555814340 207
8 iso_pr_bacteria 2558860181 2559092297 207
9 iso_pr_bacteria 2558860251 2559327145 207
10 iso_pr_bacteria 2802429587 2805847562 207
11 iso_pr_bacteria 2806310699 2807278535 207
12 iso_pr_bacteria 2820876581 2820878486 207
13 iso_pr_bacteria 8067289520 8067291841 207
14 iso_pr_bacteria 8076013101 8076014491 207
15 iso_pr_bacteria 8100315503 8100315920 207
16 iso_pr_bacteria 8100317081 8100317446 207
17 3300003097 Ga0052191_100791 Ga0052191_1007911 208
18 3300007192 Ga0103268_1009462 Ga0103268_10094621 208
19 3300042550 Ga0466656_306940 Ga0466656_306940_90_716 208
20 3300042599 Ga0466706_041685 Ga0466706_041685_3900_4526 208
21 3300042620 Ga0466728_322142 Ga0466728_322142_10368_10994 208
22 3300042622 Ga0466731_079561 Ga0466731_079561_1340_1966 208
23 iso_pr_bacteria 2510065002 2510072418 208
24 iso_pr_bacteria 2524614872 2526112453 208
25 iso_pr_bacteria 2576861450 2578394587 208
26 iso_pr_bacteria 2636416028 2638992648 208
27 iso_pr_bacteria 2836755666 2836758143 208
28 iso_pr_bacteria 2989309576 2989313296 208
29 iso_pr_bacteria 651324002 651579085 208
30 2035265002 CwormDRAF_NODE_4886_len_762_cov_170_439636 CwormDRAFT_236960 209
31 2084038013 AglaG_contig08166 AglaG_00892950 209
32 2225789004 2227358563 2227805881 209
33 3300002501 JGI24703J35330_11701798 JGI24703J35330_117017983 209
34 3300002501 JGI24703J35330_11745267 JGI24703J35330_117452671 209
35 3300002501 JGI24703J35330_11748773 JGI24703J35330_1174877311 209
36 3300002501 JGI24703J35330_11748844 JGI24703J35330_1174884414 209
37 3300002834 JGI24696J40584_12939425 JGI24696J40584_129394251 209
38 3300009826 Ga0123355_10000785 Ga0123355_1000078526 209
39 3300009826 Ga0123355_10001841 Ga0123355_100018413 209
40 3300009826 Ga0123355_10059723 Ga0123355_100597238 209
41 3300009826 Ga0123355_10105588 Ga0123355_101055884 209
42 3300009826 Ga0123355_10409565 Ga0123355_104095652 209
43 3300009826 Ga0123355_10763059 Ga0123355_107630592 209
44 3300010167 Ga0123353_10000179 Ga0123353_1000017941 209
45 3300026175 Ga0255572_1000024 Ga0255572_100002435 209
46 3300042591 Ga0466692_173785 Ga0466692_173785_201_830 209
47 3300042599 Ga0466706_032498 Ga0466706_032498_698_1327 209
48 3300042599 Ga0466706_043674 Ga0466706_043674_62_691 209
49 3300042599 Ga0466706_220681 Ga0466706_220681_120_749 209
50 3300042599 Ga0466706_273111 Ga0466706_273111_1033_1662 209
51 3300042600 Ga0466700_198485 Ga0466700_198485_23278_23907 209
52 3300042601 Ga0466707_145225 Ga0466707_145225_37_666 209
53 3300042601 Ga0466707_302602 Ga0466707_302602_4976_5605 209
54 3300042601 Ga0466707_337460 Ga0466707_337460_135_764 209
55 3300042601 Ga0466707_381389 Ga0466707_381389_63_692 209
56 3300042606 Ga0466719_298555 Ga0466719_298555_18253_18882 209
57 3300042609 Ga0466722_197654 Ga0466722_197654_1155_1784 209
58 3300042616 Ga0466715_517274 Ga0466715_517274_306_935 209
59 3300042616 Ga0466715_592523 Ga0466715_592523_10521_11150 209
60 3300042619 Ga0466726_131279 Ga0466726_131279_9430_10059 209
61 3300042619 Ga0466726_200285 Ga0466726_200285_168_797 209
62 3300042619 Ga0466726_396373 Ga0466726_396373_4565_5194 209
63 3300042621 Ga0466729_135137 Ga0466729_135137_650_1279 209
64 3300042623 Ga0466734_085075 Ga0466734_085075_194_823 209
65 3300042635 Ga0466702_444147 Ga0466702_444147_51968_52597 209
66 3300042649 Ga0466724_07482 Ga0466724_07482_287_916 209
67 3300042655 Ga0466727_346481 Ga0466727_346481_107892_108521 209
68 3300042656 Ga0466732_022324 Ga0466732_022324_675_1304 209
69 3300056564 Ga0530661_000083 Ga0530661_000083_1147_1776 209
70 3300056790 Ga0562379_0005 Ga0562379_0005_314285_314914 209
71 3300056790 Ga0562379_0011 Ga0562379_0011_262527_263156 209
72 3300056790 Ga0562379_0060 Ga0562379_0060_39797_40426 209
73 3300056790 Ga0562379_1572 Ga0562379_1572_21179_21808 209
74 3300056814 Ga0562378_2405 Ga0562378_2405_11341_11970 209
75 3300056842 Ga0562377_0135 Ga0562377_0135_176485_177114 209
76 3300056856 Ga0562375_0005 Ga0562375_0005_185758_186387 209
77 3300056856 Ga0562375_0013 Ga0562375_0013_156343_156972 209
78 3300056856 Ga0562375_0025 Ga0562375_0025_273838_274467 209
79 3300057007 Ga0562374_0008 Ga0562374_0008_1091732_1092361 209
80 3300057007 Ga0562374_0037 Ga0562374_0037_335639_336268 209
81 3300057007 Ga0562374_0570 Ga0562374_0570_13277_13906 209
82 iso_pr_bacteria 2576861670 2579167281 209
83 iso_pr_bacteria 2585428141 2588053517 209
84 iso_pr_bacteria 2590828839 2593250400 209
85 iso_pr_bacteria 2590828839 2593251393 209
86 iso_pr_bacteria 2593339124 2595064132 209
87 iso_pr_bacteria 2595698190 2596206369 209
88 iso_pr_bacteria 2595698193 2596211781 209
89 iso_pr_bacteria 2595698194 2596212483 209
90 iso_pr_bacteria 2595698195 2596215457 209
91 iso_pr_bacteria 2595698196 2596217284 209
92 iso_pr_bacteria 2595698197 2596219120 209
93 iso_pr_bacteria 2595698198 2596220952 209
94 iso_pr_bacteria 2595698199 2596222757 209
95 iso_pr_bacteria 2597490293 2598963750 209
96 iso_pr_bacteria 2622736579 2623392013 209
97 iso_pr_bacteria 2627853628 2628281155 209
98 iso_pr_bacteria 2630968413 2631703288 209
99 iso_pr_bacteria 2634166424 2635615140 209
100 iso_pr_bacteria 2651870343 2654486177 209
101 iso_pr_bacteria 2690315820 2691201429 209
102 iso_pr_bacteria 2718218475 2721608588 209
103 iso_pr_bacteria 2728369362 2730151462 209
104 iso_pr_bacteria 2740892556 2743947693 209
105 iso_pr_bacteria 2756170272 2756775670 209
106 iso_pr_bacteria 2758568557 2760421773 209
107 iso_pr_bacteria 2758568559 2760425409 209
108 iso_pr_bacteria 2758568560 2760427029 209
109 iso_pr_bacteria 2758568561 2760428683 209
110 iso_pr_bacteria 2770939318 2771021383 209
111 iso_pr_bacteria 2775507073 2777018905 209
112 iso_pr_bacteria 2808606958 2811758401 209
113 iso_pr_bacteria 2820236043 2820238285 209
114 iso_pr_bacteria 2820393573 2820395668 209
115 iso_pr_bacteria 2820411483 2820412153 209
116 iso_pr_bacteria 2820416776 2820417232 209
117 iso_pr_bacteria 2820471304 2820471623 209
118 iso_pr_bacteria 2825804107 2825805640 209
119 iso_pr_bacteria 2834540479 2834540936 209
120 iso_pr_bacteria 2850695442 2850697068 209
121 iso_pr_bacteria 2851412233 2851413056 209
122 iso_pr_bacteria 2864773010 2864776289 209
123 iso_pr_bacteria 2864918810 2864918825 209
124 iso_pr_bacteria 2864964650 2864968421 209
125 iso_pr_bacteria 2873581347 2873583607 209
126 iso_pr_bacteria 2873584433 2873585261 209
127 iso_pr_bacteria 2873632256 2873632673 209
128 iso_pr_bacteria 2881375749 2881377471 209
129 iso_pr_bacteria 2881902429 2881902896 209
130 iso_pr_bacteria 2896402965 2896403573 209
131 iso_pr_bacteria 2896843662 2896844637 209
132 iso_pr_bacteria 2900804455 2900806176 209
133 iso_pr_bacteria 2902668162 2902671229 209
134 iso_pr_bacteria 2905310146 2905311092 209
135 iso_pr_bacteria 2937236879 2937239034 209
136 iso_pr_bacteria 2940218408 2940220817 209
137 iso_pr_bacteria 2940261461 2940263864 209
138 iso_pr_bacteria 2956926959 2956928523 209
139 iso_pr_bacteria 2956928875 2956928923 209
140 iso_pr_bacteria 2956930723 2956932667 209
141 iso_pr_bacteria 2960772748 2960773851 209
142 iso_pr_bacteria 2964749277 2964751994 209
143 iso_pr_bacteria 2964765680 2964768179 209
144 iso_pr_bacteria 2964775400 2964778150 209
145 iso_pr_bacteria 2964778705 2964780976 209
146 iso_pr_bacteria 2967802344 2967804595 209
147 iso_pr_bacteria 2967825073 2967825704 209
148 iso_pr_bacteria 2977596371 2977596509 209
149 iso_pr_bacteria 2977622177 2977622311 209
150 iso_pr_bacteria 2977628635 2977630978 209
151 iso_pr_bacteria 2977635137 2977635997 209
152 iso_pr_bacteria 646564587 646803807 209
153 iso_pr_bacteria 647533136 647747285 209
154 iso_pr_bacteria 650716050 650845757 209
155 iso_pr_bacteria 8001918023 8001918973 209
156 iso_pr_bacteria 8002299145 8002300493 209
157 iso_pr_bacteria 8007211731 8007212220 209
158 iso_pr_bacteria 8007215774 8007216982 209
159 iso_pr_bacteria 8007220153 8007221521 209
160 iso_pr_bacteria 8007223943 8007223965 209
161 iso_pr_bacteria 8007237282 8007237944 209
162 iso_pr_bacteria 8012939035 8012940999 209
163 iso_pr_bacteria 8012942269 8012944516 209
164 iso_pr_bacteria 8017458139 8017460247 209
165 iso_pr_bacteria 8017489919 8017492156 209
166 iso_pr_bacteria 8018750880 8018751280 209
167 iso_pr_bacteria 8018754795 8018757093 209
168 iso_pr_bacteria 8018794549 8018797821 209
169 iso_pr_bacteria 8018798118 8018799831 209
170 iso_pr_bacteria 8018802046 8018804635 209
171 iso_pr_bacteria 8030343600 8030343667 209
172 iso_pr_bacteria 8038268975 8038271963 209
173 iso_pr_bacteria 8077780672 8077782725 209
174 iso_pr_bacteria 8108568626 8108569213 209
175 iso_pr_bacteria 8108576847 8108580150 209
176 iso_pr_bacteria 8114537524 8114538504 209
177 iso_pr_bacteria 8114541043 8114541278 209
178 iso_pr_bacteria 8114544644 8114545977 209
179 iso_pr_bacteria 8114549044 8114552347 209
180 iso_pr_bacteria 8114555646 8114556233 209
181 3300000333 HBC_ctgsDRAFT_1000119 HBC_ctgsDRAFT_100011916 210
182 3300000333 HBC_ctgsDRAFT_1024180 HBC_ctgsDRAFT_10241801 210
183 3300002507 JGI24697J35500_11257564 JGI24697J35500_112575642 210
184 3300002508 JGI24700J35501_10917863 JGI24700J35501_109178635 210
185 3300003097 Ga0052191_101012 Ga0052191_1010121 210
186 3300005071 Ga0068302_10002066 Ga0068302_100020668 210
187 3300005083 Ga0068305_10009364 Ga0068305_1000936422 210
188 3300042599 Ga0466706_062262 Ga0466706_062262_8993_9625 210
189 3300042603 Ga0466714_077834 Ga0466714_077834_622_1254 210
190 iso_pr_bacteria 2558860143 2559001397 210
191 iso_pr_bacteria 2558860143 2559001571 210
192 iso_pr_bacteria 2675903377 2677724115 210
193 iso_pr_bacteria 2877522083 2877523043 210
194 iso_pr_bacteria 2923762712 2923763715 210
195 iso_pr_bacteria 2936628749 2936630135 210
196 iso_pr_bacteria 8002304686 8002305059 210
197 iso_pr_bacteria 8066790652 8066791861 210
198 iso_pr_bacteria 8066792404 8066793690 210
199 iso_pr_bacteria 8066794103 8066795044 210
200 iso_pr_bacteria 8066795793 8066797115 210
201 iso_pr_bacteria 8066797744 8066799027 210
202 iso_pr_bacteria 8066799369 8066800512 210
203 iso_pr_bacteria 8066802609 8066803748 210
204 2225789004 2227080786 2227453488 211
205 3300002507 JGI24697J35500_11074524 JGI24697J35500_110745241 211
206 3300005201 Ga0072941_1009320 Ga0072941_100932022 211
207 3300009826 Ga0123355_10000867 Ga0123355_1000086734 211
208 3300042599 Ga0466706_117512 Ga0466706_117512_882_1517 211
209 3300056842 Ga0562377_0088 Ga0562377_0088_207198_207833 211
210 iso_pr_bacteria 2834951433 2834951634 211
211 iso_pr_bacteria 2878857142 2878857216 211
212 3300042659 Ga0466733_186893 Ga0466733_186893_2149_2787 212
213 3300042601 Ga0466707_262391 Ga0466707_262391_7089_7730 213
214 3300042602 Ga0466713_096101 Ga0466713_096101_446_1087 213
215 3300042616 Ga0466715_193860 Ga0466715_193860_668_1309 213
216 3300042603 Ga0466714_051891 Ga0466714_051891_1208_1852 214
217 3300056842 Ga0562377_0060 Ga0562377_0060_178941_179588 215
218 3300056790 Ga0562379_3157 Ga0562379_3157_2925_3575 216
219 iso_pr_bacteria 2997944163 2997945628 216
220 3300007505 Ga0105005_1021284 Ga0105005_10212842 217
221 iso_pr_bacteria 2503538010 2503574957 217
222 3300042599 Ga0466706_114359 Ga0466706_114359_16904_17563 219
223 3300042649 Ga0466724_27464 Ga0466724_27464_2729_3388 219
224 3300042599 Ga0466706_131878 Ga0466706_131878_8926_9588 220
225 3300056857 Ga0562376_0458 Ga0562376_0458_74383_75045 220
226 3300056856 Ga0562375_0037 Ga0562375_0037_507997_508668 223
227 iso_pr_bacteria 8077775691 8077779558 223
228 3300042599 Ga0466706_115763 Ga0466706_115763_429_1109 226
229 3300056564 Ga0530661_012791 Ga0530661_012791_269_952 227
230 3300056856 Ga0562375_0482 Ga0562375_0482_13573_14259 228
231 3300056842 Ga0562377_1572 Ga0562377_1572_10128_10838 236
232 3300056814 Ga0562378_1419 Ga0562378_1419_16600_17328 242

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14681 UPRTase Uracil phosphoribosyltransferase 39 241 0.99
PF00156 Pribosyltran Phosphoribosyl transferase domain 96 203 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.