Protein Family IF10480

Metagenome Isolate
527 Members
400 Samples
160 Scaffolds
277.45 Avg Length

🧬 Representative Sequence

ID
3300056814|Ga0562378_0537|Ga0562378_0537_4549_5523
Length
324 aa
Sequence
MQPTDLPKNAPFTRPLFPPLLSFGVQRVSLKQHFISHPPSRMIHFMEGEMSLQQEIIKALGVKPVIDARQEIRRSVDFLKSYLQRYPFLKTLVLGISGGQDSTLTGKLCQTAISELRKETGNDEYQFIAVRLPFGTQADEQDCQDAIAFIQPDRVLTVNIKAAVLASEQTLREAGIELSDFVRGNEKARERMKAQYSIAGMTHGVVVGTDHAAEAVTGFFTKYGDGGTDINPLFRLNKRQGKLLLKTLGCPEHLYLKSPTADLEDSRPALPDEIALGVNYDQIDDYLEGKTVGSEAAQVIENWYQKTEHKRRPPITVFDDFWQR

πŸ“Š Sample Types

Isolate 69.6%
Metagenome 30.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 19.9%
Coreidae 19.9%
Apidae 10.0%
Drosophilidae 5.2%
Anthocoridae 4.7%
Tenebrionidae 3.9%
Muscidae 3.4%
Termitidae 3.4%
Curculionidae 2.6%
Calliphoridae 2.1%
Scarabaeidae 1.8%
Cambaridae 1.6%
Elmidae 1.6%
Culicidae 1.6%
Halictidae 1.3%
Kalotermitidae 1.3%
Formicidae 1.3%
Tephritidae 1.3%
Armadillidiidae 1.0%
Aphididae 0.8%
Dytiscidae 0.8%
Termopsidae 0.8%
Sarcophagidae 0.5%
Blattidae 0.5%
Glossinidae 0.5%
Plutellidae 0.5%
Berytidae 0.5%
Pentatomidae 0.5%
Thripidae 0.3%
Anthomyiidae 0.3%
Gomphidae 0.3%
Nephropidae 0.3%
Chironomidae 0.3%
Largidae 0.3%
Aphalaridae 0.3%
Psyllidae 0.3%
Daphniidae 0.3%
Vespidae 0.3%
Hodotermitidae 0.3%
Bombycidae 0.3%
Alydidae 0.3%
Passalidae 0.3%
Rhinotermitidae 0.3%
Cerambycidae 0.3%
Crambidae 0.3%
Penaeidae 0.3%
Cicadellidae 0.3%
Rhopalidae 0.3%
Hydrophilidae 0.3%
Libellulidae 0.3%
Carabidae 0.3%
Euphausiidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 499
Eukaryota 0
Viruses 0
Unclassified 28

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
2 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
3 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
4 2595698195 Melissococcus plutonius 119 Isolate Apidae
5 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
6 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
7 2718218137 Buchnera aphidicola (Diuraphis noxia) Isolate Aphididae
8 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
9 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
10 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
11 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
12 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
13 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
14 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
15 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
16 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
17 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
18 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
19 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
20 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
21 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
24 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
25 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 651324086 Plautia crossota stali symbiont Isolate Unclassified
29 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
30 8007223943 Enterococcus sp. MSG2901 Isolate
31 8012112996 Staphylococcus muscae ATCC 49910 Isolate
32 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
33 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
34 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
35 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
36 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
37 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
38 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
39 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
40 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
41 8071333649 Escherichia coli PN108 Isolate Calliphoridae
42 8071338694 Escherichia coli PN87 Isolate Calliphoridae
43 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
44 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
45 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
46 8102117041 Caballeronia sp. INML3 Isolate Coreidae
47 8102131453 Caballeronia sp. INML5 Isolate Coreidae
48 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
49 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
50 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
51 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
52 8102982778 Erwinia sp. S63 Isolate Curculionidae
53 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
54 2595698199 Melissococcus plutonius 60 Isolate Apidae
55 2645727860 Winslowiella iniecta B120 Isolate Aphididae
56 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
57 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
58 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
59 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
60 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
61 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
62 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
63 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
64 2864909992 Bacillus velezensis S00166 Isolate Elmidae
65 2871771314 Pantoea sp. Ae16 Isolate Culicidae
66 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
67 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
68 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
69 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
70 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
71 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
72 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
73 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
74 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
75 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
76 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
77 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
78 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
79 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
80 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
81 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
82 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
83 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
84 3004719924 Lactobacillus sp. W8174 Isolate Apidae
85 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
86 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
87 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
88 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
89 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
90 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
91 648276708 Pantoea sp. aB Isolate Unclassified
92 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
93 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
94 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
95 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
96 8017489919 Lactobacillus brevis EF Isolate Unclassified
97 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
98 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
99 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
100 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
101 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
102 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
103 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
104 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
105 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
106 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
107 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
108 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
109 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
110 8102102351 Caballeronia sp. INML1 Isolate Coreidae
111 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
112 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
113 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
114 2509601000 Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 Isolate Aphalaridae
115 2512047046 Secondary Endosymbiont of Heteropsylla cubana Isolate Psyllidae
116 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
117 2556921669 Shinella sp. DD12 Isolate Daphniidae
118 2595698193 Melissococcus plutonius B5 Isolate Apidae
119 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
120 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
121 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
122 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
123 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
124 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
125 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
126 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
127 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
128 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
129 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
130 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
131 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
132 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
133 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
134 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
135 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
136 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
137 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
138 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
139 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
140 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
141 3300009533 Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov Metagenome
142 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
143 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
144 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
145 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
146 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
147 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
148 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
149 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
150 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
151 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
152 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
153 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
154 8100176769 Kosakonia sp. S57 Isolate Curculionidae
155 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
156 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
157 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
158 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
159 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
160 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
161 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
162 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
163 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
164 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
165 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
166 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
167 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
168 2648501209 Winslowiella iniecta B149 Isolate Aphididae
169 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
170 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
171 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
172 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
173 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
174 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
175 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
176 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
177 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
178 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
179 2864801025 Bacillus aerius S00042 Isolate Elmidae
180 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
181 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
182 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
183 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
184 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
185 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
186 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
187 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
188 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
189 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
190 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
191 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
192 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
193 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
194 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
195 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
196 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
197 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
198 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
199 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
200 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
201 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
202 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
203 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
204 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
205 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
206 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
207 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
208 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
209 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
210 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
211 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
212 2627853628 Melissococcus plutonius 82 Isolate Apidae
213 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
214 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
215 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
216 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
217 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
218 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
219 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
220 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
221 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
222 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
223 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
224 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
225 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
226 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
227 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
228 8114555646 Enterococcus sp. DIV1094 Isolate
229 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
230 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
231 3007994558 Escherichia alba B35 Isolate Tenebrionidae
232 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
233 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
234 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
235 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
236 8023757577 Caballeronia peredens LP006 Isolate Coreidae
237 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
238 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
239 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
240 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
241 8064008355 Heyndrickxia oleronia Isolate Unclassified
242 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
243 8082023105 Niallia sp. Man26 Isolate Penaeidae
244 8100181737 Kosakonia sp. S58 Isolate Curculionidae
245 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
246 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
247 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
248 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
249 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
250 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
251 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
252 2511231135 Wigglesworthia glossinidia endosymbiont of Glossina morsitans Isolate Glossinidae
253 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
254 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
255 2595698198 Melissococcus plutonius L9 Isolate Apidae
256 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
257 2648501856 Candidatus Baumannia cicadellinicola BGSS Isolate Cicadellidae
258 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
259 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
260 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
261 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
262 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
263 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
264 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
265 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
266 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
267 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
268 2898975184 Erwinia dacicola IL Isolate Tephritidae
269 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
270 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
271 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
272 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
273 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
274 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
275 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
276 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
277 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
278 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
279 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
280 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
281 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
282 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
283 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
284 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
285 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
286 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
287 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
288 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
289 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
290 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
291 8018312681 Enterobacter sp. OLF Isolate Tephritidae
292 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
293 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
294 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
295 8069748016 Caballeronia sp. LP003 Isolate Coreidae
296 8099192374 Erwinia typographi IC4 Isolate Curculionidae
297 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
298 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
299 8102109360 Caballeronia sp. INML2 Isolate Coreidae
300 8102145433 Caballeronia sp. LP006 Isolate Coreidae
301 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
302 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
303 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
304 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
305 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
306 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
307 2595698197 Melissococcus plutonius H6 Isolate Apidae
308 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
309 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
310 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
311 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
312 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
313 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
314 2864895409 Bacillus aerius S00152 Isolate Elmidae
315 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
316 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
317 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
318 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
319 2916858470 Heyndrickxia oleronia Isolate Unclassified
320 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
321 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
322 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
323 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
324 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
325 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
326 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
327 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
328 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
329 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
330 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
331 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
332 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
333 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
334 637000338 Wigglesworthia glossinidia Isolate Unclassified
335 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
336 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
337 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
338 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
339 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
340 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
341 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
342 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
343 8071343737 Escherichia coli PN119 Isolate Calliphoridae
344 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
345 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
346 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
347 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
348 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
349 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
350 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
351 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
352 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
353 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
354 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
355 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
356 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
357 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
358 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
359 2836714267 Shimwellia blattae NCTC10965 Isolate
360 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
361 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
362 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
363 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
364 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
365 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
366 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
367 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
368 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
369 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
370 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
371 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
372 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
373 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
374 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
375 8112490586 Staphylococcus muscae CCM 4175 Isolate
376 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
377 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
378 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
379 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
380 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
381 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
382 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
383 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
384 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
385 8021546568 Klebsiella sp. Kps Isolate Tephritidae
386 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
387 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
388 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
389 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
390 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
391 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
392 8071322446 Escherichia coli PN122 Isolate Calliphoridae
393 8100171289 Kosakonia sp. S42 Isolate Curculionidae
394 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
395 8102124461 Caballeronia sp. INML3B Isolate Coreidae
396 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
397 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
398 8103002986 Erwinia sp. S38 Isolate Curculionidae
399 8103008710 Erwinia sp. S43 Isolate Curculionidae
400 8108568626 Enterococcus sp. DIV1094 Isolate

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_005662 3300056564 Bacteria 3644
2 Ga0562379_0011 3300056790 Bacteria 1623141
3 Ga0562379_0429 3300056790 Bacteria 90757
4 Ga0562378_0537 3300056814 Bacteria 61658
5 Ga0562377_2220 3300056842 Unclassified 15440
6 Ga0562375_0304 3300056856 Bacteria 121677
7 Ga0562375_4342 3300056856 Bacteria 10972
8 Ga0562375_6110 3300056856 Bacteria 5784
9 Ga0562376_3196 3300056857 Bacteria 17195
10 Ga0562374_0439 3300057007 Bacteria 72203
11 Ga0466705_449687 3300042612 Bacteria 1793
12 Ga0123355_10099409 3300009826 Bacteria 4585
13 Ga0160430_100061 3300012852 Bacteria 116154
14 Ga0466691_064665 3300042593 Bacteria 18085
15 Ga0466713_112824 3300042602 Bacteria 48577
16 Ga0466730_040365 3300042625 Bacteria 42776
17 Ga0466730_075201 3300042625 Unclassified 6750
18 Ga0466724_62923 3300042649 Bacteria 2294
19 2227080774 2225789004 Bacteria 191256
20 2227507945 2225789004 Bacteria 72134
21 JGI24703J35330_11741923 3300002501 Bacteria 3616
22 CVPL010L_1001270 3300002932 Unclassified 3844
23 Ga0063521_1000046 3300003973 Bacteria 107081
24 Ga0074302_1139405 3300005316 Bacteria 1231
25 Ga0562379_0001 3300056790 Bacteria 4904077
26 Ga0562379_0069 3300056790 Bacteria 430601
27 Ga0562375_0175 3300056856 Bacteria 188123
28 Ga0562375_0554 3300056856 Bacteria 74507
29 Ga0562374_0010 3300057007 Bacteria 1930599
30 Ga0562374_0011 3300057007 Bacteria 1900075
31 Ga0562374_0023 3300057007 Bacteria 1031437
32 Ga0123356_10139385 3300010049 Bacteria 2391
33 Ga0160433_100388 3300012846 Unclassified 24634
34 Ga0160447_100492 3300012849 Bacteria 18766
35 Ga0316159_10392 3300030930 Bacteria 16138
36 Ga0247290_00126 3300035364 Bacteria 23762
37 Ga0466701_024618 3300042598 Bacteria 50393
38 Ga0466707_287775 3300042601 Bacteria 73891
39 HBC_ctgsDRAFT_1033611 3300000333 Bacteria 1260
40 JGI24703J35330_11748852 3300002501 Bacteria 50255
41 Ga0063521_1000056 3300003973 Bacteria 99837
42 Ga0074278_140187 3300005721 Unclassified 2094
43 Ga0105553_1041721 3300007767 Bacteria 37493
44 Ga0466705_100465 3300042612 Bacteria 4583
45 Ga0562379_0079 3300056790 Bacteria 358699
46 Ga0562379_0350 3300056790 Bacteria 110432
47 Ga0562379_0532 3300056790 Bacteria 73625
48 Ga0562378_0016 3300056814 Bacteria 880040
49 Ga0562378_0277 3300056814 Bacteria 112362
50 Ga0562378_0688 3300056814 Bacteria 49514
51 Ga0562376_0060 3300056857 Bacteria 279520
52 Ga0562376_0975 3300056857 Bacteria 44193
53 Ga0562374_0018 3300057007 Bacteria 1182001
54 Ga0466726_064906 3300042619 Bacteria 72682
55 Ga0123355_10009170 3300009826 Bacteria 15011
56 Ga0160464_100035 3300012805 Unclassified 169690
57 Ga0160456_102994 3300012820 Bacteria 2760
58 Ga0160436_1005300 3300012861 Bacteria 3040
59 Ga0265387_1000123 3300024582 Bacteria 15899
60 Ga0466699_200014 3300042597 Bacteria 1269
61 Ga0466719_031992 3300042606 Bacteria 3009
62 Ga0466730_003525 3300042625 Bacteria 46259
63 Ga0466702_181339 3300042635 Bacteria 1069
64 FGTW_contig31100 2065487013 Unclassified 4908
65 HBC_ctgsDRAFT_1001000 3300000333 Unclassified 6142
66 JGI24703J35330_11747790 3300002501 Bacteria 8284
67 JGI24699J35502_11064257 3300002509 Bacteria 1772
68 Ga0068305_10251110 3300005083 Bacteria 2456
69 Ga0074278_114052 3300005721 Unclassified 19660
70 Ga0104040_1144832 3300007149 Bacteria 1691
71 Ga0530661_004299 3300056564 Bacteria 4384
72 Ga0530661_004951 3300056564 Unclassified 3986
73 Ga0562379_0016 3300056790 Bacteria 1192610
74 Ga0562379_0486 3300056790 Bacteria 80046
75 Ga0562378_1162 3300056814 Unclassified 31022
76 Ga0562377_0001 3300056842 Bacteria 5082480
77 Ga0562377_0017 3300056842 Bacteria 1143096
78 Ga0562376_6102 3300056857 Unclassified 6204
79 Ga0562374_0037 3300057007 Bacteria 679104
80 Ga0123355_10073768 3300009826 Bacteria 5467
81 Ga0160447_100857 3300012849 Unclassified 13075
82 Ga0247289_0046 3300035363 Bacteria 38103
83 Ga0247290_01399 3300035364 Unclassified 2775
84 Ga0466706_050728 3300042599 Bacteria 5655
85 Ga0466734_016385 3300042623 Bacteria 3328
86 Ga0466730_093203 3300042625 Bacteria 81298
87 FGTW_contig06729 2065487013 Bacteria 2196
88 HBC_ctgsDRAFT_1000284 3300000333 Bacteria 11790
89 Ga0068302_10026308 3300005071 Bacteria 22231
90 Ga0530661_000001 3300056564 Bacteria 684835
91 Ga0562379_0032 3300056790 Bacteria 747488
92 Ga0562376_0297 3300056857 Bacteria 97822
93 Ga0562376_0430 3300056857 Unclassified 78789
94 Ga0562374_0420 3300057007 Bacteria 74593
95 Ga0160440_100085 3300012815 Bacteria 111297
96 Ga0316159_10337 3300030930 Bacteria 7496
97 Ga0466691_225358 3300042593 Bacteria 4150
98 Ga0466701_045007 3300042598 Bacteria 3715
99 Ga0466702_222137 3300042635 Bacteria 1740
100 Ga0466709_230827 3300042648 Bacteria 200320
101 CVPL010L_1000206 3300002932 Unclassified 20904
102 Ga0063521_1005870 3300003973 Unclassified 2906
103 Ga0562379_0727 3300056790 Bacteria 55289
104 Ga0562378_1008 3300056814 Bacteria 35411
105 Ga0562377_0088 3300056842 Bacteria 335236
106 Ga0562377_0114 3300056842 Unclassified 258244
107 Ga0562377_0148 3300056842 Bacteria 202186
108 Ga0562374_0155 3300057007 Unclassified 160671
109 Ga0562374_1215 3300057007 Bacteria 32164
110 Ga0466718_014280 3300042617 Bacteria 1403
111 Ga0160467_100026 3300012829 Bacteria 283547
112 Ga0160447_106470 3300012849 Unclassified 3091
113 Ga0265387_1000060 3300024582 Bacteria 33940
114 Ga0247289_0040 3300035363 Bacteria 40564
115 Ga0466706_096445 3300042599 Bacteria 1067
116 Ga0466707_161995 3300042601 Bacteria 13728
117 Ga0466713_093617 3300042602 Bacteria 168801
118 Ga0466703_305676 3300042636 Unclassified 1403
119 Ga0466727_142534 3300042655 Bacteria 55597
120 DPOL_contig19967 2035918003 Bacteria 58291
121 HBC_ctgsDRAFT_1047378 3300000333 Bacteria 1047
122 Ga0072941_1047447 3300005201 Bacteria 88821
123 Ga0105005_1032064 3300007505 Bacteria 4404
124 Ga0562378_1651 3300056814 Bacteria 22946
125 Ga0562377_0060 3300056842 Bacteria 477040
126 Ga0562375_0013 3300056856 Bacteria 1229523
127 Ga0562375_0025 3300056856 Bacteria 749171
128 Ga0562375_0346 3300056856 Bacteria 110366
129 Ga0160471_102750 3300012812 Bacteria 2830
130 Ga0160455_101807 3300012837 Bacteria 5488
131 Ga0255572_1000024 3300026175 Bacteria 128087
132 Ga0466706_173366 3300042599 Bacteria 2106
133 Ga0466730_002890 3300042625 Bacteria 43265
134 Ga0466730_012981 3300042625 Bacteria 11796
135 Ga0466724_12489 3300042649 Bacteria 79172
136 FGTW_contig02352 2065487013 Unclassified 3529
137 FGTW_contig31139 2065487013 Bacteria 5952
138 AustNasuHG_c1003337 3300000089 Bacteria 5793
139 HBC_ctgsDRAFT_1018088 3300000333 Bacteria 1717
140 HBC_ctgsDRAFT_1037116 3300000333 Bacteria 1195
141 Ga0072940_1581866 3300005200 Bacteria 1505
142 Ga0074278_140737 3300005721 Bacteria 11068
143 Ga0104041_1001102 3300007106 Unclassified 9557
144 Ga0104147_1019490 3300007224 Bacteria 9641
145 Ga0530661_000077 3300056564 Unclassified 91600
146 Ga0562379_0005 3300056790 Bacteria 2649770
147 Ga0562379_1998 3300056790 Unclassified 19317
148 Ga0562377_0641 3300056842 Bacteria 52294
149 Ga0562375_0009 3300056856 Bacteria 1746158
150 Ga0562376_2083 3300056857 Bacteria 25393
151 Ga0562374_2420 3300057007 Bacteria 16359
152 Ga0123355_10437019 3300009826 Bacteria 1660
153 Ga0466706_048066 3300042599 Bacteria 9274
154 Ga0466713_139973 3300042602 Bacteria 49584
155 Ga0466730_035536 3300042625 Unclassified 3012
156 HBC_ctgsDRAFT_1007235 3300000333 Unclassified 2610
157 HBC_ctgsDRAFT_1021938 3300000333 Bacteria 1562
158 CVPL010L_1000358 3300002932 Bacteria 22277
159 CVPL010L_1001670 3300002932 Unclassified 3070
160 Ga0127528_1000015 3300009533 Bacteria 619772

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005721 Ga0074278_140187 Ga0074278_1401871 215
2 3300000333 HBC_ctgsDRAFT_1001000 HBC_ctgsDRAFT_10010002 257
3 3300005721 Ga0074278_140737 Ga0074278_1407378 257
4 3300000333 HBC_ctgsDRAFT_1007235 HBC_ctgsDRAFT_10072352 259
5 3300000333 HBC_ctgsDRAFT_1033611 HBC_ctgsDRAFT_10336112 260
6 3300005721 Ga0074278_114052 Ga0074278_11405218 260
7 3300009826 Ga0123355_10073768 Ga0123355_100737685 260
8 3300002932 CVPL010L_1001270 CVPL010L_10012703 262
9 3300000333 HBC_ctgsDRAFT_1018088 HBC_ctgsDRAFT_10180882 264
10 3300009826 Ga0123355_10009170 Ga0123355_100091707 264
11 3300042635 Ga0466702_181339 Ga0466702_181339_137_931 264
12 iso_pr_bacteria 8017458139 8017459247 264
13 3300012837 Ga0160455_101807 Ga0160455_1018072 266
14 iso_pr_bacteria 8025747911 8025754532 266
15 iso_pr_bacteria 8025756023 8025762654 266
16 iso_pr_bacteria 8069755105 8069761727 266
17 iso_pr_bacteria 8102161003 8102164638 266
18 iso_pr_bacteria 2511231135 2511752629 267
19 iso_pr_bacteria 2718218137 2720250693 268
20 3300000333 HBC_ctgsDRAFT_1047378 HBC_ctgsDRAFT_10473781 269
21 3300009533 Ga0127528_1000015 Ga0127528_1000015306 269
22 iso_pr_bacteria 2956928875 2956930226 269
23 3300042635 Ga0466702_222137 Ga0466702_222137_542_1357 271
24 3300003973 Ga0063521_1005870 Ga0063521_10058701 272
25 3300042597 Ga0466699_200014 Ga0466699_200014_169_987 272
26 3300042598 Ga0466701_045007 Ga0466701_045007_195_1013 272
27 3300056790 Ga0562379_0011 Ga0562379_0011_458385_459203 272
28 3300057007 Ga0562374_0010 Ga0562374_0010_1507525_1508343 272
29 iso_pr_bacteria 2791355481 2794422580 272
30 iso_pr_bacteria 2816332114 2816400368 272
31 iso_pr_bacteria 2827179085 2827184999 272
32 iso_pr_bacteria 2864909992 2864913695 272
33 iso_pr_bacteria 2881902429 2881902591 272
34 iso_pr_bacteria 8023764196 8023772741 272
35 iso_pr_bacteria 8025747911 8025755446 272
36 iso_pr_bacteria 8025756023 8025763573 272
37 iso_pr_bacteria 8069755105 8069762641 272
38 iso_pr_bacteria 8102152052 8102160597 272
39 iso_pr_bacteria 8102161003 8102168550 272
40 3300012852 Ga0160430_100061 Ga0160430_10006170 273
41 3300042606 Ga0466719_031992 Ga0466719_031992_33_854 273
42 3300056564 Ga0530661_000001 Ga0530661_000001_562983_563804 273
43 3300056564 Ga0530661_004951 Ga0530661_004951_240_1061 273
44 3300056814 Ga0562378_0277 Ga0562378_0277_56260_57081 273
45 3300056814 Ga0562378_1008 Ga0562378_1008_12437_13258 273
46 3300056814 Ga0562378_1162 Ga0562378_1162_12053_12874 273
47 3300056842 Ga0562377_2220 Ga0562377_2220_13931_14752 273
48 3300056857 Ga0562376_0430 Ga0562376_0430_50416_51237 273
49 3300056857 Ga0562376_0975 Ga0562376_0975_19955_20776 273
50 3300056857 Ga0562376_3196 Ga0562376_3196_11647_12468 273
51 3300056857 Ga0562376_6102 Ga0562376_6102_341_1162 273
52 3300057007 Ga0562374_0420 Ga0562374_0420_12343_13164 273
53 3300057007 Ga0562374_0439 Ga0562374_0439_48549_49370 273
54 iso_pr_bacteria 2820809073 2820811127 273
55 iso_pr_bacteria 2851412233 2851413316 273
56 iso_pr_bacteria 2864801025 2864804336 273
57 iso_pr_bacteria 2864816158 2864817740 273
58 iso_pr_bacteria 2864895409 2864898718 273
59 iso_pr_bacteria 2900804455 2900804972 273
60 iso_pr_bacteria 2917496769 2917497859 273
61 iso_pr_bacteria 2956926959 2956928784 273
62 iso_pr_bacteria 2956930723 2956931453 273
63 iso_pr_bacteria 8001918023 8001918660 273
64 iso_pr_bacteria 8012112996 8012113868 273
65 iso_pr_bacteria 8043041867 8043045031 273
66 iso_pr_bacteria 8082023105 8082025026 273
67 iso_pr_bacteria 8112490586 8112491912 273
68 2225789004 2227080774 2227451538 274
69 3300000089 AustNasuHG_c1003337 AustNasuHG_10033375 274
70 3300010049 Ga0123356_10139385 Ga0123356_101393852 274
71 3300012812 Ga0160471_102750 Ga0160471_1027503 274
72 3300026175 Ga0255572_1000024 Ga0255572_1000024113 274
73 3300042593 Ga0466691_225358 Ga0466691_225358_1819_2643 274
74 3300042598 Ga0466701_024618 Ga0466701_024618_22226_23050 274
75 3300042599 Ga0466706_048066 Ga0466706_048066_669_1493 274
76 3300042599 Ga0466706_096445 Ga0466706_096445_165_989 274
77 3300042599 Ga0466706_173366 Ga0466706_173366_195_1019 274
78 3300042601 Ga0466707_287775 Ga0466707_287775_33130_33954 274
79 3300042602 Ga0466713_093617 Ga0466713_093617_137095_137919 274
80 3300042612 Ga0466705_100465 Ga0466705_100465_2537_3361 274
81 3300042619 Ga0466726_064906 Ga0466726_064906_58374_59198 274
82 3300042623 Ga0466734_016385 Ga0466734_016385_1622_2446 274
83 3300042648 Ga0466709_230827 Ga0466709_230827_56033_56857 274
84 3300042655 Ga0466727_142534 Ga0466727_142534_47977_48801 274
85 3300056790 Ga0562379_0429 Ga0562379_0429_21587_22411 274
86 3300056842 Ga0562377_0060 Ga0562377_0060_253201_254025 274
87 3300056856 Ga0562375_0009 Ga0562375_0009_461210_462034 274
88 3300056856 Ga0562375_0304 Ga0562375_0304_77009_77833 274
89 3300056856 Ga0562375_0554 Ga0562375_0554_30753_31577 274
90 3300057007 Ga0562374_0023 Ga0562374_0023_137107_137931 274
91 3300057007 Ga0562374_2420 Ga0562374_2420_9542_10366 274
92 iso_pr_bacteria 2509601000 2509601341 274
93 iso_pr_bacteria 2512047046 2512398282 274
94 iso_pr_bacteria 2524614537 2524832293 274
95 iso_pr_bacteria 2585428141 2588053866 274
96 iso_pr_bacteria 2619619082 2620610068 274
97 iso_pr_bacteria 2648501856 2651561451 274
98 iso_pr_bacteria 2651870110 2653795351 274
99 iso_pr_bacteria 2751185832 2753511628 274
100 iso_pr_bacteria 2767802234 2769330669 274
101 iso_pr_bacteria 2775507073 2777018574 274
102 iso_pr_bacteria 2820416776 2820416849 274
103 iso_pr_bacteria 2833053935 2833058880 274
104 iso_pr_bacteria 2834951433 2834953040 274
105 iso_pr_bacteria 2843246524 2843247152 274
106 iso_pr_bacteria 2852123468 2852126640 274
107 iso_pr_bacteria 2855361764 2855363136 274
108 iso_pr_bacteria 2864981449 2864985511 274
109 iso_pr_bacteria 2871760914 2871764307 274
110 iso_pr_bacteria 2873632256 2873632606 274
111 iso_pr_bacteria 2878857142 2878859563 274
112 iso_pr_bacteria 2940218408 2940219115 274
113 iso_pr_bacteria 2940261461 2940262024 274
114 iso_pr_bacteria 637000270 637853835 274
115 iso_pr_bacteria 637000338 637341722 274
116 iso_pr_bacteria 648276708 648769655 274
117 iso_pr_bacteria 8001059720 8001063101 274
118 iso_pr_bacteria 8002299145 8002301816 274
119 iso_pr_bacteria 8007223943 8007224000 274
120 iso_pr_bacteria 8012942269 8012943072 274
121 iso_pr_bacteria 8018312681 8018312935 274
122 iso_pr_bacteria 8018750880 8018751254 274
123 iso_pr_bacteria 8018754795 8018757119 274
124 iso_pr_bacteria 8018794549 8018797496 274
125 iso_pr_bacteria 8110023836 8110026447 274
126 2065487013 FGTW_contig02352 FGTW_00028070 275
127 2065487013 FGTW_contig06729 FGTW_01216470 275
128 2225789004 2227507945 2227997809 275
129 3300002501 JGI24703J35330_11741923 JGI24703J35330_117419234 275
130 3300002501 JGI24703J35330_11747790 JGI24703J35330_117477902 275
131 3300002932 CVPL010L_1000206 CVPL010L_100020623 275
132 3300005071 Ga0068302_10026308 Ga0068302_1002630814 275
133 3300005083 Ga0068305_10251110 Ga0068305_102511102 275
134 3300005200 Ga0072940_1581866 Ga0072940_15818662 275
135 3300005201 Ga0072941_1047447 Ga0072941_104744741 275
136 3300007106 Ga0104041_1001102 Ga0104041_10011028 275
137 3300007505 Ga0105005_1032064 Ga0105005_10320643 275
138 3300030930 Ga0316159_10337 Ga0316159_103372 275
139 3300035363 Ga0247289_0046 Ga0247289_0046_18400_19227 275
140 3300042599 Ga0466706_050728 Ga0466706_050728_2320_3147 275
141 3300042602 Ga0466713_139973 Ga0466713_139973_19512_20339 275
142 3300042612 Ga0466705_449687 Ga0466705_449687_956_1783 275
143 3300042617 Ga0466718_014280 Ga0466718_014280_105_932 275
144 3300042625 Ga0466730_002890 Ga0466730_002890_10620_11447 275
145 3300042625 Ga0466730_003525 Ga0466730_003525_9765_10592 275
146 3300042625 Ga0466730_035536 Ga0466730_035536_1300_2127 275
147 3300042625 Ga0466730_093203 Ga0466730_093203_37591_38418 275
148 3300056564 Ga0530661_000077 Ga0530661_000077_37759_38586 275
149 3300056564 Ga0530661_004299 Ga0530661_004299_1934_2761 275
150 3300056790 Ga0562379_0005 Ga0562379_0005_333830_334657 275
151 3300056790 Ga0562379_0032 Ga0562379_0032_282681_283508 275
152 3300056790 Ga0562379_0069 Ga0562379_0069_334794_335621 275
153 3300056790 Ga0562379_0079 Ga0562379_0079_130015_130842 275
154 3300056814 Ga0562378_0016 Ga0562378_0016_792235_793062 275
155 3300056814 Ga0562378_1651 Ga0562378_1651_8927_9754 275
156 3300056842 Ga0562377_0017 Ga0562377_0017_117906_118733 275
157 3300056842 Ga0562377_0088 Ga0562377_0088_292399_293226 275
158 3300056842 Ga0562377_0114 Ga0562377_0114_127919_128746 275
159 3300056842 Ga0562377_0148 Ga0562377_0148_102651_103478 275
160 3300056842 Ga0562377_0641 Ga0562377_0641_50134_50961 275
161 3300056856 Ga0562375_0013 Ga0562375_0013_67165_67992 275
162 3300056856 Ga0562375_0025 Ga0562375_0025_199721_200548 275
163 3300056856 Ga0562375_6110 Ga0562375_6110_411_1238 275
164 3300057007 Ga0562374_0011 Ga0562374_0011_1615390_1616217 275
165 3300057007 Ga0562374_0018 Ga0562374_0018_45702_46529 275
166 3300057007 Ga0562374_0037 Ga0562374_0037_418394_419221 275
167 iso_pr_bacteria 2507262057 2507517243 275
168 iso_pr_bacteria 2513020017 2513100216 275
169 iso_pr_bacteria 2519899623 2520394600 275
170 iso_pr_bacteria 2531839602 2534151792 275
171 iso_pr_bacteria 2537561600 2537926996 275
172 iso_pr_bacteria 2547132185 2547711110 275
173 iso_pr_bacteria 2551306516 2553380290 275
174 iso_pr_bacteria 2551306531 2553451247 275
175 iso_pr_bacteria 2558860143 2559001812 275
176 iso_pr_bacteria 2588253732 2588528905 275
177 iso_pr_bacteria 2588253791 2588731484 275
178 iso_pr_bacteria 2595698190 2596206405 275
179 iso_pr_bacteria 2595698193 2596211817 275
180 iso_pr_bacteria 2595698194 2596212447 275
181 iso_pr_bacteria 2595698195 2596215493 275
182 iso_pr_bacteria 2595698196 2596217320 275
183 iso_pr_bacteria 2595698197 2596219156 275
184 iso_pr_bacteria 2595698198 2596220988 275
185 iso_pr_bacteria 2595698199 2596222793 275
186 iso_pr_bacteria 2622736579 2623393183 275
187 iso_pr_bacteria 2627853628 2628281195 275
188 iso_pr_bacteria 2645727721 2646683915 275
189 iso_pr_bacteria 2645727860 2647289673 275
190 iso_pr_bacteria 2648501209 2648982944 275
191 iso_pr_bacteria 2684622914 2686078693 275
192 iso_pr_bacteria 2731957677 2732685585 275
193 iso_pr_bacteria 2740892556 2743947777 275
194 iso_pr_bacteria 2758568512 2760263372 275
195 iso_pr_bacteria 2778261152 2779039011 275
196 iso_pr_bacteria 2778261153 2779041861 275
197 iso_pr_bacteria 2822856742 2822859424 275
198 iso_pr_bacteria 2824588292 2824590485 275
199 iso_pr_bacteria 2825804107 2825804638 275
200 iso_pr_bacteria 2835335304 2835338559 275
201 iso_pr_bacteria 2836714267 2836715916 275
202 iso_pr_bacteria 2851410423 2851410866 275
203 iso_pr_bacteria 2852431164 2852435771 275
204 iso_pr_bacteria 2856068565 2856070364 275
205 iso_pr_bacteria 2871771314 2871773379 275
206 iso_pr_bacteria 2873584433 2873585021 275
207 iso_pr_bacteria 2874880541 2874881911 275
208 iso_pr_bacteria 2876334352 2876339047 275
209 iso_pr_bacteria 2876358570 2876358666 275
210 iso_pr_bacteria 2877522083 2877523171 275
211 iso_pr_bacteria 2881375749 2881376905 275
212 iso_pr_bacteria 2885043073 2885046545 275
213 iso_pr_bacteria 2885046828 2885050374 275
214 iso_pr_bacteria 2885050628 2885050785 275
215 iso_pr_bacteria 2885054481 2885054486 275
216 iso_pr_bacteria 2885058212 2885060713 275
217 iso_pr_bacteria 2885061987 2885065353 275
218 iso_pr_bacteria 2885065815 2885066079 275
219 iso_pr_bacteria 2890957088 2890961836 275
220 iso_pr_bacteria 2898975184 2898976736 275
221 iso_pr_bacteria 2898991528 2898995142 275
222 iso_pr_bacteria 2901296437 2901299196 275
223 iso_pr_bacteria 2905310146 2905311866 275
224 iso_pr_bacteria 2909881144 2909881410 275
225 iso_pr_bacteria 2910090113 2910091187 275
226 iso_pr_bacteria 2915166107 2915166154 275
227 iso_pr_bacteria 2915168811 2915170651 275
228 iso_pr_bacteria 2916858470 2916858595 275
229 iso_pr_bacteria 2921816052 2921819765 275
230 iso_pr_bacteria 2921842437 2921845168 275
231 iso_pr_bacteria 2923762712 2923763852 275
232 iso_pr_bacteria 2936628749 2936630001 275
233 iso_pr_bacteria 2937387794 2937389378 275
234 iso_pr_bacteria 2937427229 2937430707 275
235 iso_pr_bacteria 2957730672 2957734322 275
236 iso_pr_bacteria 2964846109 2964846369 275
237 iso_pr_bacteria 2964859436 2964861880 275
238 iso_pr_bacteria 2967915117 2967919192 275
239 iso_pr_bacteria 2967924226 2967926052 275
240 iso_pr_bacteria 2970322301 2970325978 275
241 iso_pr_bacteria 2970335472 2970337017 275
242 iso_pr_bacteria 2977691992 2977693929 275
243 iso_pr_bacteria 2977727922 2977730154 275
244 iso_pr_bacteria 2977745872 2977745957 275
245 iso_pr_bacteria 2979682021 2979684323 275
246 iso_pr_bacteria 3001459110 3001460144 275
247 iso_pr_bacteria 3001462594 3001465162 275
248 iso_pr_bacteria 3004010258 3004011766 275
249 iso_pr_bacteria 3004364956 3004365983 275
250 iso_pr_bacteria 3007994558 3007995476 275
251 iso_pr_bacteria 647533136 647747218 275
252 iso_pr_bacteria 650716050 650845795 275
253 iso_pr_bacteria 651324086 651695652 275
254 iso_pr_bacteria 8002304686 8002305723 275
255 iso_pr_bacteria 8004118532 8004119627 275
256 iso_pr_bacteria 8007211731 8007212266 275
257 iso_pr_bacteria 8007215774 8007218140 275
258 iso_pr_bacteria 8007220153 8007221582 275
259 iso_pr_bacteria 8012939035 8012941078 275
260 iso_pr_bacteria 8018798118 8018799744 275
261 iso_pr_bacteria 8018802046 8018804548 275
262 iso_pr_bacteria 8021535516 8021538928 275
263 iso_pr_bacteria 8021540981 8021544015 275
264 iso_pr_bacteria 8021546568 8021551187 275
265 iso_pr_bacteria 8038268975 8038271904 275
266 iso_pr_bacteria 8064008355 8064013477 275
267 iso_pr_bacteria 8065462725 8065465062 275
268 iso_pr_bacteria 8065466226 8065467805 275
269 iso_pr_bacteria 8065469765 8065472116 275
270 iso_pr_bacteria 8066790652 8066792181 275
271 iso_pr_bacteria 8066794103 8066794913 275
272 iso_pr_bacteria 8066799369 8066800617 275
273 iso_pr_bacteria 8071322446 8071327403 275
274 iso_pr_bacteria 8071333649 8071338410 275
275 iso_pr_bacteria 8071338694 8071338804 275
276 iso_pr_bacteria 8071343737 8071345906 275
277 iso_pr_bacteria 8073124432 8073126932 275
278 iso_pr_bacteria 8074288691 8074290406 275
279 iso_pr_bacteria 8074292191 8074295345 275
280 iso_pr_bacteria 8077780672 8077782793 275
281 iso_pr_bacteria 8099192374 8099194837 275
282 iso_pr_bacteria 8102982778 8102986263 275
283 iso_pr_bacteria 8103002986 8103006893 275
284 iso_pr_bacteria 8103008710 8103009939 275
285 iso_pr_bacteria 8108568626 8108569269 275
286 iso_pr_bacteria 8114537524 8114538590 275
287 iso_pr_bacteria 8114541043 8114541207 275
288 iso_pr_bacteria 8114549044 8114552272 275
289 iso_pr_bacteria 8114555646 8114556289 275
290 2035918003 DPOL_contig19967 DPOLB_721570 276
291 3300000333 HBC_ctgsDRAFT_1000284 HBC_ctgsDRAFT_100028413 276
292 3300002932 CVPL010L_1000358 CVPL010L_100035815 276
293 3300002932 CVPL010L_1001670 CVPL010L_10016702 276
294 3300003973 Ga0063521_1000056 Ga0063521_100005661 276
295 3300005316 Ga0074302_1139405 Ga0074302_11394051 276
296 3300007149 Ga0104040_1144832 Ga0104040_11448322 276
297 3300007224 Ga0104147_1019490 Ga0104147_101949011 276
298 3300007767 Ga0105553_1041721 Ga0105553_104172129 276
299 3300012820 Ga0160456_102994 Ga0160456_1029943 276
300 3300012829 Ga0160467_100026 Ga0160467_100026177 276
301 3300012846 Ga0160433_100388 Ga0160433_10038822 276
302 3300024582 Ga0265387_1000060 Ga0265387_100006029 276
303 3300024582 Ga0265387_1000123 Ga0265387_10001237 276
304 3300056790 Ga0562379_1998 Ga0562379_1998_13499_14329 276
305 3300056856 Ga0562375_0346 Ga0562375_0346_51364_52194 276
306 iso_pr_bacteria 2684622911 2686073178 276
307 iso_pr_bacteria 2684622913 2686076720 276
308 iso_pr_bacteria 2758568505 2760251356 276
309 iso_pr_bacteria 2758568506 2760253051 276
310 iso_pr_bacteria 2758568507 2760254726 276
311 iso_pr_bacteria 2758568508 2760256425 276
312 iso_pr_bacteria 2758568509 2760258124 276
313 iso_pr_bacteria 2758568510 2760259826 276
314 iso_pr_bacteria 2758568513 2760265206 276
315 iso_pr_bacteria 2758568514 2760267085 276
316 iso_pr_bacteria 2758568515 2760269064 276
317 iso_pr_bacteria 2758568557 2760421557 276
318 iso_pr_bacteria 2758568558 2760424494 276
319 iso_pr_bacteria 2758568560 2760426813 276
320 iso_pr_bacteria 2765235945 2766083270 276
321 iso_pr_bacteria 2785510748 2785746733 276
322 iso_pr_bacteria 2799112220 2799190890 276
323 iso_pr_bacteria 2799112229 2799229241 276
324 iso_pr_bacteria 2799112230 2799230996 276
325 iso_pr_bacteria 2837516909 2837518922 276
326 iso_pr_bacteria 2846386538 2846389141 276
327 iso_pr_bacteria 2864816158 2864818803 276
328 iso_pr_bacteria 2873581347 2873581439 276
329 iso_pr_bacteria 2877513988 2877514425 276
330 iso_pr_bacteria 2882334426 2882336148 276
331 iso_pr_bacteria 2884613238 2884616511 276
332 iso_pr_bacteria 2896843662 2896844885 276
333 iso_pr_bacteria 2938192669 2938193450 276
334 iso_pr_bacteria 2958885890 2958886179 276
335 iso_pr_bacteria 2961465228 2961465514 276
336 iso_pr_bacteria 2961515617 2961516023 276
337 iso_pr_bacteria 2968368220 2968369878 276
338 iso_pr_bacteria 2971062614 2971063546 276
339 iso_pr_bacteria 3004719924 3004721933 276
340 iso_pr_bacteria 8004832522 8004832809 276
341 iso_pr_bacteria 8017440191 8017441568 276
342 iso_pr_bacteria 8017462664 8017463149 276
343 iso_pr_bacteria 8017489919 8017492404 276
344 iso_pr_bacteria 8017536074 8017536542 276
345 iso_pr_bacteria 8062647588 8062648302 276
346 iso_pr_bacteria 8067987626 8067988835 276
347 iso_pr_bacteria 8100181737 8100183276 276
348 3300000333 HBC_ctgsDRAFT_1021938 HBC_ctgsDRAFT_10219382 277
349 3300002509 JGI24699J35502_11064257 JGI24699J35502_110642572 277
350 3300009826 Ga0123355_10099409 Ga0123355_100994092 277
351 3300012861 Ga0160436_1005300 Ga0160436_10053004 277
352 3300042593 Ga0466691_064665 Ga0466691_064665_269_1102 277
353 3300042625 Ga0466730_075201 Ga0466730_075201_2305_3138 277
354 3300042636 Ga0466703_305676 Ga0466703_305676_242_1075 277
355 3300042649 Ga0466724_62923 Ga0466724_62923_225_1058 277
356 3300056790 Ga0562379_0016 Ga0562379_0016_344012_344845 277
357 3300056790 Ga0562379_0727 Ga0562379_0727_42788_43621 277
358 3300056857 Ga0562376_0060 Ga0562376_0060_102782_103615 277
359 3300056857 Ga0562376_2083 Ga0562376_2083_5860_6693 277
360 3300057007 Ga0562374_0155 Ga0562374_0155_113605_114438 277
361 3300057007 Ga0562374_1215 Ga0562374_1215_22792_23625 277
362 iso_pr_bacteria 2684622912 2686074976 277
363 iso_pr_bacteria 2758568501 2760244733 277
364 iso_pr_bacteria 2758568502 2760246402 277
365 iso_pr_bacteria 2758568503 2760248064 277
366 iso_pr_bacteria 2758568504 2760249726 277
367 iso_pr_bacteria 2758568511 2760261544 277
368 iso_pr_bacteria 2758568559 2760425624 277
369 iso_pr_bacteria 2758568561 2760428465 277
370 iso_pr_bacteria 2808606958 2811758621 277
371 iso_pr_bacteria 2814123166 2815022861 277
372 iso_pr_bacteria 2818991320 2819438770 277
373 iso_pr_bacteria 2873614151 2873617361 277
374 iso_pr_bacteria 2912324399 2912324713 277
375 iso_pr_bacteria 2915157839 2915157850 277
376 iso_pr_bacteria 2915160415 2915162656 277
377 iso_pr_bacteria 2979949929 2979950283 277
378 iso_pr_bacteria 8002519755 8002520814 277
379 iso_pr_bacteria 8025650824 8025655061 277
380 iso_pr_bacteria 8025658853 8025662847 277
381 iso_pr_bacteria 8025671076 8025675216 277
382 iso_pr_bacteria 8025678175 8025681211 277
383 iso_pr_bacteria 8025685901 8025690447 277
384 iso_pr_bacteria 8025694439 8025698645 277
385 iso_pr_bacteria 8102208438 8102212675 277
386 iso_pr_bacteria 8102216467 8102220673 277
387 iso_pr_bacteria 8102223607 8102227747 277
388 iso_pr_bacteria 8102230706 8102235252 277
389 iso_pr_bacteria 8102239244 8102242278 277
390 iso_pr_bacteria 8102251710 8102255704 277
391 3300000333 HBC_ctgsDRAFT_1037116 HBC_ctgsDRAFT_10371161 278
392 3300035363 Ga0247289_0040 Ga0247289_0040_20789_21625 278
393 3300035364 Ga0247290_01399 Ga0247290_01399_214_1050 278
394 3300042625 Ga0466730_040365 Ga0466730_040365_13067_13903 278
395 3300056790 Ga0562379_0486 Ga0562379_0486_59149_59985 278
396 iso_pr_bacteria 2820518089 2820519841 278
397 iso_pr_bacteria 2864985977 2864987039 278
398 2065487013 FGTW_contig31100 FGTW_01849020 279
399 2065487013 FGTW_contig31139 FGTW_02155270 279
400 3300002501 JGI24703J35330_11748852 JGI24703J35330_117488524 279
401 3300035364 Ga0247290_00126 Ga0247290_00126_21709_22548 279
402 3300042601 Ga0466707_161995 Ga0466707_161995_5299_6138 279
403 3300042602 Ga0466713_112824 Ga0466713_112824_27860_28699 279
404 3300042625 Ga0466730_012981 Ga0466730_012981_1290_2129 279
405 3300042649 Ga0466724_12489 Ga0466724_12489_61634_62473 279
406 3300056842 Ga0562377_0001 Ga0562377_0001_1625159_1625998 279
407 3300056856 Ga0562375_0175 Ga0562375_0175_8561_9400 279
408 iso_pr_bacteria 2556921669 2558279418 279
409 iso_pr_bacteria 3003869270 3003872703 279
410 iso_pr_bacteria 2820876581 2820877471 280
411 3300003973 Ga0063521_1000046 Ga0063521_100004657 281
412 3300009826 Ga0123355_10437019 Ga0123355_104370192 281
413 iso_pr_bacteria 2524023214 2524487800 281
414 iso_pr_bacteria 2675903013 2676273041 281
415 iso_pr_bacteria 2894897082 2894898712 281
416 iso_pr_bacteria 2894900265 2894900964 281
417 iso_pr_bacteria 2894926108 2894929232 281
418 iso_pr_bacteria 2894929448 2894930156 281
419 iso_pr_bacteria 2894932631 2894933887 281
420 iso_pr_bacteria 2894935787 2894936084 281
421 iso_pr_bacteria 2894944011 2894944736 281
422 iso_pr_bacteria 2894966443 2894966942 281
423 iso_pr_bacteria 2894974975 2894976154 281
424 iso_pr_bacteria 2894981435 2894982042 281
425 iso_pr_bacteria 8023747282 8023747311 281
426 iso_pr_bacteria 8023764196 8023764637 281
427 iso_pr_bacteria 8023764196 8023772690 281
428 iso_pr_bacteria 8023764196 8023772966 281
429 iso_pr_bacteria 8024014383 8024018704 281
430 iso_pr_bacteria 8024019580 8024024072 281
431 iso_pr_bacteria 8024025509 8024030409 281
432 iso_pr_bacteria 8024044713 8024049516 281
433 iso_pr_bacteria 8025658853 8025665744 281
434 iso_pr_bacteria 8025678175 8025681858 281
435 iso_pr_bacteria 8025701579 8025704009 281
436 iso_pr_bacteria 8025723035 8025727115 281
437 iso_pr_bacteria 8025728939 8025732193 281
438 iso_pr_bacteria 8025735396 8025740808 281
439 iso_pr_bacteria 8025740903 8025747428 281
440 iso_pr_bacteria 8069763219 8069769744 281
441 iso_pr_bacteria 8069770227 8069770256 281
442 iso_pr_bacteria 8102014801 8102019112 281
443 iso_pr_bacteria 8102020860 8102026736 281
444 iso_pr_bacteria 8102054868 8102059782 281
445 iso_pr_bacteria 8102081745 8102087299 281
446 iso_pr_bacteria 8102152052 8102152493 281
447 iso_pr_bacteria 8102152052 8102160546 281
448 iso_pr_bacteria 8102152052 8102160822 281
449 iso_pr_bacteria 8102169119 8102174531 281
450 iso_pr_bacteria 8102174626 8102177880 281
451 iso_pr_bacteria 8102181083 8102185163 281
452 iso_pr_bacteria 8102201977 8102204407 281
453 iso_pr_bacteria 8102239244 8102242925 281
454 iso_pr_bacteria 8102251710 8102258601 281
455 iso_pr_bacteria 8109397740 8109401510 281
456 3300012805 Ga0160464_100035 Ga0160464_10003520 282
457 3300012849 Ga0160447_106470 Ga0160447_1064704 282
458 iso_pr_bacteria 8025650824 8025658424 283
459 iso_pr_bacteria 8025685901 8025693998 283
460 iso_pr_bacteria 8102208438 8102216038 283
461 iso_pr_bacteria 8102230706 8102238803 283
462 3300056790 Ga0562379_0350 Ga0562379_0350_106796_107653 285
463 3300056856 Ga0562375_4342 Ga0562375_4342_9952_10809 285
464 3300056857 Ga0562376_0297 Ga0562376_0297_78587_79444 285
465 iso_pr_bacteria 8024037630 8024043882 285
466 iso_pr_bacteria 8025716094 8025722270 285
467 iso_pr_bacteria 8025740903 8025743951 285
468 iso_pr_bacteria 8069748016 8069753776 285
469 iso_pr_bacteria 8069763219 8069766267 285
470 iso_pr_bacteria 8078130113 8078134011 285
471 iso_pr_bacteria 8101951471 8101957993 285
472 iso_pr_bacteria 8101960468 8101967038 285
473 iso_pr_bacteria 8101967387 8101974066 285
474 iso_pr_bacteria 8101974301 8101980895 285
475 iso_pr_bacteria 8101981714 8101987909 285
476 iso_pr_bacteria 8101988189 8101994330 285
477 iso_pr_bacteria 8101994502 8102000916 285
478 iso_pr_bacteria 8102001125 8102007462 285
479 iso_pr_bacteria 8102007614 8102014371 285
480 iso_pr_bacteria 8102026984 8102033601 285
481 iso_pr_bacteria 8102033761 8102040861 285
482 iso_pr_bacteria 8102047609 8102054389 285
483 iso_pr_bacteria 8102067727 8102074398 285
484 iso_pr_bacteria 8102094248 8102098197 285
485 iso_pr_bacteria 8102131453 8102136087 285
486 iso_pr_bacteria 8102186987 8102193164 285
487 iso_pr_bacteria 8102264549 8102271467 285
488 iso_pr_bacteria 8102271933 8102278842 285
489 iso_pr_bacteria 8102279326 8102286109 285
490 iso_pr_bacteria 8102286609 8102293143 285
491 iso_pr_bacteria 8102312426 8102319060 285
492 3300012849 Ga0160447_100492 Ga0160447_1004922 286
493 3300012849 Ga0160447_100857 Ga0160447_1008572 286
494 iso_pr_bacteria 8102102351 8102106268 286
495 iso_pr_bacteria 8102109360 8102113285 286
496 iso_pr_bacteria 8102117041 8102121084 286
497 iso_pr_bacteria 8102124461 8102128494 286
498 iso_pr_bacteria 8102138357 8102142267 286
499 iso_pr_bacteria 8102094248 8102099917 287
500 iso_pr_bacteria 2597489944 2598061072 288
501 3300012815 Ga0160440_100085 Ga0160440_10008520 291
502 3300030930 Ga0316159_10392 Ga0316159_1039211 293
503 iso_pr_bacteria 8100171289 8100172837 293
504 iso_pr_bacteria 8100176769 8100178296 293
505 3300056564 Ga0530661_005662 Ga0530661_005662_1866_2750 294
506 3300056790 Ga0562379_0532 Ga0562379_0532_14326_15216 296
507 3300056814 Ga0562378_0688 Ga0562378_0688_42905_43795 296
508 iso_pr_bacteria 8012935351 8012938036 296
509 iso_pr_bacteria 8023724303 8023726992 307
510 iso_pr_bacteria 8023757577 8023760266 307
511 iso_pr_bacteria 8023764196 8023767672 307
512 iso_pr_bacteria 8024001094 8024004432 307
513 iso_pr_bacteria 8025747911 8025753279 307
514 iso_pr_bacteria 8025756023 8025761393 307
515 iso_pr_bacteria 8069755105 8069760473 307
516 iso_pr_bacteria 8102041249 8102044893 307
517 iso_pr_bacteria 8102060671 8102064626 307
518 iso_pr_bacteria 8102074813 8102078745 307
519 iso_pr_bacteria 8102087471 8102091033 307
520 iso_pr_bacteria 8102145433 8102148122 307
521 iso_pr_bacteria 8102152052 8102155528 307
522 iso_pr_bacteria 8102161003 8102163380 307
523 iso_pr_bacteria 8025708040 8025711189 314
524 iso_pr_bacteria 8102094248 8102102022 314
525 iso_pr_bacteria 8102193924 8102197071 314
526 3300056790 Ga0562379_0001 Ga0562379_0001_3064601_3065575 324
527 3300056814 Ga0562378_0537 Ga0562378_0537_4549_5523 324

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02540 NAD_synthase NAD synthase 72 314 0.98

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.