Protein Family IF10480
Metagenome
Isolate
527
Members
400
Samples
160
Scaffolds
277.45
Avg Length
Representative Sequence
- ID
- 3300056814|Ga0562378_0537|Ga0562378_0537_4549_5523
- Length
- 324 aa
- Sequence
- MQPTDLPKNAPFTRPLFPPLLSFGVQRVSLKQHFISHPPSRMIHFMEGEMSLQQEIIKALGVKPVIDARQEIRRSVDFLKSYLQRYPFLKTLVLGISGGQDSTLTGKLCQTAISELRKETGNDEYQFIAVRLPFGTQADEQDCQDAIAFIQPDRVLTVNIKAAVLASEQTLREAGIELSDFVRGNEKARERMKAQYSIAGMTHGVVVGTDHAAEAVTGFFTKYGDGGTDINPLFRLNKRQGKLLLKTLGCPEHLYLKSPTADLEDSRPALPDEIALGVNYDQIDDYLEGKTVGSEAAQVIENWYQKTEHKRRPPITVFDDFWQR
Sample Types
Isolate
69.6%
Metagenome
30.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.9%
Coreidae
19.9%
Apidae
10.0%
Drosophilidae
5.2%
Anthocoridae
4.7%
Tenebrionidae
3.9%
Muscidae
3.4%
Termitidae
3.4%
Curculionidae
2.6%
Calliphoridae
2.1%
Scarabaeidae
1.8%
Cambaridae
1.6%
Elmidae
1.6%
Culicidae
1.6%
Halictidae
1.3%
Kalotermitidae
1.3%
Formicidae
1.3%
Tephritidae
1.3%
Armadillidiidae
1.0%
Aphididae
0.8%
Dytiscidae
0.8%
Termopsidae
0.8%
Sarcophagidae
0.5%
Blattidae
0.5%
Glossinidae
0.5%
Plutellidae
0.5%
Berytidae
0.5%
Pentatomidae
0.5%
Thripidae
0.3%
Anthomyiidae
0.3%
Gomphidae
0.3%
Nephropidae
0.3%
Chironomidae
0.3%
Largidae
0.3%
Aphalaridae
0.3%
Psyllidae
0.3%
Daphniidae
0.3%
Vespidae
0.3%
Hodotermitidae
0.3%
Bombycidae
0.3%
Alydidae
0.3%
Passalidae
0.3%
Rhinotermitidae
0.3%
Cerambycidae
0.3%
Crambidae
0.3%
Penaeidae
0.3%
Cicadellidae
0.3%
Rhopalidae
0.3%
Hydrophilidae
0.3%
Libellulidae
0.3%
Carabidae
0.3%
Euphausiidae
0.3%
Taxonomy
Archaea
0
Bacteria
499
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 2 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 3 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 4 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 5 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 6 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 7 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 8 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 9 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 10 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 11 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 12 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 13 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 14 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 15 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 16 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 17 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 18 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 19 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 20 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 21 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 24 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 25 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 29 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 30 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 31 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 32 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 33 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 34 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 35 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 36 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 37 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 38 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 39 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 40 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 41 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 42 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 43 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 44 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 45 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 46 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 47 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 48 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 49 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 50 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 51 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 52 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 53 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 54 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 55 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 56 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 57 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 58 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 59 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 60 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 61 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 62 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 63 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 64 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 65 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 66 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 67 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 68 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 69 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 70 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 71 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 72 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 73 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 74 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 75 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 76 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 77 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 78 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 79 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 80 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 81 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 82 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 83 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 84 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 85 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 86 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 87 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 88 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 89 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 90 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 91 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 92 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 93 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 94 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 95 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 96 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 97 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 98 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 99 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 100 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 101 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 102 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 103 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 104 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 105 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 106 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 107 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 108 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 109 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 110 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 111 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 112 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 113 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 114 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 115 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 116 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 117 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 118 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 119 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 120 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 121 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 122 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 123 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 124 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 125 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 126 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 127 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 128 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 129 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 130 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 131 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 132 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 133 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 134 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 135 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 136 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 137 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 138 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 139 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 140 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 141 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 142 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 143 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 144 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 145 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 146 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 147 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 148 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 149 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 150 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 151 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 152 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 153 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 154 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 155 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 156 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 157 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 158 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 159 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 160 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 161 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 162 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 163 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 164 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 165 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 166 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 167 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 168 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 169 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 170 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 171 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 172 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 173 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 174 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 175 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 176 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 177 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 178 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 179 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 180 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 181 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 182 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 183 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 184 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 185 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 186 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 187 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 188 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 189 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 190 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 191 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 192 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 193 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 194 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 195 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 196 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 197 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 198 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 199 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 200 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 201 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 202 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 203 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 204 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 205 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 206 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 207 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 208 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 209 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 210 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 211 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 212 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 213 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 214 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 215 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 216 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 217 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 218 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 219 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 220 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 221 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 222 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 223 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 224 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 225 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 226 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 227 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 228 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 229 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 230 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 231 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 232 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 233 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 234 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 235 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 236 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 237 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 238 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 239 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 240 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 241 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 242 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 243 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 244 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 245 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 246 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 247 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 248 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 249 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 250 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 251 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 252 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 253 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 254 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 255 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 256 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 257 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 258 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 259 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 260 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 261 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 262 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 263 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 264 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 265 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 266 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 267 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 268 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 269 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 270 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 271 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 272 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 273 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 274 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 275 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 276 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 277 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 278 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 279 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 280 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 281 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 282 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 283 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 284 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 285 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 286 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 287 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 288 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 289 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 290 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 291 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 292 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 293 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 294 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 295 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 296 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 297 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 298 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 299 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 300 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 301 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 302 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 303 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 304 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 305 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 306 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 307 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 308 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 309 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 310 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 311 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 312 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 313 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 314 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 315 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 316 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 317 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 318 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 319 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 320 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 321 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 322 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 323 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 324 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 325 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 326 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 327 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 328 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 329 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 330 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 331 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 332 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 333 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 334 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 335 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 336 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 337 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 338 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 339 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 340 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 341 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 342 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 343 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 344 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 345 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 346 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 347 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 348 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 349 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 350 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 351 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 352 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 353 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 354 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 355 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 356 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 357 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 358 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 359 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 360 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 361 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 362 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 363 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 364 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 365 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 366 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 367 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 368 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 369 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 370 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 371 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 372 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 373 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 374 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 375 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 376 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 377 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 378 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 379 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 380 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 381 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 382 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 383 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 384 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 385 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 386 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 387 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 388 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 389 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 390 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 391 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 392 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 393 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 394 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 395 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 396 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 397 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 398 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 399 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 400 | 8108568626 | Enterococcus sp. DIV1094 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_005662 | 3300056564 | Bacteria | 3644 |
| 2 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 3 | Ga0562379_0429 | 3300056790 | Bacteria | 90757 |
| 4 | Ga0562378_0537 | 3300056814 | Bacteria | 61658 |
| 5 | Ga0562377_2220 | 3300056842 | Unclassified | 15440 |
| 6 | Ga0562375_0304 | 3300056856 | Bacteria | 121677 |
| 7 | Ga0562375_4342 | 3300056856 | Bacteria | 10972 |
| 8 | Ga0562375_6110 | 3300056856 | Bacteria | 5784 |
| 9 | Ga0562376_3196 | 3300056857 | Bacteria | 17195 |
| 10 | Ga0562374_0439 | 3300057007 | Bacteria | 72203 |
| 11 | Ga0466705_449687 | 3300042612 | Bacteria | 1793 |
| 12 | Ga0123355_10099409 | 3300009826 | Bacteria | 4585 |
| 13 | Ga0160430_100061 | 3300012852 | Bacteria | 116154 |
| 14 | Ga0466691_064665 | 3300042593 | Bacteria | 18085 |
| 15 | Ga0466713_112824 | 3300042602 | Bacteria | 48577 |
| 16 | Ga0466730_040365 | 3300042625 | Bacteria | 42776 |
| 17 | Ga0466730_075201 | 3300042625 | Unclassified | 6750 |
| 18 | Ga0466724_62923 | 3300042649 | Bacteria | 2294 |
| 19 | 2227080774 | 2225789004 | Bacteria | 191256 |
| 20 | 2227507945 | 2225789004 | Bacteria | 72134 |
| 21 | JGI24703J35330_11741923 | 3300002501 | Bacteria | 3616 |
| 22 | CVPL010L_1001270 | 3300002932 | Unclassified | 3844 |
| 23 | Ga0063521_1000046 | 3300003973 | Bacteria | 107081 |
| 24 | Ga0074302_1139405 | 3300005316 | Bacteria | 1231 |
| 25 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 26 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 27 | Ga0562375_0175 | 3300056856 | Bacteria | 188123 |
| 28 | Ga0562375_0554 | 3300056856 | Bacteria | 74507 |
| 29 | Ga0562374_0010 | 3300057007 | Bacteria | 1930599 |
| 30 | Ga0562374_0011 | 3300057007 | Bacteria | 1900075 |
| 31 | Ga0562374_0023 | 3300057007 | Bacteria | 1031437 |
| 32 | Ga0123356_10139385 | 3300010049 | Bacteria | 2391 |
| 33 | Ga0160433_100388 | 3300012846 | Unclassified | 24634 |
| 34 | Ga0160447_100492 | 3300012849 | Bacteria | 18766 |
| 35 | Ga0316159_10392 | 3300030930 | Bacteria | 16138 |
| 36 | Ga0247290_00126 | 3300035364 | Bacteria | 23762 |
| 37 | Ga0466701_024618 | 3300042598 | Bacteria | 50393 |
| 38 | Ga0466707_287775 | 3300042601 | Bacteria | 73891 |
| 39 | HBC_ctgsDRAFT_1033611 | 3300000333 | Bacteria | 1260 |
| 40 | JGI24703J35330_11748852 | 3300002501 | Bacteria | 50255 |
| 41 | Ga0063521_1000056 | 3300003973 | Bacteria | 99837 |
| 42 | Ga0074278_140187 | 3300005721 | Unclassified | 2094 |
| 43 | Ga0105553_1041721 | 3300007767 | Bacteria | 37493 |
| 44 | Ga0466705_100465 | 3300042612 | Bacteria | 4583 |
| 45 | Ga0562379_0079 | 3300056790 | Bacteria | 358699 |
| 46 | Ga0562379_0350 | 3300056790 | Bacteria | 110432 |
| 47 | Ga0562379_0532 | 3300056790 | Bacteria | 73625 |
| 48 | Ga0562378_0016 | 3300056814 | Bacteria | 880040 |
| 49 | Ga0562378_0277 | 3300056814 | Bacteria | 112362 |
| 50 | Ga0562378_0688 | 3300056814 | Bacteria | 49514 |
| 51 | Ga0562376_0060 | 3300056857 | Bacteria | 279520 |
| 52 | Ga0562376_0975 | 3300056857 | Bacteria | 44193 |
| 53 | Ga0562374_0018 | 3300057007 | Bacteria | 1182001 |
| 54 | Ga0466726_064906 | 3300042619 | Bacteria | 72682 |
| 55 | Ga0123355_10009170 | 3300009826 | Bacteria | 15011 |
| 56 | Ga0160464_100035 | 3300012805 | Unclassified | 169690 |
| 57 | Ga0160456_102994 | 3300012820 | Bacteria | 2760 |
| 58 | Ga0160436_1005300 | 3300012861 | Bacteria | 3040 |
| 59 | Ga0265387_1000123 | 3300024582 | Bacteria | 15899 |
| 60 | Ga0466699_200014 | 3300042597 | Bacteria | 1269 |
| 61 | Ga0466719_031992 | 3300042606 | Bacteria | 3009 |
| 62 | Ga0466730_003525 | 3300042625 | Bacteria | 46259 |
| 63 | Ga0466702_181339 | 3300042635 | Bacteria | 1069 |
| 64 | FGTW_contig31100 | 2065487013 | Unclassified | 4908 |
| 65 | HBC_ctgsDRAFT_1001000 | 3300000333 | Unclassified | 6142 |
| 66 | JGI24703J35330_11747790 | 3300002501 | Bacteria | 8284 |
| 67 | JGI24699J35502_11064257 | 3300002509 | Bacteria | 1772 |
| 68 | Ga0068305_10251110 | 3300005083 | Bacteria | 2456 |
| 69 | Ga0074278_114052 | 3300005721 | Unclassified | 19660 |
| 70 | Ga0104040_1144832 | 3300007149 | Bacteria | 1691 |
| 71 | Ga0530661_004299 | 3300056564 | Bacteria | 4384 |
| 72 | Ga0530661_004951 | 3300056564 | Unclassified | 3986 |
| 73 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 74 | Ga0562379_0486 | 3300056790 | Bacteria | 80046 |
| 75 | Ga0562378_1162 | 3300056814 | Unclassified | 31022 |
| 76 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 77 | Ga0562377_0017 | 3300056842 | Bacteria | 1143096 |
| 78 | Ga0562376_6102 | 3300056857 | Unclassified | 6204 |
| 79 | Ga0562374_0037 | 3300057007 | Bacteria | 679104 |
| 80 | Ga0123355_10073768 | 3300009826 | Bacteria | 5467 |
| 81 | Ga0160447_100857 | 3300012849 | Unclassified | 13075 |
| 82 | Ga0247289_0046 | 3300035363 | Bacteria | 38103 |
| 83 | Ga0247290_01399 | 3300035364 | Unclassified | 2775 |
| 84 | Ga0466706_050728 | 3300042599 | Bacteria | 5655 |
| 85 | Ga0466734_016385 | 3300042623 | Bacteria | 3328 |
| 86 | Ga0466730_093203 | 3300042625 | Bacteria | 81298 |
| 87 | FGTW_contig06729 | 2065487013 | Bacteria | 2196 |
| 88 | HBC_ctgsDRAFT_1000284 | 3300000333 | Bacteria | 11790 |
| 89 | Ga0068302_10026308 | 3300005071 | Bacteria | 22231 |
| 90 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 91 | Ga0562379_0032 | 3300056790 | Bacteria | 747488 |
| 92 | Ga0562376_0297 | 3300056857 | Bacteria | 97822 |
| 93 | Ga0562376_0430 | 3300056857 | Unclassified | 78789 |
| 94 | Ga0562374_0420 | 3300057007 | Bacteria | 74593 |
| 95 | Ga0160440_100085 | 3300012815 | Bacteria | 111297 |
| 96 | Ga0316159_10337 | 3300030930 | Bacteria | 7496 |
| 97 | Ga0466691_225358 | 3300042593 | Bacteria | 4150 |
| 98 | Ga0466701_045007 | 3300042598 | Bacteria | 3715 |
| 99 | Ga0466702_222137 | 3300042635 | Bacteria | 1740 |
| 100 | Ga0466709_230827 | 3300042648 | Bacteria | 200320 |
| 101 | CVPL010L_1000206 | 3300002932 | Unclassified | 20904 |
| 102 | Ga0063521_1005870 | 3300003973 | Unclassified | 2906 |
| 103 | Ga0562379_0727 | 3300056790 | Bacteria | 55289 |
| 104 | Ga0562378_1008 | 3300056814 | Bacteria | 35411 |
| 105 | Ga0562377_0088 | 3300056842 | Bacteria | 335236 |
| 106 | Ga0562377_0114 | 3300056842 | Unclassified | 258244 |
| 107 | Ga0562377_0148 | 3300056842 | Bacteria | 202186 |
| 108 | Ga0562374_0155 | 3300057007 | Unclassified | 160671 |
| 109 | Ga0562374_1215 | 3300057007 | Bacteria | 32164 |
| 110 | Ga0466718_014280 | 3300042617 | Bacteria | 1403 |
| 111 | Ga0160467_100026 | 3300012829 | Bacteria | 283547 |
| 112 | Ga0160447_106470 | 3300012849 | Unclassified | 3091 |
| 113 | Ga0265387_1000060 | 3300024582 | Bacteria | 33940 |
| 114 | Ga0247289_0040 | 3300035363 | Bacteria | 40564 |
| 115 | Ga0466706_096445 | 3300042599 | Bacteria | 1067 |
| 116 | Ga0466707_161995 | 3300042601 | Bacteria | 13728 |
| 117 | Ga0466713_093617 | 3300042602 | Bacteria | 168801 |
| 118 | Ga0466703_305676 | 3300042636 | Unclassified | 1403 |
| 119 | Ga0466727_142534 | 3300042655 | Bacteria | 55597 |
| 120 | DPOL_contig19967 | 2035918003 | Bacteria | 58291 |
| 121 | HBC_ctgsDRAFT_1047378 | 3300000333 | Bacteria | 1047 |
| 122 | Ga0072941_1047447 | 3300005201 | Bacteria | 88821 |
| 123 | Ga0105005_1032064 | 3300007505 | Bacteria | 4404 |
| 124 | Ga0562378_1651 | 3300056814 | Bacteria | 22946 |
| 125 | Ga0562377_0060 | 3300056842 | Bacteria | 477040 |
| 126 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 127 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 128 | Ga0562375_0346 | 3300056856 | Bacteria | 110366 |
| 129 | Ga0160471_102750 | 3300012812 | Bacteria | 2830 |
| 130 | Ga0160455_101807 | 3300012837 | Bacteria | 5488 |
| 131 | Ga0255572_1000024 | 3300026175 | Bacteria | 128087 |
| 132 | Ga0466706_173366 | 3300042599 | Bacteria | 2106 |
| 133 | Ga0466730_002890 | 3300042625 | Bacteria | 43265 |
| 134 | Ga0466730_012981 | 3300042625 | Bacteria | 11796 |
| 135 | Ga0466724_12489 | 3300042649 | Bacteria | 79172 |
| 136 | FGTW_contig02352 | 2065487013 | Unclassified | 3529 |
| 137 | FGTW_contig31139 | 2065487013 | Bacteria | 5952 |
| 138 | AustNasuHG_c1003337 | 3300000089 | Bacteria | 5793 |
| 139 | HBC_ctgsDRAFT_1018088 | 3300000333 | Bacteria | 1717 |
| 140 | HBC_ctgsDRAFT_1037116 | 3300000333 | Bacteria | 1195 |
| 141 | Ga0072940_1581866 | 3300005200 | Bacteria | 1505 |
| 142 | Ga0074278_140737 | 3300005721 | Bacteria | 11068 |
| 143 | Ga0104041_1001102 | 3300007106 | Unclassified | 9557 |
| 144 | Ga0104147_1019490 | 3300007224 | Bacteria | 9641 |
| 145 | Ga0530661_000077 | 3300056564 | Unclassified | 91600 |
| 146 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 147 | Ga0562379_1998 | 3300056790 | Unclassified | 19317 |
| 148 | Ga0562377_0641 | 3300056842 | Bacteria | 52294 |
| 149 | Ga0562375_0009 | 3300056856 | Bacteria | 1746158 |
| 150 | Ga0562376_2083 | 3300056857 | Bacteria | 25393 |
| 151 | Ga0562374_2420 | 3300057007 | Bacteria | 16359 |
| 152 | Ga0123355_10437019 | 3300009826 | Bacteria | 1660 |
| 153 | Ga0466706_048066 | 3300042599 | Bacteria | 9274 |
| 154 | Ga0466713_139973 | 3300042602 | Bacteria | 49584 |
| 155 | Ga0466730_035536 | 3300042625 | Unclassified | 3012 |
| 156 | HBC_ctgsDRAFT_1007235 | 3300000333 | Unclassified | 2610 |
| 157 | HBC_ctgsDRAFT_1021938 | 3300000333 | Bacteria | 1562 |
| 158 | CVPL010L_1000358 | 3300002932 | Bacteria | 22277 |
| 159 | CVPL010L_1001670 | 3300002932 | Unclassified | 3070 |
| 160 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02540 | NAD_synthase | NAD synthase | 72 | 314 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.