Protein Family IF10428

Metagenome Isolate
295 Members
202 Samples
154 Scaffolds
324.9 Avg Length

🧬 Representative Sequence

ID
3300056790|Ga0562379_0258|Ga0562379_0258_69482_70591
Length
369 aa
Sequence
MTEKQTINKLQRTLTKRFLTLTSNFAFSDCVVLLTRMPKKGAVTYLTEERISLEIQLTQNDDISLLLGSHDKHIKVIEDATQTTIHTRGEMIQITGEKVAAEKAQSVIHALQELIKRGINISTPDVITALNMANKGNLDYFTDMYEEEIIKDRNGKPIRAKNAGQKKYIEAIRTHDVVFGVGPAGTGKTFLAVVMAIAALKKGQVQKIILTRPAVEAGENLGFLPGDLKEKVDPYLRPVYDALYQIFGMDHTNRLMERGVIEIAPLAYMRGRTLEDAFVILDEAQNTTIAQMKMFLTRLGFNSKMIVNGDTSQIDLPKGTTSGLVHAQRALEAIPKIAFAHFEAGDVVRHPVVADIIRAYEESDSKEKR

πŸ“Š Sample Types

Isolate 47.8%
Metagenome 52.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 29.4%
Termitidae 15.5%
Apidae 14.4%
Drosophilidae 11.8%
Halictidae 4.3%
Tenebrionidae 4.3%
Kalotermitidae 3.7%
Scarabaeidae 3.2%
Rhinotermitidae 1.6%
Termopsidae 1.6%
Dytiscidae 1.1%
Blattidae 1.1%
Passalidae 1.1%
Formicidae 1.1%
Gomphidae 0.5%
Calliphoridae 0.5%
Vespidae 0.5%
Bombycidae 0.5%
Hodotermitidae 0.5%
Libellulidae 0.5%
Cerambycidae 0.5%
Hydrophilidae 0.5%
Elmidae 0.5%
Curculionidae 0.5%
Noctuidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 284
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
2 2595698195 Melissococcus plutonius 119 Isolate Apidae
3 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
4 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
5 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
6 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
7 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
8 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
9 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
10 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
11 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
12 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
13 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 8007223943 Enterococcus sp. MSG2901 Isolate
16 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
17 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
18 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
19 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
29 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
30 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
31 2595698193 Melissococcus plutonius B5 Isolate Apidae
32 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
33 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
34 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
35 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
36 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
37 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
38 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
39 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
40 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
41 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
42 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
43 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
44 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
45 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
46 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
47 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
48 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
49 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
50 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
51 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
52 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
53 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
54 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
55 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
56 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
57 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
58 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
59 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
60 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
61 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
62 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
63 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
64 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
65 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
66 2595698199 Melissococcus plutonius 60 Isolate Apidae
67 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
68 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
69 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
70 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
71 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
72 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
73 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
74 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
75 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
76 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
77 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
78 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
79 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
80 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
81 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
82 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
83 8007237282 Enterococcus sp. DIV0212c Isolate
84 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
85 8017489919 Lactobacillus brevis EF Isolate Unclassified
86 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
87 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
88 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
89 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
90 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
91 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
92 3004719924 Lactobacillus sp. W8174 Isolate Apidae
93 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
94 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
95 2595698197 Melissococcus plutonius H6 Isolate Apidae
96 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
97 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
98 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
99 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
100 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
101 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
102 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
103 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
104 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
105 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
106 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
107 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
108 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
109 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
110 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
111 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
112 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
113 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
114 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
115 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
116 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
117 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
118 8114555646 Enterococcus sp. DIV1094 Isolate
119 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
120 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
121 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
122 2627853628 Melissococcus plutonius 82 Isolate Apidae
123 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
124 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
125 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
126 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
127 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
128 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
129 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
130 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
131 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
132 2820426531 Unclassified Firmicutes Lab288P3bin45 Isolate Unclassified
133 2864836148 Arcicella rosea S00070 Isolate Elmidae
134 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
135 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
136 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
137 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
138 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
139 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
140 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
141 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
142 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
143 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
144 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
145 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
146 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
147 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
148 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
149 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
150 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
151 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
152 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
153 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
154 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
155 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
156 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
157 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
158 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
159 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
160 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
161 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
162 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
163 2595698198 Melissococcus plutonius L9 Isolate Apidae
164 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
165 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
166 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
167 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
168 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
169 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
170 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
171 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
172 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
173 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
174 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
175 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
176 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
177 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
178 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
179 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
180 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
181 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
182 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
183 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
184 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
185 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
186 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
187 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
188 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
189 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
190 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
191 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
192 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
193 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
194 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
195 8108568626 Enterococcus sp. DIV1094 Isolate
196 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
197 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
198 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
199 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
200 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
201 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
202 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_245950 3300042611 Bacteria 1872
2 Ga0466733_166009 3300042659 Bacteria 20223
3 Ga0466733_222756 3300042659 Bacteria 1274
4 Ga0562378_0003 3300056814 Bacteria 2474150
5 Ga0466701_085341 3300042598 Bacteria 1516
6 Ga0466706_126911 3300042599 Bacteria 18302
7 Ga0466706_260770 3300042599 Bacteria 2089
8 Ga0466722_166910 3300042609 Bacteria 8418
9 Ga0466715_136743 3300042616 Bacteria 15268
10 Ga0466656_023402 3300042550 Bacteria 2875
11 Ga0466691_111513 3300042593 Bacteria 9991
12 Ga0466696_362060 3300042596 Bacteria 3900
13 Ga0123355_10006360 3300009826 Bacteria 17483
14 Ga0123355_10184510 3300009826 Bacteria 3088
15 Ga0123356_10228334 3300010049 Bacteria 1924
16 2227080774 2225789004 Bacteria 191256
17 HBC_ctgsDRAFT_1007441 3300000333 Unclassified 2583
18 JGI24703J35330_11747925 3300002501 Bacteria 9133
19 Ga0562374_0037 3300057007 Bacteria 679104
20 Ga0562374_1563 3300057007 Bacteria 25967
21 Ga0466702_444147 3300042635 Bacteria 77354
22 Ga0466713_156550 3300042602 Bacteria 26644
23 Ga0466714_032525 3300042603 Bacteria 1671
24 Ga0466714_058960 3300042603 Bacteria 1364
25 Ga0466717_014730 3300042604 Bacteria 2331
26 Ga0466698_235054 3300042610 Bacteria 6737
27 Ga0123355_10266700 3300009826 Bacteria 2386
28 Ga0123356_10041583 3300010049 Bacteria 4282
29 Ga0123356_10052190 3300010049 Bacteria 3804
30 Ga0123356_10623786 3300010049 Bacteria 1244
31 AglaG_contig19080 2084038013 Bacteria 11552
32 HBC_ctgsDRAFT_1009594 3300000333 Bacteria 2304
33 JGI24695J34938_10045228 3300002450 Bacteria 1954
34 Ga0072941_1013232 3300005201 Bacteria 98941
35 Ga0562379_0009 3300056790 Bacteria 1927879
36 Ga0562379_0390 3300056790 Bacteria 99119
37 Ga0562379_0691 3300056790 Bacteria 57361
38 Ga0562378_0004 3300056814 Bacteria 2423881
39 Ga0562375_0058 3300056856 Bacteria 444736
40 Ga0562375_0076 3300056856 Bacteria 327447
41 Ga0562374_0725 3300057007 Bacteria 48750
42 Ga0562374_2307 3300057007 Unclassified 17311
43 Ga0466729_219538 3300042621 Bacteria 1656
44 Ga0466724_24238 3300042649 Bacteria 22794
45 Ga0466706_102864 3300042599 Unclassified 1262
46 Ga0466706_145545 3300042599 Bacteria 24377
47 Ga0466713_093617 3300042602 Bacteria 168801
48 Ga0466714_001992 3300042603 Bacteria 7072
49 Ga0466697_048523 3300042611 Bacteria 1637
50 Ga0466728_388833 3300042620 Bacteria 1084
51 Ga0415639_018935 3300038395 Bacteria 3817
52 Ga0123355_10004922 3300009826 Bacteria 19444
53 Ga0123355_10060561 3300009826 Bacteria 6113
54 Ga0123355_10116829 3300009826 Bacteria 4150
55 Ga0123354_10059934 3300010882 Bacteria 5639
56 JGI24703J35330_11737512 3300002501 Bacteria 3117
57 JGI24703J35330_11748863 3300002501 Bacteria 60401
58 Ga0466697_279123 3300042611 Bacteria 2973
59 Ga0562377_1775 3300056842 Bacteria 19874
60 Ga0562375_0013 3300056856 Bacteria 1229523
61 Ga0562374_0008 3300057007 Bacteria 1999653
62 Ga0466707_082502 3300042601 Bacteria 39523
63 Ga0123355_10000304 3300009826 Bacteria 63149
64 Ga0123355_10158773 3300009826 Bacteria 3413
65 Ga0123353_10062751 3300010167 Unclassified 5960
66 Ga0123353_10800567 3300010167 Bacteria 1301
67 Ga0123354_10088389 3300010882 Bacteria 4309
68 IMNBL1DRAFT_c0001375 3300000062 Bacteria 18278
69 HBC_ctgsDRAFT_1009725 3300000333 Unclassified 2291
70 JGI24703J35330_11748754 3300002501 Bacteria 31354
71 CVPL010L_1001214 3300002932 Unclassified 8097
72 Ga0562377_0539 3300056842 Bacteria 59504
73 Ga0466735_210554 3300042624 Bacteria 8535
74 Ga0466706_042144 3300042599 Bacteria 10225
75 Ga0466706_143510 3300042599 Bacteria 7821
76 Ga0466700_417079 3300042600 Bacteria 69635
77 Ga0466715_507994 3300042616 Bacteria 16581
78 Ga0466656_048102 3300042550 Bacteria 2562
79 Ga0123355_10001760 3300009826 Bacteria 30282
80 Ga0123355_10046860 3300009826 Bacteria 7029
81 Ga0123355_10131747 3300009826 Bacteria 3851
82 Ga0123355_10163328 3300009826 Bacteria 3349
83 Ga0123355_10220889 3300009826 Bacteria 2725
84 Ga0123354_10000005 3300010882 Bacteria 283385
85 Ga0123354_10260857 3300010882 Bacteria 1731
86 HBC_ctgsDRAFT_1007294 3300000333 Bacteria 2602
87 JGI24702J35022_10091595 3300002462 Bacteria 1655
88 JGI24703J35330_11748870 3300002501 Bacteria 105930
89 Ga0052191_101272 3300003097 Bacteria 4361
90 Ga0074278_152631 3300005721 Bacteria 16819
91 Ga0466705_061829 3300042612 Bacteria 4351
92 Ga0530661_000001 3300056564 Bacteria 684835
93 Ga0562379_0258 3300056790 Bacteria 138793
94 Ga0562377_0019 3300056842 Bacteria 1067000
95 Ga0466731_074953 3300042622 Bacteria 12668
96 Ga0466734_122698 3300042623 Bacteria 1514
97 Ga0466721_313890 3300042608 Bacteria 1304
98 Ga0466715_104811 3300042616 Bacteria 85178
99 Ga0466715_526118 3300042616 Bacteria 10134
100 Ga0466696_119294 3300042596 Bacteria 103684
101 Ga0123355_10000197 3300009826 Bacteria 74985
102 Ga0123355_10000398 3300009826 Bacteria 56583
103 Ga0123355_10007073 3300009826 Bacteria 16724
104 Ga0123355_10079340 3300009826 Bacteria 5243
105 Ga0123356_10014207 3300010049 Bacteria 7660
106 Ga0123356_10026319 3300010049 Bacteria 5463
107 Ga0123353_10048584 3300010167 Bacteria 6756
108 Ga0123353_10714049 3300010167 Bacteria 1404
109 Ga0160464_100300 3300012805 Bacteria 43427
110 JGI24703J35330_11659952 3300002501 Bacteria 1651
111 Ga0466697_268564 3300042611 Bacteria 7551
112 Ga0562379_0005 3300056790 Bacteria 2649770
113 Ga0562379_0273 3300056790 Bacteria 133845
114 Ga0562378_0279 3300056814 Bacteria 111869
115 Ga0562377_0063 3300056842 Bacteria 461046
116 Ga0562376_1355 3300056857 Bacteria 34916
117 Ga0562374_0006 3300057007 Bacteria 2178283
118 Ga0466731_325219 3300042622 Unclassified 1129
119 Ga0466734_028885 3300042623 Bacteria 8652
120 Ga0466727_251819 3300042655 Bacteria 21791
121 Ga0466706_131104 3300042599 Bacteria 1692
122 Ga0466717_035477 3300042604 Bacteria 2903
123 Ga0466719_448741 3300042606 Bacteria 6315
124 Ga0466722_111932 3300042609 Bacteria 3587
125 Ga0466710_420998 3300042613 Unclassified 2373
126 Ga0466723_163769 3300042618 Bacteria 7261
127 Ga0466693_221142 3300042592 Bacteria 1408
128 Ga0123355_10000655 3300009826 Bacteria 46923
129 Ga0123355_10157850 3300009826 Bacteria 3426
130 Ga0123356_10037042 3300010049 Bacteria 4552
131 Ga0123356_10440301 3300010049 Bacteria 1449
132 Ga0123354_10086797 3300010882 Bacteria 4370
133 IMNBL1DRAFT_c0022113 3300000062 Bacteria 2525
134 JGI24696J40584_12951725 3300002834 Bacteria 2272
135 Ga0562379_0044 3300056790 Bacteria 597058
136 Ga0562377_0106 3300056842 Bacteria 268063
137 Ga0466735_079367 3300042624 Bacteria 15650
138 Ga0466735_186761 3300042624 Unclassified 1849
139 Ga0466725_334262 3300042654 Bacteria 3979
140 Ga0466706_098812 3300042599 Bacteria 5702
141 Ga0466717_041446 3300042604 Bacteria 3723
142 Ga0466715_515269 3300042616 Bacteria 14969
143 Ga0466718_026832 3300042617 Bacteria 2607
144 Ga0415639_149871 3300038395 Bacteria 4189
145 Ga0415639_154225 3300038395 Bacteria 5751
146 Ga0123355_10031547 3300009826 Bacteria 8597
147 Ga0123356_10315893 3300010049 Bacteria 1673
148 JGI24703J35330_11748746 3300002501 Bacteria 30877
149 JGI24705J35276_12233675 3300002504 Unclassified 4984
150 JGI24705J35276_12235654 3300002504 Bacteria 6782
151 JGI24700J35501_10930890 3300002508 Bacteria 34676
152 Ga0063521_1009068 3300003973 Unclassified 2377
153 Ga0068302_10166889 3300005071 Bacteria 3642
154 Ga0123357_10000254 3300009784 Bacteria 51081

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_515269 Ga0466715_515269_7590_8474 294
2 3300042624 Ga0466735_186761 Ga0466735_186761_324_1223 299
3 3300002501 JGI24703J35330_11737512 JGI24703J35330_117375123 300
4 3300005201 Ga0072941_1013232 Ga0072941_101323213 303
5 3300042599 Ga0466706_098812 Ga0466706_098812_3774_4694 306
6 3300010167 Ga0123353_10800567 Ga0123353_108005672 307
7 3300042600 Ga0466700_417079 Ga0466700_417079_48520_49446 308
8 3300010882 Ga0123354_10000005 Ga0123354_1000000575 309
9 3300042550 Ga0466656_023402 Ga0466656_023402_1301_2287 309
10 iso_pr_bacteria 642555127 642610526 309
11 3300042599 Ga0466706_145545 Ga0466706_145545_15317_16249 310
12 3300042599 Ga0466706_126911 Ga0466706_126911_1575_2510 311
13 3300002834 JGI24696J40584_12951725 JGI24696J40584_129517252 312
14 3300010167 Ga0123353_10714049 Ga0123353_107140492 312
15 3300042616 Ga0466715_104811 Ga0466715_104811_45290_46228 312
16 iso_pr_bacteria 2820176377 2820178020 312
17 3300042599 Ga0466706_102864 Ga0466706_102864_254_1195 313
18 3300042612 Ga0466705_061829 Ga0466705_061829_1273_2214 313
19 3300042593 Ga0466691_111513 Ga0466691_111513_1293_2258 314
20 3300042601 Ga0466707_082502 Ga0466707_082502_28059_29003 314
21 3300042599 Ga0466706_042144 Ga0466706_042144_5572_6570 315
22 3300042659 Ga0466733_222756 Ga0466733_222756_203_1150 315
23 3300010049 Ga0123356_10014207 Ga0123356_100142072 316
24 3300010882 Ga0123354_10059934 Ga0123354_100599344 316
25 3300042596 Ga0466696_362060 Ga0466696_362060_2656_3606 316
26 3300042611 Ga0466697_268564 Ga0466697_268564_5652_6602 316
27 3300042623 Ga0466734_122698 Ga0466734_122698_217_1167 316
28 iso_pr_bacteria 2684622911 2686073752 316
29 iso_pr_bacteria 2684622913 2686077344 316
30 iso_pr_bacteria 2758568513 2760265722 316
31 iso_pr_bacteria 2758568515 2760269565 316
32 iso_pr_bacteria 2758568558 2760423523 316
33 iso_pr_bacteria 2877513988 2877515007 316
34 iso_pr_bacteria 2900804455 2900805238 316
35 iso_pr_bacteria 2961515617 2961516531 316
36 iso_pr_bacteria 3004719924 3004720293 316
37 iso_pr_bacteria 8017462664 8017463777 316
38 2225789004 2227080774 2227451557 317
39 3300000333 HBC_ctgsDRAFT_1007441 HBC_ctgsDRAFT_10074413 317
40 3300003097 Ga0052191_101272 Ga0052191_1012723 317
41 3300005721 Ga0074278_152631 Ga0074278_1526315 317
42 3300042613 Ga0466710_420998 Ga0466710_420998_691_1644 317
43 3300042616 Ga0466715_526118 Ga0466715_526118_2277_3230 317
44 3300042623 Ga0466734_028885 Ga0466734_028885_3348_4301 317
45 3300042655 Ga0466727_251819 Ga0466727_251819_9802_10755 317
46 iso_pr_bacteria 2820236043 2820237278 317
47 iso_pr_bacteria 2820426531 2820426844 317
48 iso_pr_bacteria 2850695442 2850696194 317
49 3300002450 JGI24695J34938_10045228 JGI24695J34938_100452282 318
50 3300003973 Ga0063521_1009068 Ga0063521_10090682 318
51 3300010167 Ga0123353_10048584 Ga0123353_100485842 318
52 3300042598 Ga0466701_085341 Ga0466701_085341_357_1313 318
53 3300042599 Ga0466706_143510 Ga0466706_143510_1552_2508 318
54 3300042624 Ga0466735_079367 Ga0466735_079367_13935_14891 318
55 3300056564 Ga0530661_000001 Ga0530661_000001_197224_198180 318
56 iso_pr_bacteria 2645727721 2646684430 318
57 iso_pr_bacteria 2684622914 2686079199 318
58 iso_pr_bacteria 2758568501 2760245295 318
59 iso_pr_bacteria 2758568502 2760246908 318
60 iso_pr_bacteria 2758568503 2760248570 318
61 iso_pr_bacteria 2758568504 2760250232 318
62 iso_pr_bacteria 2758568511 2760262130 318
63 iso_pr_bacteria 2758568512 2760263876 318
64 iso_pr_bacteria 2758568514 2760267698 318
65 iso_pr_bacteria 2814123166 2815022437 318
66 iso_pr_bacteria 2851410423 2851411373 318
67 iso_pr_bacteria 2979949929 2979950874 318
68 iso_pr_bacteria 8017536074 8017537161 318
69 3300000333 HBC_ctgsDRAFT_1007294 HBC_ctgsDRAFT_10072943 319
70 3300000333 HBC_ctgsDRAFT_1009594 HBC_ctgsDRAFT_10095943 319
71 3300000333 HBC_ctgsDRAFT_1009725 HBC_ctgsDRAFT_10097253 319
72 3300002462 JGI24702J35022_10091595 JGI24702J35022_100915952 319
73 3300010049 Ga0123356_10228334 Ga0123356_102283342 319
74 3300042606 Ga0466719_448741 Ga0466719_448741_3768_4727 319
75 3300042617 Ga0466718_026832 Ga0466718_026832_1163_2122 319
76 3300042649 Ga0466724_24238 Ga0466724_24238_2432_3391 319
77 3300056814 Ga0562378_0003 Ga0562378_0003_1533349_1534308 319
78 3300057007 Ga0562374_0006 Ga0562374_0006_2118814_2119773 319
79 3300057007 Ga0562374_0008 Ga0562374_0008_1955012_1955971 319
80 iso_pr_bacteria 2775507073 2777017814 319
81 iso_pr_bacteria 2820565217 2820566341 319
82 iso_pr_bacteria 2873581347 2873583949 319
83 iso_pr_bacteria 2873632256 2873633555 319
84 iso_pr_bacteria 8017458139 8017458806 319
85 3300012805 Ga0160464_100300 Ga0160464_10030029 320
86 3300042599 Ga0466706_131104 Ga0466706_131104_366_1343 320
87 3300042604 Ga0466717_035477 Ga0466717_035477_844_1806 320
88 iso_pr_bacteria 2595698190 2596206142 320
89 iso_pr_bacteria 2595698193 2596211553 320
90 iso_pr_bacteria 2595698194 2596213274 320
91 iso_pr_bacteria 2595698195 2596215170 320
92 iso_pr_bacteria 2595698196 2596217054 320
93 iso_pr_bacteria 2595698197 2596218892 320
94 iso_pr_bacteria 2595698198 2596220723 320
95 iso_pr_bacteria 2595698199 2596222535 320
96 iso_pr_bacteria 2627853628 2628280856 320
97 iso_pr_bacteria 2785510748 2785747303 320
98 iso_pr_bacteria 2799112220 2799191505 320
99 iso_pr_bacteria 2799112229 2799228697 320
100 iso_pr_bacteria 2820344559 2820346236 320
101 iso_pr_bacteria 2864836148 2864840509 320
102 iso_pr_bacteria 2881375749 2881376137 320
103 iso_pr_bacteria 2882334426 2882334595 320
104 iso_pr_bacteria 650716050 650845453 320
105 iso_pr_bacteria 8012939035 8012939445 320
106 3300010049 Ga0123356_10623786 Ga0123356_106237862 321
107 3300042611 Ga0466697_279123 Ga0466697_279123_1938_2903 321
108 3300042621 Ga0466729_219538 Ga0466729_219538_621_1586 321
109 3300056856 Ga0562375_0013 Ga0562375_0013_381915_382880 321
110 iso_pr_bacteria 2731957677 2732686094 321
111 iso_pr_bacteria 2852431164 2852432632 321
112 iso_pr_bacteria 2881902429 2881903129 321
113 iso_pr_bacteria 2905310146 2905311411 321
114 iso_pr_bacteria 2956928875 2956929142 321
115 iso_pr_bacteria 8002299145 8002302161 321
116 3300002501 JGI24703J35330_11748863 JGI24703J35330_1174886342 322
117 3300005071 Ga0068302_10166889 Ga0068302_101668894 322
118 3300010882 Ga0123354_10260857 Ga0123354_102608572 322
119 3300042550 Ga0466656_048102 Ga0466656_048102_1215_2183 322
120 3300042592 Ga0466693_221142 Ga0466693_221142_415_1383 322
121 3300042602 Ga0466713_093617 Ga0466713_093617_153579_154547 322
122 3300042609 Ga0466722_166910 Ga0466722_166910_962_1930 322
123 3300042610 Ga0466698_235054 Ga0466698_235054_5710_6678 322
124 3300056790 Ga0562379_0009 Ga0562379_0009_1161957_1162925 322
125 3300056790 Ga0562379_0044 Ga0562379_0044_485606_486574 322
126 3300056790 Ga0562379_0390 Ga0562379_0390_38685_39653 322
127 3300056790 Ga0562379_0691 Ga0562379_0691_28445_29413 322
128 3300056842 Ga0562377_0539 Ga0562377_0539_39794_40762 322
129 3300057007 Ga0562374_2307 Ga0562374_2307_13213_14181 322
130 iso_pr_bacteria 2558860143 2559000738 322
131 iso_pr_bacteria 2675903377 2677723529 322
132 iso_pr_bacteria 2820393573 2820396662 322
133 iso_pr_bacteria 2820702360 2820704714 322
134 iso_pr_bacteria 2878857142 2878859583 322
135 iso_pr_bacteria 8002304686 8002305877 322
136 iso_pr_bacteria 8018798118 8018800081 322
137 iso_pr_bacteria 8018802046 8018804886 322
138 iso_pr_bacteria 8108576847 8108577263 322
139 iso_pr_bacteria 8114537524 8114538257 322
140 iso_pr_bacteria 8114541043 8114541540 322
141 iso_pr_bacteria 8114549044 8114549460 322
142 3300002501 JGI24703J35330_11659952 JGI24703J35330_116599523 323
143 3300010049 Ga0123356_10440301 Ga0123356_104403012 323
144 3300042603 Ga0466714_058960 Ga0466714_058960_199_1200 323
145 3300042624 Ga0466735_210554 Ga0466735_210554_2422_3393 323
146 3300042659 Ga0466733_166009 Ga0466733_166009_5599_6570 323
147 3300056790 Ga0562379_0005 Ga0562379_0005_1653613_1654584 323
148 3300056857 Ga0562376_1355 Ga0562376_1355_10906_11877 323
149 3300057007 Ga0562374_1563 Ga0562374_1563_14706_15677 323
150 iso_pr_bacteria 2597490293 2598962663 323
151 iso_pr_bacteria 2690315820 2691202456 323
152 iso_pr_bacteria 2820459456 2820459928 323
153 iso_pr_bacteria 2825804107 2825804259 323
154 iso_pr_bacteria 2937236879 2937238665 323
155 iso_pr_bacteria 2957623355 2957626030 323
156 iso_pr_bacteria 2960772748 2960774639 323
157 iso_pr_bacteria 2964739456 2964741986 323
158 iso_pr_bacteria 2964749277 2964749355 323
159 iso_pr_bacteria 2964765680 2964766050 323
160 iso_pr_bacteria 2964775400 2964775474 323
161 iso_pr_bacteria 2964778705 2964778783 323
162 iso_pr_bacteria 2967802344 2967804920 323
163 iso_pr_bacteria 2967825073 2967825153 323
164 iso_pr_bacteria 2970199020 2970201519 323
165 iso_pr_bacteria 2970225615 2970228082 323
166 iso_pr_bacteria 2970254690 2970256933 323
167 iso_pr_bacteria 2977592972 2977595187 323
168 iso_pr_bacteria 2977596371 2977597485 323
169 iso_pr_bacteria 2977622177 2977623825 323
170 iso_pr_bacteria 2977628635 2977628713 323
171 iso_pr_bacteria 2977635137 2977635216 323
172 iso_pr_bacteria 2977653127 2977655789 323
173 iso_pr_bacteria 8007223943 8007225868 323
174 iso_pr_bacteria 8038268975 8038269215 323
175 iso_pr_bacteria 8108568626 8108568669 323
176 iso_pr_bacteria 8114555646 8114555689 323
177 3300002501 JGI24703J35330_11748746 JGI24703J35330_117487465 324
178 3300010167 Ga0123353_10062751 Ga0123353_100627515 324
179 3300042609 Ga0466722_111932 Ga0466722_111932_1696_2670 324
180 iso_pr_bacteria 2585428141 2588054276 324
181 iso_pr_bacteria 2740892556 2743947289 324
182 iso_pr_bacteria 2923762712 2923763465 324
183 iso_pr_bacteria 2936628749 2936629001 324
184 iso_pr_bacteria 8018794549 8018796211 324
185 iso_pr_bacteria 8066790652 8066791236 324
186 iso_pr_bacteria 8066792404 8066792949 324
187 iso_pr_bacteria 8066794103 8066795290 324
188 iso_pr_bacteria 8066795793 8066795944 324
189 iso_pr_bacteria 8066797744 8066798296 324
190 iso_pr_bacteria 8066799369 8066799895 324
191 iso_pr_bacteria 8077780672 8077782634 324
192 3300002932 CVPL010L_1001214 CVPL010L_10012148 325
193 3300009826 Ga0123355_10266700 Ga0123355_102667003 325
194 3300042618 Ga0466723_163769 Ga0466723_163769_1390_2367 325
195 3300042620 Ga0466728_388833 Ga0466728_388833_95_1072 325
196 3300042622 Ga0466731_325219 Ga0466731_325219_46_1023 325
197 iso_pr_bacteria 2576861670 2579164914 325
198 iso_pr_bacteria 2718218475 2721608225 325
199 iso_pr_bacteria 2728369362 2730151099 325
200 iso_pr_bacteria 2770939318 2771020994 325
201 iso_pr_bacteria 8007211731 8007213379 325
202 iso_pr_bacteria 8007215774 8007218431 325
203 iso_pr_bacteria 8007220153 8007222885 325
204 iso_pr_bacteria 8114544644 8114544799 325
205 3300000062 IMNBL1DRAFT_c0001375 IMNBL1DRAFT_000137513 326
206 3300009826 Ga0123355_10001760 Ga0123355_100017602 326
207 iso_pr_bacteria 2820382897 2820384887 326
208 iso_pr_bacteria 2820615445 2820615912 326
209 iso_pr_bacteria 2877522083 2877522720 326
210 iso_pr_bacteria 2940218408 2940220548 326
211 iso_pr_bacteria 2940261461 2940263595 326
212 3300000062 IMNBL1DRAFT_c0022113 IMNBL1DRAFT_00221133 327
213 3300002501 JGI24703J35330_11748870 JGI24703J35330_1174887014 327
214 3300009826 Ga0123355_10000304 Ga0123355_1000030430 327
215 3300056842 Ga0562377_0019 Ga0562377_0019_764339_765322 327
216 3300056842 Ga0562377_0106 Ga0562377_0106_57265_58248 327
217 3300057007 Ga0562374_0725 Ga0562374_0725_27072_28055 327
218 iso_pr_bacteria 2820481688 2820481978 327
219 3300009826 Ga0123355_10184510 Ga0123355_101845102 328
220 3300010049 Ga0123356_10052190 Ga0123356_100521902 328
221 3300042599 Ga0466706_260770 Ga0466706_260770_274_1260 328
222 3300042603 Ga0466714_032525 Ga0466714_032525_93_1079 328
223 3300042616 Ga0466715_136743 Ga0466715_136743_917_1936 328
224 3300042616 Ga0466715_507994 Ga0466715_507994_4890_5876 328
225 3300042622 Ga0466731_074953 Ga0466731_074953_9394_10380 328
226 iso_pr_bacteria 2896843662 2896844049 328
227 iso_pr_bacteria 8017489919 8017491574 328
228 3300009826 Ga0123355_10006360 Ga0123355_100063609 329
229 3300009826 Ga0123355_10031547 Ga0123355_1003154710 329
230 3300010049 Ga0123356_10026319 Ga0123356_100263195 329
231 3300042596 Ga0466696_119294 Ga0466696_119294_63090_64079 329
232 3300042604 Ga0466717_014730 Ga0466717_014730_837_1826 329
233 iso_pr_bacteria 2820329821 2820330059 329
234 iso_pr_bacteria 2820469612 2820470180 329
235 2084038013 AglaG_contig19080 AglaG_03123170 330
236 3300009826 Ga0123355_10000398 Ga0123355_100003988 330
237 3300009826 Ga0123355_10046860 Ga0123355_100468602 330
238 3300042608 Ga0466721_313890 Ga0466721_313890_78_1070 330
239 3300002504 JGI24705J35276_12233675 JGI24705J35276_122336752 331
240 3300009826 Ga0123355_10004922 Ga0123355_100049228 331
241 3300009826 Ga0123355_10116829 Ga0123355_101168292 331
242 3300009826 Ga0123355_10220889 Ga0123355_102208893 331
243 iso_pr_bacteria 8007237282 8007238676 331
244 3300009826 Ga0123355_10000655 Ga0123355_1000065543 332
245 iso_pr_bacteria 2820487239 2820487805 332
246 3300042654 Ga0466725_334262 Ga0466725_334262_101_1102 333
247 3300056814 Ga0562378_0279 Ga0562378_0279_10989_11990 333
248 iso_pr_bacteria 2820518089 2820519272 333
249 3300009826 Ga0123355_10157850 Ga0123355_101578502 334
250 3300056814 Ga0562378_0004 Ga0562378_0004_383204_384208 334
251 3300056842 Ga0562377_0063 Ga0562377_0063_91799_92803 334
252 3300057007 Ga0562374_0037 Ga0562374_0037_19811_20815 334
253 iso_pr_bacteria 2622736579 2623392595 334
254 iso_pr_bacteria 2820115951 2820116759 334
255 3300009784 Ga0123357_10000254 Ga0123357_1000025443 335
256 3300009826 Ga0123355_10007073 Ga0123355_100070732 335
257 3300010882 Ga0123354_10086797 Ga0123354_100867974 335
258 3300009826 Ga0123355_10158773 Ga0123355_101587735 336
259 3300038395 Ga0415639_018935 Ga0415639_018935_1242_2252 336
260 3300038395 Ga0415639_149871 Ga0415639_149871_988_1998 336
261 iso_pr_bacteria 2834951433 2834952210 336
262 iso_pr_bacteria 2873584433 2873585939 336
263 iso_pr_bacteria 2820301196 2820302497 337
264 iso_pr_bacteria 2820693137 2820693736 337
265 3300042611 Ga0466697_245950 Ga0466697_245950_96_1112 338
266 3300002501 JGI24703J35330_11748754 JGI24703J35330_1174875416 339
267 3300002501 JGI24703J35330_11747925 JGI24703J35330_117479257 340
268 3300042603 Ga0466714_001992 Ga0466714_001992_3654_4676 340
269 3300056842 Ga0562377_1775 Ga0562377_1775_11492_12514 340
270 3300056856 Ga0562375_0058 Ga0562375_0058_191865_192887 340
271 3300056856 Ga0562375_0076 Ga0562375_0076_77502_78524 340
272 iso_pr_bacteria 647533136 647747381 340
273 3300009826 Ga0123355_10060561 Ga0123355_100605614 343
274 3300038395 Ga0415639_154225 Ga0415639_154225_40_1071 343
275 3300042604 Ga0466717_041446 Ga0466717_041446_2066_3100 344
276 iso_pr_bacteria 2820369699 2820371662 344
277 iso_pr_bacteria 2820411483 2820412123 348
278 iso_pr_bacteria 2820416776 2820418010 348
279 3300010882 Ga0123354_10088389 Ga0123354_100883892 349
280 3300009826 Ga0123355_10079340 Ga0123355_100793404 350
281 3300042611 Ga0466697_048523 Ga0466697_048523_40_1092 350
282 3300042635 Ga0466702_444147 Ga0466702_444147_69864_70919 351
283 iso_pr_bacteria 2820146621 2820147314 351
284 3300002504 JGI24705J35276_12235654 JGI24705J35276_122356544 352
285 3300002508 JGI24700J35501_10930890 JGI24700J35501_1093089023 352
286 3300010049 Ga0123356_10037042 Ga0123356_100370422 352
287 3300009826 Ga0123355_10000197 Ga0123355_1000019715 353
288 3300010049 Ga0123356_10041583 Ga0123356_100415834 354
289 3300009826 Ga0123355_10163328 Ga0123355_101633283 359
290 3300009826 Ga0123355_10131747 Ga0123355_101317472 360
291 3300010049 Ga0123356_10315893 Ga0123356_103158932 360
292 iso_pr_bacteria 2724678956 2724787165 360
293 3300042602 Ga0466713_156550 Ga0466713_156550_6610_7695 361
294 3300056790 Ga0562379_0258 Ga0562379_0258_69482_70591 369
295 3300056790 Ga0562379_0273 Ga0562379_0273_61901_63010 369

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02562 PhoH PhoH-like protein 158 361 0.99
PF13604 AAA_30 AAA domain 162 314 0.83
PF13245 AAA_19 AAA domain 165 314 0.78

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02562 GO:0005524 ATP binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.