Protein Family IF10390
Metagenome
Isolate
207
Members
168
Samples
81
Scaffolds
412.43
Avg Length
Representative Sequence
- ID
- 3300056564|Ga0530661_004406|Ga0530661_004406_2783_4213
- Length
- 476 aa
- Sequence
- VRCNIFVASDAEGGGVLTGAADGATQRAAPVHRKRIFTRLSRPHARAPLFGSPPGPDRSRHIMSSTSISPLAPKTAPSLPEIAGVRLATAQAGIRYQGRTDVLFVGLDAGTQVAGVFTRSRCPSAPVDWCRAALQTGVGARALVVNSGNANAFTGLKGRDAVTLTAEIAGRAAGCTPDAVMIASTGVIGEPLDATKFDGVLADCVARAEPGAQAWEQAAKAIMTTDTFPKLATRSAEIDGTAVTINGIAKGAGMIAPDMATMLSFVFTDATLPQTVLQELLSAGTKTSFNCVTVDGDTSTSDTLLLFATGAAGNASIDRADDPRLDGFRAALDDLLIELAQLVARDGEGARKLVTVRVEGAESDASAHRIALSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLAIWFGDVRVAVQGARDPGYSEEAASAVMREPEITVRVDLGLGEGAARVWTCDLTKAYVEINGDYRS
Sample Types
Isolate
60.9%
Metagenome
39.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
32.9%
Drosophilidae
15.0%
Unclassified
12.0%
Formicidae
9.0%
Elmidae
7.8%
Termitidae
7.2%
Culicidae
3.6%
Armadillidiidae
3.0%
Kalotermitidae
1.8%
Psyllidae
1.8%
Pyrrhocoridae
0.6%
Termopsidae
0.6%
Pediculidae
0.6%
Nymphalidae
0.6%
Curculionidae
0.6%
Daphniidae
0.6%
Nephropidae
0.6%
Tenebrionidae
0.6%
Noctuidae
0.6%
Muscidae
0.6%
Taxonomy
Archaea
0
Bacteria
193
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 2 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 3 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 4 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 5 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 6 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 7 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 8 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 9 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 10 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 11 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 12 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 639279308 | Ehrlichia ruminantium Welgevonden, ARC-OVI | Isolate | Unclassified |
| 17 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 18 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 19 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 20 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 21 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 22 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 23 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 24 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 25 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 26 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 27 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 28 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 29 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 30 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 31 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 32 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 33 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 34 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 35 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 36 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 37 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 38 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 39 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 40 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 41 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 42 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 43 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 44 | 639279309 | Ehrlichia ruminantium Welgevonden, CIRAD | Isolate | Unclassified |
| 45 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 46 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 47 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 48 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 49 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 50 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 51 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 52 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 53 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 54 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 57 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 58 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 59 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 60 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 61 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 62 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 63 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 64 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 65 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 68 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 69 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 70 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 71 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 72 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 73 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 74 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 75 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 76 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 77 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 78 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 79 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 80 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 81 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 82 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 83 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 84 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 85 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 88 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 89 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 90 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 91 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 92 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 93 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 94 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 95 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 96 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 97 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 98 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 99 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 100 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 101 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 102 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 103 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 104 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 105 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 106 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 107 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 108 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 109 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 110 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 111 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 112 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 113 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 114 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 115 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 116 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 117 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 118 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 119 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 120 | 2744054723 | Ehrlichia ruminantium Palm River | Isolate | Unclassified |
| 121 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 122 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 123 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 124 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 125 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 126 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 127 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 128 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 129 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 130 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 131 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 132 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 133 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 134 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 135 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 136 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 137 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 138 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 139 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 140 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 141 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 142 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 143 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 144 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 145 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 146 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 147 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 148 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 149 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 150 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 151 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 152 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 153 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 154 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 155 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 156 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 157 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 158 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 159 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 160 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 161 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 162 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 163 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 164 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 165 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 166 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 167 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 168 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | CVPL010W_10000177 | 3300002931 | Bacteria | 55052 |
| 2 | Ga0104045_1076103 | 3300007085 | Bacteria | 1746 |
| 3 | Ga0103264_1000213 | 3300007188 | Bacteria | 42565 |
| 4 | Ga0160467_100469 | 3300012829 | Bacteria | 39445 |
| 5 | Ga0160472_100015 | 3300012839 | Bacteria | 403883 |
| 6 | Ga0160460_100148 | 3300012845 | Bacteria | 80857 |
| 7 | Ga0466701_001839 | 3300042598 | Bacteria | 1943 |
| 8 | Ga0123356_10051881 | 3300010049 | Bacteria | 3815 |
| 9 | CVPL005W_1002748 | 3300002934 | Bacteria | 3231 |
| 10 | CVPL005L_10000015 | 3300002938 | Bacteria | 104057 |
| 11 | Ga0074278_129509 | 3300005721 | Bacteria | 25676 |
| 12 | Ga0074278_146366 | 3300005721 | Bacteria | 6968 |
| 13 | Ga0160443_103960 | 3300012848 | Bacteria | 2379 |
| 14 | Ga0466696_177167 | 3300042596 | Bacteria | 5292 |
| 15 | Ga0466699_404639 | 3300042597 | Bacteria | 2088 |
| 16 | CVPL010W_10000103 | 3300002931 | Bacteria | 61958 |
| 17 | CVPL005L_10000008 | 3300002938 | Bacteria | 183753 |
| 18 | CVPL005L_10016334 | 3300002938 | Bacteria | 4580 |
| 19 | Ga0160467_100056 | 3300012829 | Bacteria | 169022 |
| 20 | Ga0160446_100113 | 3300012835 | Bacteria | 71976 |
| 21 | Ga0160448_102186 | 3300012854 | Bacteria | 6114 |
| 22 | Ga0309904_1000001 | 3300029810 | Bacteria | 103432 |
| 23 | Ga0316159_10118 | 3300030930 | Bacteria | 15453 |
| 24 | Ga0123356_10047566 | 3300010049 | Bacteria | 3992 |
| 25 | Ga0123356_10060445 | 3300010049 | Unclassified | 3536 |
| 26 | Ga0466730_039130 | 3300042625 | Bacteria | 24493 |
| 27 | Ga0466724_55135 | 3300042649 | Bacteria | 2145 |
| 28 | JGI24705J35276_12238198 | 3300002504 | Bacteria | 17115 |
| 29 | Ga0074278_108561 | 3300005721 | Bacteria | 10369 |
| 30 | Ga0103264_1000542 | 3300007188 | Bacteria | 22394 |
| 31 | Ga0160459_100074 | 3300012831 | Bacteria | 129853 |
| 32 | Ga0123354_10204024 | 3300010882 | Bacteria | 2162 |
| 33 | Ga0466701_072683 | 3300042598 | Unclassified | 82865 |
| 34 | Ga0466730_057675 | 3300042625 | Bacteria | 40301 |
| 35 | Ga0530661_000203 | 3300056564 | Bacteria | 49716 |
| 36 | Ga0074278_111064 | 3300005721 | Unclassified | 4539 |
| 37 | Ga0074278_127206 | 3300005721 | Unclassified | 41739 |
| 38 | Ga0123357_10005786 | 3300009784 | Bacteria | 14890 |
| 39 | Ga0123355_10016111 | 3300009826 | Bacteria | 11770 |
| 40 | Ga0123355_10258438 | 3300009826 | Bacteria | 2439 |
| 41 | Ga0123356_10032996 | 3300010049 | Unclassified | 4842 |
| 42 | Ga0466734_126811 | 3300042623 | Bacteria | 20244 |
| 43 | Ga0466724_04076 | 3300042649 | Bacteria | 105631 |
| 44 | Ga0466724_07005 | 3300042649 | Unclassified | 1333 |
| 45 | Ga0466724_07030 | 3300042649 | Unclassified | 1333 |
| 46 | Ga0530661_004406 | 3300056564 | Bacteria | 4317 |
| 47 | Ga0074278_130899 | 3300005721 | Bacteria | 6866 |
| 48 | Ga0160468_100001 | 3300012819 | Bacteria | 1115787 |
| 49 | Ga0160457_1008875 | 3300012858 | Bacteria | 1443 |
| 50 | Ga0123355_10070664 | 3300009826 | Bacteria | 5606 |
| 51 | Ga0123356_10109600 | 3300010049 | Bacteria | 2664 |
| 52 | Ga0466704_018300 | 3300042643 | Bacteria | 9837 |
| 53 | JGI24705J35276_12208208 | 3300002504 | Bacteria | 1766 |
| 54 | Ga0160433_100099 | 3300012846 | Bacteria | 86801 |
| 55 | Ga0160433_100217 | 3300012846 | Bacteria | 43589 |
| 56 | Ga0160457_1004423 | 3300012858 | Bacteria | 2253 |
| 57 | Ga0255572_1000006 | 3300026175 | Bacteria | 236537 |
| 58 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 59 | Ga0123355_10000248 | 3300009826 | Bacteria | 69553 |
| 60 | Ga0123356_10058470 | 3300010049 | Unclassified | 3595 |
| 61 | Ga0466701_063444 | 3300042598 | Bacteria | 5742 |
| 62 | Ga0466709_189162 | 3300042648 | Bacteria | 21764 |
| 63 | HBC_ctgsDRAFT_1010077 | 3300000333 | Unclassified | 2250 |
| 64 | JGI24705J35276_12231809 | 3300002504 | Unclassified | 4075 |
| 65 | CVPL010L_1001286 | 3300002932 | Unclassified | 4476 |
| 66 | CVPL005W_1000126 | 3300002934 | Bacteria | 32591 |
| 67 | Ga0074311_1141789 | 3300005317 | Bacteria | 2453 |
| 68 | Ga0103266_1000003 | 3300007067 | Bacteria | 141646 |
| 69 | Ga0102734_1000519 | 3300007129 | Bacteria | 21385 |
| 70 | Ga0103264_1000169 | 3300007188 | Bacteria | 38203 |
| 71 | Ga0103264_1000931 | 3300007188 | Bacteria | 13166 |
| 72 | Ga0105004_1192294 | 3300007763 | Bacteria | 3187 |
| 73 | Ga0160459_100238 | 3300012831 | Bacteria | 27351 |
| 74 | Ga0309903_100003 | 3300029809 | Bacteria | 120869 |
| 75 | Ga0123355_10008886 | 3300009826 | Unclassified | 15214 |
| 76 | Ga0123355_10094636 | 3300009826 | Unclassified | 4726 |
| 77 | Ga0123356_10135000 | 3300010049 | Bacteria | 2424 |
| 78 | Ga0123356_10400532 | 3300010049 | Bacteria | 1510 |
| 79 | Ga0466717_230063 | 3300042604 | Unclassified | 2151 |
| 80 | Ga0466734_081708 | 3300042623 | Bacteria | 1695 |
| 81 | Ga0466726_347789 | 3300042619 | Bacteria | 126502 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01960 | ArgJ | ArgJ family | 87 | 476 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.