Protein Family IF10372

Metagenome Isolate
159 Members
47 Samples
151 Scaffolds
610.46 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_210986|Ga0466733_210986_10462_12651
Length
692 aa
Sequence
LPNCYQLIANLIVGVLPTVTAVLSLSKAKVSKINVILSFTFNCCVAVNTVSQLSININQPLTTFFEVFADLMYLCGLYDAKMISIEGLTVEFGGFTLLDGLSFVVNNKDRIALVGKNGAGKSTLLKILARMQAPTSGVVSIPKDTTIGYLPQQMQLSDKHTVREEAERAFEQIHLMEEEINRINTELAERTDYESEAFQKLIDRVTLLSEQFQMMGGTNYHAELERTLMGLGFTRDDFERPTSEFSGGWRMRIELAKLLLQRPDVLLLDEPTNHLDIESIQWLETFIATRANAVILVSHDRAFIDNTTIRTVEIELGKIYDYKVKYSDYVELRKERRAYENQQKKLADTEAFIERFRYKATKAVQVQSRIKSSALRLKFPPAPRSGSYPVITENLTKRYGDHLVFSGATFTIHRGDKVAFVGKNGEGKSTLVKCIMDEIDYQGTLTLGHNVKIGYFAQNQAQLLDENRTVFETIDYVAVGDVRTKIRDILGAFMFGGEASDKKVKVLSGGERSRLAMIRLLLEPVNLLILDEPTNHLDMRSKDVLKDALRDFDGTIIVVSHDREFLDGLVDKVYEFGNKQVKEHLGGIYEFLERKKIENLQELERKTTANMVSESTSQTIDTSXTSKLSYEEQKERSRVQRRLEKAITDSEQKIGASDTALYIEYEAAKKELSQTMDQWTEQTIELEEFGKD

📊 Sample Types

Isolate 5.0%
Metagenome 95.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.8%
Termitidae 25.5%
Unclassified 21.3%
Termopsidae 8.5%
Rhinotermitidae 6.4%
Hodotermitidae 2.1%
Tenebrionidae 2.1%
Passalidae 2.1%
Blattidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
6 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
29 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 2820219087 Unclassified Ignavibacteria Th196P3bin14 Isolate Unclassified
36 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
43 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0004 3300056842 Bacteria 3525959
2 Ga0466707_007087 3300042601 Bacteria 4441
3 Ga0466714_147194 3300042603 Bacteria 26228
4 Ga0123356_10186957 3300010049 Bacteria 2099
5 Ga0466735_057601 3300042624 Bacteria 5572
6 Ga0466735_146418 3300042624 Bacteria 5047
7 Ga0466703_063222 3300042636 Bacteria 8905
8 Ga0466704_298975 3300042643 Bacteria 9913
9 Ga0466704_381674 3300042643 Bacteria 10098
10 Ga0466704_480992 3300042643 Bacteria 10100
11 Ga0466727_037576 3300042655 Bacteria 6512
12 Ga0466727_253072 3300042655 Bacteria 3764
13 Ga0466690_100360 3300042590 Bacteria 7025
14 Ga0466690_430393 3300042590 Bacteria 5144
15 Ga0466691_045790 3300042593 Bacteria 2649
16 Ga0466711_008885 3300042615 Bacteria 6751
17 Ga0466711_022010 3300042615 Bacteria 4790
18 Ga0466715_233404 3300042616 Bacteria 7086
19 Ga0466715_485052 3300042616 Bacteria 31199
20 Ga0466726_023029 3300042619 Bacteria 2806
21 Ga0466728_244432 3300042620 Bacteria 30862
22 Ga0068302_10066918 3300005071 Bacteria 9116
23 Ga0466697_247403 3300042611 Bacteria 2366
24 Ga0466733_108606 3300042659 Bacteria 27573
25 Ga0466733_185781 3300042659 Bacteria 4631
26 Ga0466707_287966 3300042601 Bacteria 4895
27 Ga0466716_500320 3300042605 Bacteria 3598
28 Ga0466722_267876 3300042609 Bacteria 7084
29 Ga0466703_061210 3300042636 Bacteria 7420
30 Ga0466692_103340 3300042591 Bacteria 5892
31 Ga0466699_266864 3300042597 Bacteria 4432
32 Ga0466705_425387 3300042612 Bacteria 13913
33 Ga0466705_475466 3300042612 Bacteria 8126
34 Ga0466711_145802 3300042615 Bacteria 19674
35 Ga0466711_152310 3300042615 Bacteria 29157
36 Ga0466711_239934 3300042615 Bacteria 17196
37 Ga0068305_10452624 3300005083 Unclassified 10012
38 Ga0466733_044113 3300042659 Bacteria 6287
39 Ga0466706_079043 3300042599 Bacteria 5088
40 Ga0466706_252956 3300042599 Bacteria 3093
41 Ga0466735_034042 3300042624 Bacteria 8965
42 Ga0466703_032941 3300042636 Bacteria 6990
43 Ga0466704_366289 3300042643 Bacteria 3636
44 Ga0466704_416049 3300042643 Bacteria 2767
45 Ga0466709_036824 3300042648 Bacteria 45300
46 Ga0466709_178314 3300042648 Bacteria 4513
47 Ga0466725_085561 3300042654 Bacteria 5900
48 Ga0466690_037427 3300042590 Bacteria 19485
49 Ga0466690_290671 3300042590 Bacteria 5102
50 Ga0466696_157990 3300042596 Bacteria 15081
51 Ga0466696_353358 3300042596 Bacteria 3392
52 Ga0466711_000212 3300042615 Bacteria 21541
53 Ga0466715_458768 3300042616 Bacteria 71878
54 Ga0466723_095121 3300042618 Bacteria 177949
55 Ga0466726_037804 3300042619 Bacteria 5661
56 Ga0466726_048500 3300042619 Bacteria 17749
57 Ga0466705_332215 3300042612 Bacteria 4473
58 Ga0466707_183787 3300042601 Bacteria 20164
59 Ga0466707_211687 3300042601 Bacteria 38449
60 Ga0466714_122509 3300042603 Bacteria 6883
61 Ga0466716_029337 3300042605 Bacteria 6198
62 Ga0466722_108041 3300042609 Bacteria 10352
63 Ga0466722_266272 3300042609 Bacteria 29442
64 Ga0466735_023376 3300042624 Bacteria 4824
65 Ga0466703_062227 3300042636 Bacteria 19166
66 Ga0466690_148842 3300042590 Bacteria 22929
67 Ga0466715_079087 3300042616 Bacteria 12214
68 Ga0466715_155144 3300042616 Bacteria 18435
69 Ga0466715_438719 3300042616 Bacteria 10030
70 Ga0466723_202994 3300042618 Bacteria 13808
71 Ga0466728_006837 3300042620 Bacteria 8018
72 Ga0466733_010958 3300042659 Bacteria 12720
73 Ga0466706_179279 3300042599 Bacteria 10325
74 Ga0466700_387454 3300042600 Bacteria 47059
75 Ga0466714_112815 3300042603 Bacteria 3738
76 Ga0466714_140426 3300042603 Bacteria 5048
77 Ga0466719_177034 3300042606 Bacteria 4262
78 Ga0466722_043134 3300042609 Bacteria 89421
79 Ga0466722_238617 3300042609 Bacteria 3396
80 Ga0466735_228473 3300042624 Bacteria 6604
81 Ga0466704_066112 3300042643 Bacteria 10764
82 Ga0466709_381353 3300042648 Bacteria 5595
83 Ga0466708_236414 3300042652 Bacteria 7716
84 Ga0466691_038170 3300042593 Bacteria 24327
85 Ga0466715_439245 3300042616 Bacteria 26781
86 Ga0466715_604278 3300042616 Bacteria 10883
87 IMNBL1DRAFT_c0002663 3300000062 Bacteria 12207
88 JGI24702J35022_10011142 3300002462 Bacteria 5009
89 JGI24702J35022_10019178 3300002462 Bacteria 3723
90 Ga0466705_098986 3300042612 Bacteria 5801
91 Ga0466705_200604 3300042612 Bacteria 4640
92 Ga0466705_315866 3300042612 Bacteria 12753
93 Ga0466705_357345 3300042612 Bacteria 2663
94 Ga0466706_104301 3300042599 Bacteria 25950
95 Ga0466713_088520 3300042602 Bacteria 50636
96 Ga0466713_140678 3300042602 Bacteria 25597
97 Ga0466714_039543 3300042603 Bacteria 17731
98 Ga0466716_323239 3300042605 Bacteria 8558
99 Ga0123353_10002429 3300010167 Bacteria 23152
100 Ga0466735_035764 3300042624 Bacteria 9305
101 Ga0466703_322168 3300042636 Bacteria 8808
102 Ga0466704_120143 3300042643 Bacteria 12402
103 Ga0466708_361553 3300042652 Bacteria 11479
104 Ga0466725_338069 3300042654 Bacteria 25558
105 Ga0466727_093047 3300042655 Bacteria 16544
106 Ga0466656_218598 3300042550 Bacteria 5858
107 Ga0466690_017055 3300042590 Bacteria 17485
108 Ga0466690_055481 3300042590 Bacteria 72316
109 Ga0466696_113650 3300042596 Bacteria 3444
110 Ga0466696_249490 3300042596 Bacteria 3155
111 Ga0466696_345688 3300042596 Bacteria 17065
112 Ga0466723_188080 3300042618 Bacteria 4842
113 Ga0466728_087702 3300042620 Bacteria 35663
114 Ga0466729_031223 3300042621 Bacteria 18508
115 Ga0466729_043865 3300042621 Bacteria 7686
116 Ga0068305_10005931 3300005083 Bacteria 20264
117 Ga0466733_210986 3300042659 Bacteria 33448
118 Ga0466706_104552 3300042599 Bacteria 33608
119 Ga0466700_386735 3300042600 Bacteria 4796
120 Ga0466707_358950 3300042601 Bacteria 4483
121 Ga0466719_050451 3300042606 Bacteria 8322
122 Ga0466719_356059 3300042606 Bacteria 3578
123 Ga0123353_10295130 3300010167 Bacteria 2479
124 Ga0123354_10001155 3300010882 Bacteria 30901
125 Ga0466703_433482 3300042636 Bacteria 8973
126 Ga0466709_073410 3300042648 Bacteria 19111
127 Ga0466708_367530 3300042652 Bacteria 33206
128 Ga0466727_074149 3300042655 Bacteria 16026
129 Ga0466690_002319 3300042590 Bacteria 19213
130 Ga0466696_406078 3300042596 Bacteria 14164
131 Ga0466715_083945 3300042616 Bacteria 14593
132 IMNBL1DRAFT_c0004303 3300000062 Bacteria 8607
133 JGI24699J35502_11134168 3300002509 Bacteria 43545
134 Ga0466706_025945 3300042599 Bacteria 100859
135 Ga0466706_132460 3300042599 Bacteria 45287
136 Ga0466707_205111 3300042601 Bacteria 5465
137 Ga0466713_012205 3300042602 Bacteria 14481
138 Ga0466722_080425 3300042609 Bacteria 8406
139 Ga0123353_10208719 3300010167 Bacteria 3065
140 Ga0466703_166876 3300042636 Bacteria 14308
141 Ga0466704_484825 3300042643 Bacteria 6099
142 Ga0466709_208828 3300042648 Bacteria 4491
143 Ga0466708_297652 3300042652 Bacteria 42408
144 Ga0466727_057709 3300042655 Bacteria 2946
145 Ga0466691_000897 3300042593 Bacteria 25654
146 Ga0466691_011534 3300042593 Bacteria 26579
147 Ga0466691_040831 3300042593 Bacteria 126917
148 Ga0466696_062057 3300042596 Bacteria 26500
149 Ga0466715_414673 3300042616 Bacteria 3322
150 Ga0466723_030183 3300042618 Bacteria 23821
151 IMNBL1DRAFT_c0001741 3300000062 Bacteria 15965

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_238617 Ga0466722_238617_1049_2947 552
2 3300042636 Ga0466703_062227 Ga0466703_062227_7713_9659 558
3 3300042612 Ga0466705_200604 Ga0466705_200604_1594_3534 561
4 3300042624 Ga0466735_023376 Ga0466735_023376_2390_4336 564
5 3300042600 Ga0466700_387454 Ga0466700_387454_27112_29043 565
6 3300042619 Ga0466726_048500 Ga0466726_048500_12217_14190 567
7 3300005071 Ga0068302_10066918 Ga0068302_100669185 568
8 3300042597 Ga0466699_266864 Ga0466699_266864_819_2528 569
9 3300042601 Ga0466707_007087 Ga0466707_007087_326_2293 570
10 3300042603 Ga0466714_039543 Ga0466714_039543_6815_8803 570
11 3300042609 Ga0466722_266272 Ga0466722_266272_23805_25742 570
12 3300042609 Ga0466722_108041 Ga0466722_108041_722_2620 572
13 3300042609 Ga0466722_267876 Ga0466722_267876_3563_5500 572
14 3300010167 Ga0123353_10002429 Ga0123353_100024296 574
15 3300042615 Ga0466711_000212 Ga0466711_000212_14763_16685 574
16 3300042659 Ga0466733_010958 Ga0466733_010958_8045_10027 575
17 3300042596 Ga0466696_345688 Ga0466696_345688_12000_13943 576
18 3300042621 Ga0466729_031223 Ga0466729_031223_12756_14687 576
19 iso_pr_bacteria 2820737921 2820739867 576
20 3300042590 Ga0466690_430393 Ga0466690_430393_1054_2931 577
21 3300042616 Ga0466715_604278 Ga0466715_604278_4632_6566 579
22 3300056842 Ga0562377_0004 Ga0562377_0004_1054061_1056016 579
23 3300042550 Ga0466656_218598 Ga0466656_218598_2794_4728 580
24 3300042624 Ga0466735_057601 Ga0466735_057601_446_2389 580
25 3300042602 Ga0466713_140678 Ga0466713_140678_6794_8734 582
26 3300042591 Ga0466692_103340 Ga0466692_103340_1299_3242 584
27 3300042648 Ga0466709_036824 Ga0466709_036824_12541_14484 584
28 3300002462 JGI24702J35022_10019178 JGI24702J35022_100191782 586
29 3300010167 Ga0123353_10208719 Ga0123353_102087191 586
30 3300000062 IMNBL1DRAFT_c0001741 IMNBL1DRAFT_00017412 587
31 3300042636 Ga0466703_061210 Ga0466703_061210_2068_4014 587
32 3300005083 Ga0068305_10452624 Ga0068305_104526243 588
33 3300042659 Ga0466733_185781 Ga0466733_185781_2410_4344 588
34 3300042615 Ga0466711_239934 Ga0466711_239934_432_2366 589
35 3300042616 Ga0466715_458768 Ga0466715_458768_64138_66075 589
36 3300042599 Ga0466706_132460 Ga0466706_132460_16478_18439 590
37 3300042601 Ga0466707_358950 Ga0466707_358950_1759_3696 590
38 3300042616 Ga0466715_485052 Ga0466715_485052_17467_19422 590
39 3300042615 Ga0466711_022010 Ga0466711_022010_2770_4710 591
40 3300000062 IMNBL1DRAFT_c0004303 IMNBL1DRAFT_00043033 592
41 3300042602 Ga0466713_088520 Ga0466713_088520_44619_46550 592
42 3300042616 Ga0466715_155144 Ga0466715_155144_8708_10612 592
43 3300042643 Ga0466704_066112 Ga0466704_066112_910_2919 592
44 3300042636 Ga0466703_166876 Ga0466703_166876_4535_6478 593
45 3300042606 Ga0466719_356059 Ga0466719_356059_867_2780 595
46 3300042648 Ga0466709_381353 Ga0466709_381353_2731_4662 595
47 3300042621 Ga0466729_043865 Ga0466729_043865_3020_4954 596
48 3300042652 Ga0466708_236414 Ga0466708_236414_873_2804 596
49 3300042596 Ga0466696_157990 Ga0466696_157990_9292_11268 597
50 3300042624 Ga0466735_034042 Ga0466735_034042_291_2234 597
51 3300042599 Ga0466706_104552 Ga0466706_104552_9324_11285 599
52 3300042606 Ga0466719_050451 Ga0466719_050451_682_2628 599
53 3300042648 Ga0466709_208828 Ga0466709_208828_765_2705 599
54 3300042655 Ga0466727_253072 Ga0466727_253072_1471_3417 599
55 3300042590 Ga0466690_037427 Ga0466690_037427_3588_5492 600
56 3300042599 Ga0466706_252956 Ga0466706_252956_181_2109 600
57 3300042654 Ga0466725_085561 Ga0466725_085561_2378_4312 600
58 3300010167 Ga0123353_10295130 Ga0123353_102951302 601
59 3300042643 Ga0466704_298975 Ga0466704_298975_7369_9264 601
60 3300042603 Ga0466714_140426 Ga0466714_140426_71_2008 602
61 3300042643 Ga0466704_484825 Ga0466704_484825_2900_4876 602
62 3300042654 Ga0466725_338069 Ga0466725_338069_11901_13823 602
63 3300010049 Ga0123356_10186957 Ga0123356_101869572 603
64 3300042590 Ga0466690_002319 Ga0466690_002319_10399_12345 603
65 3300042590 Ga0466690_055481 Ga0466690_055481_6748_8664 603
66 3300042612 Ga0466705_332215 Ga0466705_332215_2398_4341 603
67 3300042590 Ga0466690_100360 Ga0466690_100360_4864_6807 604
68 3300042596 Ga0466696_062057 Ga0466696_062057_24388_26319 604
69 3300042606 Ga0466719_177034 Ga0466719_177034_58_1989 604
70 3300042599 Ga0466706_079043 Ga0466706_079043_1405_3315 605
71 3300042609 Ga0466722_043134 Ga0466722_043134_17229_19169 605
72 3300042616 Ga0466715_079087 Ga0466715_079087_2314_4272 605
73 3300042655 Ga0466727_093047 Ga0466727_093047_3698_5629 605
74 3300042599 Ga0466706_104301 Ga0466706_104301_20117_22000 606
75 3300000062 IMNBL1DRAFT_c0002663 IMNBL1DRAFT_00026631 607
76 3300042599 Ga0466706_025945 Ga0466706_025945_51155_53107 607
77 3300042615 Ga0466711_152310 Ga0466711_152310_25178_27121 607
78 3300042593 Ga0466691_011534 Ga0466691_011534_223_2154 608
79 3300042636 Ga0466703_063222 Ga0466703_063222_3329_5389 609
80 3300042601 Ga0466707_211687 Ga0466707_211687_32899_34833 610
81 3300042616 Ga0466715_233404 Ga0466715_233404_1582_3540 610
82 3300042618 Ga0466723_188080 Ga0466723_188080_604_2538 610
83 3300042596 Ga0466696_353358 Ga0466696_353358_264_2234 611
84 3300042605 Ga0466716_323239 Ga0466716_323239_3017_4963 611
85 3300042643 Ga0466704_416049 Ga0466704_416049_248_2194 611
86 3300002509 JGI24699J35502_11134168 JGI24699J35502_1113416831 612
87 3300042601 Ga0466707_205111 Ga0466707_205111_679_2613 612
88 3300042618 Ga0466723_202994 Ga0466723_202994_2144_4066 612
89 3300042655 Ga0466727_074149 Ga0466727_074149_10210_12141 612
90 3300042624 Ga0466735_035764 Ga0466735_035764_2268_4208 613
91 3300042601 Ga0466707_183787 Ga0466707_183787_7074_9023 614
92 3300042616 Ga0466715_414673 Ga0466715_414673_297_2216 614
93 3300042655 Ga0466727_037576 Ga0466727_037576_262_2199 614
94 3300042603 Ga0466714_147194 Ga0466714_147194_5418_7418 615
95 3300042615 Ga0466711_145802 Ga0466711_145802_12339_14309 615
96 3300042619 Ga0466726_037804 Ga0466726_037804_256_2190 616
97 3300042620 Ga0466728_006837 Ga0466728_006837_1051_2970 616
98 3300042612 Ga0466705_315866 Ga0466705_315866_482_2521 617
99 3300042652 Ga0466708_361553 Ga0466708_361553_440_2395 617
100 3300042611 Ga0466697_247403 Ga0466697_247403_385_2319 618
101 3300042659 Ga0466733_044113 Ga0466733_044113_4140_6095 618
102 3300010882 Ga0123354_10001155 Ga0123354_1000115521 619
103 3300042601 Ga0466707_287966 Ga0466707_287966_2769_4691 619
104 3300042620 Ga0466728_087702 Ga0466728_087702_26299_28254 619
105 3300042624 Ga0466735_146418 Ga0466735_146418_1335_3299 619
106 3300042596 Ga0466696_113650 Ga0466696_113650_12_2048 621
107 3300042603 Ga0466714_112815 Ga0466714_112815_1413_3362 621
108 3300042603 Ga0466714_122509 Ga0466714_122509_2497_4476 621
109 3300042652 Ga0466708_367530 Ga0466708_367530_27506_29431 621
110 3300042590 Ga0466690_017055 Ga0466690_017055_1902_3866 622
111 3300042636 Ga0466703_032941 Ga0466703_032941_3110_5050 622
112 3300042636 Ga0466703_322168 Ga0466703_322168_449_2452 622
113 3300042599 Ga0466706_179279 Ga0466706_179279_1687_3636 623
114 3300042612 Ga0466705_475466 Ga0466705_475466_5340_7277 623
115 3300042616 Ga0466715_083945 Ga0466715_083945_4063_6021 624
116 3300042618 Ga0466723_095121 Ga0466723_095121_33727_35691 624
117 3300042655 Ga0466727_057709 Ga0466727_057709_839_2812 624
118 3300042619 Ga0466726_023029 Ga0466726_023029_706_2664 625
119 3300042648 Ga0466709_073410 Ga0466709_073410_5081_7048 626
120 3300042652 Ga0466708_297652 Ga0466708_297652_18972_20948 626
121 3300042659 Ga0466733_108606 Ga0466733_108606_18173_20122 626
122 3300042605 Ga0466716_500320 Ga0466716_500320_1479_3407 627
123 3300042593 Ga0466691_040831 Ga0466691_040831_55025_56986 628
124 3300042636 Ga0466703_433482 Ga0466703_433482_6725_8680 630
125 3300042590 Ga0466690_290671 Ga0466690_290671_1854_3884 631
126 3300042616 Ga0466715_438719 Ga0466715_438719_5981_7924 632
127 3300042620 Ga0466728_244432 Ga0466728_244432_5516_7492 632
128 3300042600 Ga0466700_386735 Ga0466700_386735_2314_4293 633
129 3300005083 Ga0068305_10005931 Ga0068305_100059313 634
130 3300042612 Ga0466705_357345 Ga0466705_357345_500_2428 634
131 3300042615 Ga0466711_008885 Ga0466711_008885_1280_3292 636
132 3300042643 Ga0466704_381674 Ga0466704_381674_3996_6086 636
133 3300002462 JGI24702J35022_10011142 JGI24702J35022_100111423 637
134 iso_pr_bacteria 2820744581 2820745299 638
135 3300042616 Ga0466715_439245 Ga0466715_439245_4424_6394 639
136 3300042593 Ga0466691_045790 Ga0466691_045790_309_2246 640
137 3300042643 Ga0466704_480992 Ga0466704_480992_7868_9877 642
138 3300042593 Ga0466691_038170 Ga0466691_038170_9048_10979 643
139 3300042643 Ga0466704_120143 Ga0466704_120143_8199_10238 644
140 3300042605 Ga0466716_029337 Ga0466716_029337_3902_6049 645
141 3300042612 Ga0466705_425387 Ga0466705_425387_9071_11098 647
142 iso_pr_bacteria 2820789850 2820792654 648
143 3300042612 Ga0466705_098986 Ga0466705_098986_1949_3931 649
144 iso_pr_bacteria 2695420314 2695470851 649
145 iso_pr_bacteria 2820219087 2820220364 649
146 iso_pr_bacteria 2910926975 2910927407 649
147 3300042609 Ga0466722_080425 Ga0466722_080425_3109_5061 650
148 3300042596 Ga0466696_406078 Ga0466696_406078_3389_5347 652
149 3300042593 Ga0466691_000897 Ga0466691_000897_5105_7069 654
150 iso_pr_bacteria 2820774381 2820774956 654
151 3300042596 Ga0466696_249490 Ga0466696_249490_28_2073 655
152 3300042590 Ga0466690_148842 Ga0466690_148842_20277_22256 659
153 3300042602 Ga0466713_012205 Ga0466713_012205_10365_12383 660
154 3300042618 Ga0466723_030183 Ga0466723_030183_20690_22885 661
155 3300042648 Ga0466709_178314 Ga0466709_178314_644_2746 664
156 3300042643 Ga0466704_366289 Ga0466704_366289_953_3088 665
157 3300042624 Ga0466735_228473 Ga0466735_228473_4073_6076 667
158 iso_pr_bacteria 2820750388 2820751775 669
159 3300042659 Ga0466733_210986 Ga0466733_210986_10462_12651 692

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12848 ABC_tran_Xtn ABC transporter 312 371 0.96
PF00005 ABC_tran ABC transporter 98 273 0.88
PF00350 Dynamin_N Dynamin family 111 310 0.81
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 112 132 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.