Protein Family IF10353

Metagenome Isolate
151 Members
57 Samples
131 Scaffolds
410.85 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_186141|Ga0466733_186141_323_1606
Length
416 aa
Sequence
MDFSEFNFHPTVMEGLDAMRFQTATPVQELTIPIIMQGRDIVACAQTGTGKTAAYLLPILHKLCETPHPQDSINAIVIAPTRELAQQIDQQLEGFSYFMPVSSVAVYGGNDGGAWDQQKRGLEKGADFVIATPGRLLSHLNINSNIDFSRVQYFILDEADRMLDMGFFDDIMQVVKRLGKNRQTILFSATMPDKIRQLANAILQDPEEVKIAVSKPAEGIKQSAFICHEGQKQGIIQSLFSEHQPDRAIIFVGSKMKVKEVAAGLRKFCKGVAEMHSDLEQAQREETMNGFRSGRIKLLVATDVVSRGIDVEDIELVINYDVPRAAEDYVHRIGRTARASAEGAAITLVSDKDQPTFKRIEDFLEKEIEKSPVPENLGKAPEYNPAKFVGRFGDKKGQRSGGQHRHKKPVANKKAE

📊 Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.7%
Kalotermitidae 25.0%
Termitidae 16.1%
Rhinotermitidae 5.4%
Unclassified 5.4%
Passalidae 5.4%
Termopsidae 3.6%
Hodotermitidae 1.8%
Culicidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 2923982719 Parabacteroides sp. 52 Isolate Blattidae
6 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
7 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
8 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2922326829 Bacteroides sp. 224 Isolate Blattidae
19 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
25 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
26 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
38 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
39 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
40 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
41 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
42 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
43 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
44 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
51 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
52 3004667792 Bacteroides sp. 519 Isolate Blattidae
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_068471 3300042612 Bacteria 9310
2 Ga0123353_10573030 3300010167 Bacteria 1622
3 Ga0466715_567151 3300042616 Bacteria 35252
4 Ga0466690_249215 3300042590 Bacteria 8764
5 Ga0466690_253817 3300042590 Bacteria 10765
6 Ga0466706_174110 3300042599 Bacteria 65436
7 Ga0466713_020992 3300042602 Bacteria 62959
8 Ga0466713_041582 3300042602 Bacteria 35087
9 Ga0466716_160457 3300042605 Bacteria 8760
10 Ga0466716_432952 3300042605 Bacteria 18137
11 Ga0466722_240768 3300042609 Bacteria 19386
12 Ga0466703_258576 3300042636 Bacteria 1959
13 Ga0466704_063568 3300042643 Bacteria 7323
14 Ga0466727_203052 3300042655 Bacteria 14252
15 JGI24702J35022_10037247 3300002462 Bacteria 2598
16 Ga0466705_116524 3300042612 Bacteria 1530
17 Ga0466733_025416 3300042659 Bacteria 189255
18 Ga0160470_100005 3300012813 Bacteria 615500
19 Ga0466705_460664 3300042612 Bacteria 19970
20 Ga0466711_008567 3300042615 Bacteria 15554
21 Ga0466711_073380 3300042615 Bacteria 11163
22 Ga0466728_071660 3300042620 Bacteria 25955
23 Ga0466690_264520 3300042590 Bacteria 31137
24 Ga0466691_065526 3300042593 Bacteria 12371
25 Ga0466696_227170 3300042596 Bacteria 9389
26 Ga0466716_026310 3300042605 Bacteria 16932
27 Ga0466716_318424 3300042605 Bacteria 12350
28 Ga0466719_145993 3300042606 Bacteria 3605
29 Ga0466703_384196 3300042636 Bacteria 5798
30 Ga0466704_513594 3300042643 Unclassified 3029
31 2226980371 2225789003 Bacteria 33112
32 IMNBL1DRAFT_c0002283 3300000062 Bacteria 13508
33 Ga0068305_10020657 3300005083 Bacteria 24279
34 Ga0068305_10021548 3300005083 Bacteria 32392
35 Ga0466705_012645 3300042612 Bacteria 7552
36 Ga0466733_162634 3300042659 Bacteria 12785
37 Ga0466733_186141 3300042659 Bacteria 8487
38 Ga0466711_042337 3300042615 Bacteria 11612
39 Ga0466711_109380 3300042615 Bacteria 31839
40 Ga0466715_083734 3300042616 Bacteria 4289
41 Ga0466715_353013 3300042616 Bacteria 8109
42 Ga0466726_359970 3300042619 Bacteria 3535
43 Ga0466692_147996 3300042591 Bacteria 7875
44 Ga0466693_439199 3300042592 Bacteria 2219
45 Ga0466696_278891 3300042596 Bacteria 171866
46 Ga0466706_031709 3300042599 Bacteria 16740
47 Ga0466707_382222 3300042601 Bacteria 7072
48 Ga0466713_003255 3300042602 Bacteria 2306
49 Ga0466713_108254 3300042602 Bacteria 1769
50 Ga0466703_019316 3300042636 Bacteria 19998
51 Ga0466703_070668 3300042636 Bacteria 9689
52 Ga0466709_215893 3300042648 Bacteria 4855
53 Ga0466725_012412 3300042654 Bacteria 26917
54 Ga0466727_079271 3300042655 Bacteria 1953
55 JGI24702J35022_10002179 3300002462 Bacteria 12067
56 JGI24702J35022_10003838 3300002462 Bacteria 9020
57 Ga0466715_007714 3300042616 Bacteria 20281
58 Ga0466715_037900 3300042616 Bacteria 143938
59 Ga0466715_613585 3300042616 Bacteria 24795
60 Ga0466728_371959 3300042620 Bacteria 5889
61 Ga0466690_106639 3300042590 Bacteria 6486
62 Ga0466692_042425 3300042591 Bacteria 36466
63 Ga0466691_031003 3300042593 Bacteria 14168
64 Ga0466706_135756 3300042599 Bacteria 21184
65 Ga0466706_286866 3300042599 Bacteria 2075
66 Ga0466719_401362 3300042606 Bacteria 6480
67 Ga0466722_146807 3300042609 Bacteria 6613
68 Ga0466703_120191 3300042636 Bacteria 3068
69 Ga0466704_471365 3300042643 Bacteria 37639
70 Ga0466704_472879 3300042643 Bacteria 13574
71 2227610723 2225789004 Bacteria 12124
72 IMNBL1DRAFT_c0001129 3300000062 Bacteria 20460
73 JGI24702J35022_10014451 3300002462 Bacteria 4356
74 JGI24696J40584_12961293 3300002834 Bacteria 13128
75 Ga0123356_10240233 3300010049 Bacteria 1882
76 Ga0466711_117551 3300042615 Bacteria 11311
77 Ga0466723_095121 3300042618 Bacteria 177949
78 Ga0466723_182664 3300042618 Bacteria 13551
79 Ga0466729_123526 3300042621 Bacteria 33019
80 Ga0466690_362030 3300042590 Bacteria 3859
81 Ga0466691_029267 3300042593 Bacteria 26342
82 Ga0466696_044701 3300042596 Bacteria 6094
83 Ga0466706_074381 3300042599 Bacteria 5346
84 Ga0466706_273282 3300042599 Bacteria 15137
85 Ga0466707_048942 3300042601 Bacteria 15157
86 Ga0466707_087813 3300042601 Bacteria 8092
87 Ga0466703_022505 3300042636 Bacteria 6301
88 Ga0466704_082193 3300042643 Bacteria 8478
89 Ga0466704_137469 3300042643 Bacteria 3598
90 Ga0466704_196953 3300042643 Bacteria 20194
91 Ga0466708_013865 3300042652 Bacteria 14920
92 Ga0466708_117511 3300042652 Bacteria 28515
93 Ga0466727_164396 3300042655 Bacteria 6455
94 IMNBL1DRAFT_c0000274 3300000062 Bacteria 45532
95 Ga0466705_031444 3300042612 Bacteria 4054
96 Ga0466711_123903 3300042615 Bacteria 10875
97 Ga0466711_226745 3300042615 Bacteria 1694
98 Ga0466696_168764 3300042596 Bacteria 12119
99 Ga0466706_193517 3300042599 Bacteria 13890
100 Ga0466716_467224 3300042605 Bacteria 5000
101 Ga0466722_059240 3300042609 Bacteria 3293
102 Ga0466722_252060 3300042609 Bacteria 10534
103 Ga0466704_199203 3300042643 Bacteria 10322
104 Ga0466708_086991 3300042652 Bacteria 84818
105 Ga0466727_061283 3300042655 Bacteria 22990
106 JGI24702J35022_10000131 3300002462 Bacteria 37210
107 Ga0466728_261552 3300042620 Bacteria 4625
108 Ga0466696_248480 3300042596 Bacteria 8299
109 Ga0466706_047399 3300042599 Bacteria 1788
110 Ga0466706_098228 3300042599 Bacteria 39742
111 Ga0466722_051355 3300042609 Bacteria 31148
112 Ga0466703_342364 3300042636 Bacteria 6891
113 Ga0466709_334966 3300042648 Bacteria 3081
114 Ga0466727_051963 3300042655 Bacteria 6857
115 IMNBL1DRAFT_c0002159 3300000062 Bacteria 13932
116 Ga0072941_1405744 3300005201 Bacteria 1516
117 Ga0466705_288409 3300042612 Bacteria 9614
118 Ga0466733_202578 3300042659 Bacteria 7510
119 Ga0123356_10099350 3300010049 Bacteria 2789
120 Ga0466723_195534 3300042618 Bacteria 4998
121 Ga0466690_325412 3300042590 Bacteria 27630
122 Ga0466694_184032 3300042594 Bacteria 1628
123 Ga0466696_063686 3300042596 Bacteria 6628
124 Ga0466707_336776 3300042601 Bacteria 6667
125 Ga0466713_149568 3300042602 Bacteria 40583
126 Ga0466714_013813 3300042603 Bacteria 151010
127 Ga0466719_151669 3300042606 Bacteria 4151
128 Ga0466722_090500 3300042609 Bacteria 8166
129 Ga0466703_157676 3300042636 Bacteria 5897
130 Ga0466704_374004 3300042643 Bacteria 15901
131 Ga0466727_207370 3300042655 Bacteria 4735

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_137469 Ga0466704_137469_64_1149 361
2 3300042591 Ga0466692_147996 Ga0466692_147996_20_1144 374
3 3300042636 Ga0466703_120191 Ga0466703_120191_1632_2864 385
4 3300042599 Ga0466706_135756 Ga0466706_135756_4415_5656 388
5 3300042596 Ga0466696_044701 Ga0466696_044701_3686_5119 390
6 3300042659 Ga0466733_202578 Ga0466733_202578_2958_4307 390
7 3300012813 Ga0160470_100005 Ga0160470_100005195 391
8 3300042593 Ga0466691_029267 Ga0466691_029267_4852_6198 392
9 3300002834 JGI24696J40584_12961293 JGI24696J40584_1296129312 393
10 3300042605 Ga0466716_160457 Ga0466716_160457_7112_8392 393
11 3300042605 Ga0466716_467224 Ga0466716_467224_586_1827 393
12 3300042599 Ga0466706_031709 Ga0466706_031709_12002_13249 395
13 3300042659 Ga0466733_162634 Ga0466733_162634_535_1779 395
14 3300002462 JGI24702J35022_10014451 JGI24702J35022_100144511 396
15 3300002462 JGI24702J35022_10037247 JGI24702J35022_100372471 396
16 3300042596 Ga0466696_227170 Ga0466696_227170_6108_7436 396
17 3300042612 Ga0466705_068471 Ga0466705_068471_5468_6718 396
18 3300042599 Ga0466706_047399 Ga0466706_047399_172_1449 397
19 3300042643 Ga0466704_471365 Ga0466704_471365_25650_26939 399
20 3300042596 Ga0466696_168764 Ga0466696_168764_361_1725 400
21 3300042602 Ga0466713_020992 Ga0466713_020992_9773_11026 401
22 3300042655 Ga0466727_164396 Ga0466727_164396_3593_4819 401
23 3300042655 Ga0466727_203052 Ga0466727_203052_3095_4360 401
24 3300005083 Ga0068305_10020657 Ga0068305_1002065717 402
25 3300042599 Ga0466706_098228 Ga0466706_098228_32174_33445 402
26 3300042609 Ga0466722_240768 Ga0466722_240768_12764_13972 402
27 3300042636 Ga0466703_258576 Ga0466703_258576_228_1502 402
28 3300042591 Ga0466692_042425 Ga0466692_042425_11820_13031 403
29 3300042599 Ga0466706_273282 Ga0466706_273282_3154_4416 403
30 3300042599 Ga0466706_286866 Ga0466706_286866_379_1590 403
31 3300042601 Ga0466707_382222 Ga0466707_382222_4920_6131 403
32 3300042609 Ga0466722_051355 Ga0466722_051355_22029_23240 403
33 3300042609 Ga0466722_059240 Ga0466722_059240_1518_2795 403
34 3300042609 Ga0466722_146807 Ga0466722_146807_5097_6308 403
35 3300042620 Ga0466728_071660 Ga0466728_071660_21793_23067 403
36 2225789003 2226980371 2227324778 404
37 3300042602 Ga0466713_003255 Ga0466713_003255_443_1657 404
38 3300042615 Ga0466711_226745 Ga0466711_226745_401_1615 404
39 3300042621 Ga0466729_123526 Ga0466729_123526_335_1549 404
40 3300042652 Ga0466708_013865 Ga0466708_013865_5596_6879 404
41 3300042652 Ga0466708_086991 Ga0466708_086991_36149_37438 404
42 3300000062 IMNBL1DRAFT_c0000274 IMNBL1DRAFT_000027411 405
43 3300000062 IMNBL1DRAFT_c0002283 IMNBL1DRAFT_00022832 405
44 3300005083 Ga0068305_10021548 Ga0068305_100215485 405
45 3300042593 Ga0466691_031003 Ga0466691_031003_3629_4846 405
46 3300042602 Ga0466713_149568 Ga0466713_149568_9832_11088 405
47 3300042615 Ga0466711_042337 Ga0466711_042337_7361_8578 405
48 3300042615 Ga0466711_123903 Ga0466711_123903_6570_7787 405
49 3300042643 Ga0466704_063568 Ga0466704_063568_3495_4787 405
50 3300000062 IMNBL1DRAFT_c0002159 IMNBL1DRAFT_00021596 406
51 3300042599 Ga0466706_193517 Ga0466706_193517_11442_12716 406
52 3300042612 Ga0466705_116524 Ga0466705_116524_16_1236 406
53 3300042655 Ga0466727_051963 Ga0466727_051963_2259_3602 406
54 3300042592 Ga0466693_439199 Ga0466693_439199_132_1511 407
55 3300042594 Ga0466694_184032 Ga0466694_184032_275_1558 407
56 3300042601 Ga0466707_087813 Ga0466707_087813_508_1800 407
57 3300042615 Ga0466711_008567 Ga0466711_008567_11139_12362 407
58 3300042616 Ga0466715_353013 Ga0466715_353013_3918_5201 407
59 3300042618 Ga0466723_182664 Ga0466723_182664_5305_6624 407
60 3300002462 JGI24702J35022_10000131 JGI24702J35022_100001314 408
61 3300042590 Ga0466690_362030 Ga0466690_362030_1579_2805 408
62 3300042601 Ga0466707_048942 Ga0466707_048942_7304_8593 408
63 3300042605 Ga0466716_026310 Ga0466716_026310_229_1455 408
64 3300042605 Ga0466716_318424 Ga0466716_318424_9031_10257 408
65 3300042606 Ga0466719_151669 Ga0466719_151669_2534_3760 408
66 3300042615 Ga0466711_109380 Ga0466711_109380_25454_26680 408
67 3300042615 Ga0466711_117551 Ga0466711_117551_6123_7349 408
68 3300042616 Ga0466715_007714 Ga0466715_007714_12835_14061 408
69 3300042616 Ga0466715_037900 Ga0466715_037900_32842_34068 408
70 3300042618 Ga0466723_195534 Ga0466723_195534_118_1344 408
71 3300042636 Ga0466703_019316 Ga0466703_019316_15311_16537 408
72 3300042636 Ga0466703_022505 Ga0466703_022505_1878_3104 408
73 3300042636 Ga0466703_342364 Ga0466703_342364_1370_2596 408
74 3300042643 Ga0466704_196953 Ga0466704_196953_12430_13656 408
75 3300042648 Ga0466709_334966 Ga0466709_334966_362_1639 408
76 3300042593 Ga0466691_065526 Ga0466691_065526_10069_11298 409
77 3300042599 Ga0466706_174110 Ga0466706_174110_61427_62710 409
78 3300042616 Ga0466715_567151 Ga0466715_567151_32931_34217 409
79 3300042636 Ga0466703_070668 Ga0466703_070668_5472_6764 410
80 3300042636 Ga0466703_384196 Ga0466703_384196_4152_5399 410
81 3300042643 Ga0466704_513594 Ga0466704_513594_1369_2661 410
82 3300042659 Ga0466733_025416 Ga0466733_025416_172985_174277 410
83 3300010049 Ga0123356_10099350 Ga0123356_100993502 411
84 3300042654 Ga0466725_012412 Ga0466725_012412_7907_9142 411
85 3300042619 Ga0466726_359970 Ga0466726_359970_250_1533 412
86 3300042590 Ga0466690_264520 Ga0466690_264520_22411_23652 413
87 3300042618 Ga0466723_095121 Ga0466723_095121_98582_99823 413
88 iso_pr_bacteria 2940195863 2940198512 413
89 iso_pr_bacteria 3004667792 3004670995 413
90 3300042603 Ga0466714_013813 Ga0466714_013813_120411_121685 414
91 3300042648 Ga0466709_215893 Ga0466709_215893_59_1303 414
92 3300042655 Ga0466727_061283 Ga0466727_061283_15901_17205 414
93 3300002462 JGI24702J35022_10003838 JGI24702J35022_100038385 415
94 3300010049 Ga0123356_10240233 Ga0123356_102402332 416
95 3300042602 Ga0466713_041582 Ga0466713_041582_29561_30811 416
96 3300042659 Ga0466733_186141 Ga0466733_186141_323_1606 416
97 iso_pr_bacteria 2922326829 2922329978 416
98 3300000062 IMNBL1DRAFT_c0001129 IMNBL1DRAFT_000112910 417
99 3300005201 Ga0072941_1405744 Ga0072941_14057441 417
100 3300042612 Ga0466705_288409 Ga0466705_288409_730_1983 417
101 3300010167 Ga0123353_10573030 Ga0123353_105730302 418
102 3300042606 Ga0466719_145993 Ga0466719_145993_1239_2564 418
103 3300042620 Ga0466728_371959 Ga0466728_371959_4225_5481 418
104 iso_pr_bacteria 2923982719 2923984327 418
105 iso_pr_bacteria 2940371297 2940372002 418
106 3300042596 Ga0466696_248480 Ga0466696_248480_6107_7528 419
107 3300042602 Ga0466713_108254 Ga0466713_108254_421_1680 419
108 3300042609 Ga0466722_090500 Ga0466722_090500_662_1921 419
109 3300042616 Ga0466715_083734 Ga0466715_083734_28_1287 419
110 3300042655 Ga0466727_079271 Ga0466727_079271_501_1760 419
111 iso_pr_bacteria 2940199050 2940200824 419
112 iso_pr_bacteria 2940346213 2940347672 419
113 3300042590 Ga0466690_249215 Ga0466690_249215_6277_7542 421
114 3300042599 Ga0466706_074381 Ga0466706_074381_2952_4232 421
115 3300042652 Ga0466708_117511 Ga0466708_117511_11255_12520 421
116 3300042590 Ga0466690_253817 Ga0466690_253817_3275_4627 422
117 3300042596 Ga0466696_278891 Ga0466696_278891_156803_158071 422
118 3300042612 Ga0466705_460664 Ga0466705_460664_3033_4301 422
119 3300042596 Ga0466696_063686 Ga0466696_063686_4364_5635 423
120 3300042605 Ga0466716_432952 Ga0466716_432952_6083_7354 423
121 iso_pr_bacteria 2940205530 2940205922 423
122 iso_pr_bacteria 2940212447 2940212837 423
123 iso_pr_bacteria 2940298504 2940298894 423
124 iso_pr_bacteria 2940302308 2940302698 423
125 iso_pr_bacteria 2940306115 2940309246 423
126 iso_pr_bacteria 2940309933 2940313083 423
127 iso_pr_bacteria 2940313741 2940316897 423
128 iso_pr_bacteria 2940317558 2940320711 423
129 iso_pr_bacteria 2940321370 2940324468 423
130 iso_pr_bacteria 2940325180 2940325186 423
131 iso_pr_bacteria 2940328985 2940328991 423
132 iso_pr_bacteria 2940332795 2940335949 423
133 3300042590 Ga0466690_325412 Ga0466690_325412_21563_22837 424
134 3300042616 Ga0466715_613585 Ga0466715_613585_6762_8036 424
135 3300042643 Ga0466704_082193 Ga0466704_082193_4765_6039 424
136 3300042643 Ga0466704_199203 Ga0466704_199203_1448_2722 424
137 3300042643 Ga0466704_374004 Ga0466704_374004_12016_13290 424
138 iso_pr_bacteria 2940202316 2940204202 424
139 3300042620 Ga0466728_261552 Ga0466728_261552_2076_3356 426
140 3300042636 Ga0466703_157676 Ga0466703_157676_822_2102 426
141 3300042590 Ga0466690_106639 Ga0466690_106639_1717_3000 427
142 3300042609 Ga0466722_252060 Ga0466722_252060_4334_5722 427
143 2225789004 2227610723 2228182352 428
144 3300042606 Ga0466719_401362 Ga0466719_401362_1022_2308 428
145 3300042655 Ga0466727_207370 Ga0466727_207370_1138_2424 428
146 3300042612 Ga0466705_031444 Ga0466705_031444_2683_3972 429
147 3300042612 Ga0466705_012645 Ga0466705_012645_582_1877 431
148 3300042615 Ga0466711_073380 Ga0466711_073380_4412_5707 431
149 3300002462 JGI24702J35022_10002179 JGI24702J35022_100021797 432
150 3300042601 Ga0466707_336776 Ga0466707_336776_3971_5275 434
151 3300042643 Ga0466704_472879 Ga0466704_472879_3092_4399 435

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00271 Helicase_C Helicase conserved C-terminal domain 234 339 0.91
PF00270 DEAD DEAD/DEAH box helicase 25 197 0.9
PF04851 ResIII Type III restriction enzyme, res subunit 38 192 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.