Protein Family IF10327
Metagenome
Isolate
122
Members
47
Samples
115
Scaffolds
210.32
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_130577|Ga0466733_130577_13514_14284
- Length
- 244 aa
- Sequence
- MEVKKPKIKSIRYEEFNDNEYLENMVKELNANGTNVLIGVLDDVVNWGRSNSLWPLTFATSCCGIEYMAVGAARYDFARFGFEVTRASPRQADFIMVAGTITDKMAPVLKRLYDQMADPKYVIAIGACAVSGGPFKKSYHVVNGVDKILPVDVYVPGCPPRPEAMLYGIIQLQRKVKVEKFFGGVNKQVKNAEYERLMEEQSRLERQGCFDPEFLDGELHGCEPAIKGDLMTKPAEHEQDTGNK
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Kalotermitidae
27.7%
Unclassified
14.9%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Passalidae
4.3%
Blattidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 5 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 19 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 41 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10015964 | 3300009784 | Bacteria | 9862 |
| 2 | Ga0123356_10965447 | 3300010049 | Bacteria | 1023 |
| 3 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 4 | Ga0466711_008482 | 3300042615 | Bacteria | 9471 |
| 5 | Ga0466711_037672 | 3300042615 | Bacteria | 7262 |
| 6 | Ga0466711_091216 | 3300042615 | Bacteria | 7257 |
| 7 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 8 | IMNBL1DRAFT_c0002877 | 3300000062 | Bacteria | 11540 |
| 9 | IMNBL1DRAFT_c0051029 | 3300000062 | Bacteria | 1306 |
| 10 | Ga0466707_233145 | 3300042601 | Bacteria | 2121 |
| 11 | Ga0466713_083302 | 3300042602 | Bacteria | 19866 |
| 12 | Ga0466716_244511 | 3300042605 | Bacteria | 11044 |
| 13 | Ga0466735_090278 | 3300042624 | Bacteria | 3196 |
| 14 | Ga0466703_167618 | 3300042636 | Bacteria | 10138 |
| 15 | Ga0466704_186597 | 3300042643 | Bacteria | 3823 |
| 16 | Ga0466704_396717 | 3300042643 | Bacteria | 26428 |
| 17 | Ga0466727_065684 | 3300042655 | Bacteria | 2505 |
| 18 | Ga0466727_167278 | 3300042655 | Bacteria | 64897 |
| 19 | Ga0123356_10838245 | 3300010049 | Bacteria | 1091 |
| 20 | Ga0123353_10154635 | 3300010167 | Bacteria | 3658 |
| 21 | Ga0123353_10416902 | 3300010167 | Bacteria | 1991 |
| 22 | Ga0466692_063786 | 3300042591 | Bacteria | 32372 |
| 23 | Ga0466711_171443 | 3300042615 | Unclassified | 2271 |
| 24 | Ga0466715_176999 | 3300042616 | Bacteria | 6557 |
| 25 | Ga0466715_351050 | 3300042616 | Bacteria | 23393 |
| 26 | Ga0466728_183857 | 3300042620 | Bacteria | 4473 |
| 27 | Ga0466722_237599 | 3300042609 | Bacteria | 4902 |
| 28 | Ga0466702_133169 | 3300042635 | Bacteria | 1099 |
| 29 | Ga0466709_245110 | 3300042648 | Bacteria | 22256 |
| 30 | Ga0466708_290083 | 3300042652 | Bacteria | 3901 |
| 31 | Ga0466727_021040 | 3300042655 | Bacteria | 7971 |
| 32 | Ga0466727_180639 | 3300042655 | Bacteria | 5143 |
| 33 | Ga0466727_334432 | 3300042655 | Bacteria | 3455 |
| 34 | Ga0123353_11343793 | 3300010167 | Bacteria | 924 |
| 35 | Ga0466694_016389 | 3300042594 | Bacteria | 1415 |
| 36 | Ga0466696_286508 | 3300042596 | Bacteria | 7879 |
| 37 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 38 | Ga0123357_10002924 | 3300009784 | Bacteria | 19286 |
| 39 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 40 | Ga0466701_098207 | 3300042598 | Bacteria | 13365 |
| 41 | Ga0466707_106706 | 3300042601 | Bacteria | 2240 |
| 42 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 43 | Ga0466703_418314 | 3300042636 | Bacteria | 2434 |
| 44 | Ga0466704_142594 | 3300042643 | Bacteria | 6642 |
| 45 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 46 | Ga0123354_10240708 | 3300010882 | Bacteria | 1862 |
| 47 | Ga0466690_005110 | 3300042590 | Bacteria | 14539 |
| 48 | Ga0466715_403844 | 3300042616 | Bacteria | 18417 |
| 49 | Ga0466723_094954 | 3300042618 | Bacteria | 8294 |
| 50 | 2227265259 | 2225789004 | Bacteria | 1290 |
| 51 | Ga0466707_075430 | 3300042601 | Bacteria | 1530 |
| 52 | Ga0466707_094849 | 3300042601 | Bacteria | 5976 |
| 53 | Ga0466731_428057 | 3300042622 | Unclassified | 1080 |
| 54 | Ga0466735_064452 | 3300042624 | Bacteria | 1315 |
| 55 | Ga0466735_100070 | 3300042624 | Bacteria | 6650 |
| 56 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 57 | Ga0466705_032844 | 3300042612 | Bacteria | 18355 |
| 58 | Ga0123353_10073829 | 3300010167 | Bacteria | 5483 |
| 59 | Ga0466729_148330 | 3300042621 | Bacteria | 4854 |
| 60 | 2227376385 | 2225789004 | Unclassified | 1105 |
| 61 | JGI24702J35022_10038789 | 3300002462 | Bacteria | 2543 |
| 62 | Ga0466706_005003 | 3300042599 | Bacteria | 88622 |
| 63 | Ga0466707_093237 | 3300042601 | Bacteria | 19367 |
| 64 | Ga0466707_292031 | 3300042601 | Bacteria | 25024 |
| 65 | Ga0466707_359464 | 3300042601 | Bacteria | 15596 |
| 66 | Ga0466707_404068 | 3300042601 | Bacteria | 3494 |
| 67 | Ga0466719_388414 | 3300042606 | Bacteria | 11249 |
| 68 | Ga0466735_008935 | 3300042624 | Bacteria | 1942 |
| 69 | Ga0466704_019741 | 3300042643 | Bacteria | 2133 |
| 70 | Ga0466709_231759 | 3300042648 | Bacteria | 5441 |
| 71 | Ga0466725_079292 | 3300042654 | Bacteria | 1335 |
| 72 | Ga0466705_111152 | 3300042612 | Bacteria | 15328 |
| 73 | Ga0123353_10509141 | 3300010167 | Bacteria | 1751 |
| 74 | Ga0466696_115856 | 3300042596 | Bacteria | 3586 |
| 75 | Ga0466696_117540 | 3300042596 | Bacteria | 4651 |
| 76 | IMNBL1DRAFT_c0000105 | 3300000062 | Bacteria | 74361 |
| 77 | IMNBL1DRAFT_c0058719 | 3300000062 | Bacteria | 1167 |
| 78 | Ga0466706_283748 | 3300042599 | Bacteria | 2235 |
| 79 | Ga0466716_539568 | 3300042605 | Bacteria | 9234 |
| 80 | Ga0466719_012506 | 3300042606 | Bacteria | 11641 |
| 81 | Ga0466722_225350 | 3300042609 | Bacteria | 6032 |
| 82 | Ga0466735_012272 | 3300042624 | Bacteria | 13363 |
| 83 | Ga0466735_108960 | 3300042624 | Bacteria | 1260 |
| 84 | Ga0466735_178283 | 3300042624 | Bacteria | 4947 |
| 85 | Ga0466703_275677 | 3300042636 | Bacteria | 16696 |
| 86 | Ga0466656_064781 | 3300042550 | Bacteria | 21643 |
| 87 | Ga0466694_172365 | 3300042594 | Bacteria | 5807 |
| 88 | Ga0466696_066752 | 3300042596 | Bacteria | 1918 |
| 89 | Ga0466711_207811 | 3300042615 | Bacteria | 2195 |
| 90 | Ga0466711_427983 | 3300042615 | Unclassified | 1541 |
| 91 | Ga0466723_092051 | 3300042618 | Bacteria | 16294 |
| 92 | Ga0466726_481304 | 3300042619 | Bacteria | 2332 |
| 93 | 2227548516 | 2225789004 | Bacteria | 2887 |
| 94 | Ga0466706_021075 | 3300042599 | Bacteria | 16026 |
| 95 | Ga0466700_032619 | 3300042600 | Bacteria | 5166 |
| 96 | Ga0466707_323672 | 3300042601 | Bacteria | 13232 |
| 97 | Ga0466716_371367 | 3300042605 | Bacteria | 12791 |
| 98 | Ga0466731_105697 | 3300042622 | Bacteria | 2851 |
| 99 | Ga0466705_293721 | 3300042612 | Unclassified | 1620 |
| 100 | Ga0466733_130577 | 3300042659 | Bacteria | 17591 |
| 101 | Ga0123356_10154068 | 3300010049 | Bacteria | 2286 |
| 102 | Ga0466692_139916 | 3300042591 | Bacteria | 4146 |
| 103 | Ga0466696_026812 | 3300042596 | Bacteria | 27611 |
| 104 | Ga0466696_151083 | 3300042596 | Bacteria | 1241 |
| 105 | Ga0466699_077001 | 3300042597 | Bacteria | 2469 |
| 106 | Ga0466715_028762 | 3300042616 | Bacteria | 3767 |
| 107 | Ga0466726_031616 | 3300042619 | Bacteria | 2295 |
| 108 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 109 | Ga0466716_264400 | 3300042605 | Bacteria | 2576 |
| 110 | Ga0466722_156750 | 3300042609 | Bacteria | 2042 |
| 111 | Ga0466730_038353 | 3300042625 | Bacteria | 1383 |
| 112 | Ga0466704_243988 | 3300042643 | Bacteria | 3526 |
| 113 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 114 | Ga0466708_114504 | 3300042652 | Bacteria | 16711 |
| 115 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042605 | Ga0466716_539568 | Ga0466716_539568_6930_7571 | 196 |
| 2 | 3300042654 | Ga0466725_079292 | Ga0466725_079292_24_614 | 196 |
| 3 | 3300010167 | Ga0123353_11343793 | Ga0123353_113437932 | 197 |
| 4 | 3300042599 | Ga0466706_005003 | Ga0466706_005003_68265_68858 | 197 |
| 5 | 3300042599 | Ga0466706_021075 | Ga0466706_021075_2176_2769 | 197 |
| 6 | 3300042615 | Ga0466711_008482 | Ga0466711_008482_4479_5072 | 197 |
| 7 | 3300042601 | Ga0466707_075430 | Ga0466707_075430_501_1148 | 198 |
| 8 | iso_pr_bacteria | 2609459943 | 2610742015 | 198 |
| 9 | iso_pr_bacteria | 2830041218 | 2830044152 | 198 |
| 10 | 3300042602 | Ga0466713_083302 | Ga0466713_083302_7550_8149 | 199 |
| 11 | 3300042619 | Ga0466726_481304 | Ga0466726_481304_1710_2309 | 199 |
| 12 | 3300010167 | Ga0123353_10154635 | Ga0123353_101546352 | 200 |
| 13 | 3300010167 | Ga0123353_10416902 | Ga0123353_104169022 | 200 |
| 14 | 3300042590 | Ga0466690_005110 | Ga0466690_005110_6379_6981 | 200 |
| 15 | 3300042594 | Ga0466694_172365 | Ga0466694_172365_3599_4201 | 200 |
| 16 | 3300042615 | Ga0466711_037672 | Ga0466711_037672_5902_6504 | 200 |
| 17 | 3300042652 | Ga0466708_114504 | Ga0466708_114504_14557_15159 | 200 |
| 18 | 3300042654 | Ga0466725_210063 | Ga0466725_210063_10647_11249 | 200 |
| 19 | 3300042591 | Ga0466692_139916 | Ga0466692_139916_1483_2088 | 201 |
| 20 | 3300042596 | Ga0466696_117540 | Ga0466696_117540_2452_3057 | 201 |
| 21 | 3300042615 | Ga0466711_171443 | Ga0466711_171443_1147_1791 | 201 |
| 22 | 3300010049 | Ga0123356_10154068 | Ga0123356_101540683 | 202 |
| 23 | 3300042606 | Ga0466719_012506 | Ga0466719_012506_10465_11073 | 202 |
| 24 | 3300042612 | Ga0466705_111152 | Ga0466705_111152_5158_5766 | 202 |
| 25 | 3300042616 | Ga0466715_028762 | Ga0466715_028762_1498_2106 | 202 |
| 26 | 3300042616 | Ga0466715_176999 | Ga0466715_176999_3580_4188 | 202 |
| 27 | 3300042618 | Ga0466723_092051 | Ga0466723_092051_9364_9972 | 202 |
| 28 | 3300002462 | JGI24702J35022_10038789 | JGI24702J35022_100387892 | 203 |
| 29 | 3300042636 | Ga0466703_140271 | Ga0466703_140271_17086_17697 | 203 |
| 30 | iso_pr_bacteria | 2820778767 | 2820780871 | 203 |
| 31 | 3300009784 | Ga0123357_10015964 | Ga0123357_100159644 | 204 |
| 32 | 3300010049 | Ga0123356_10965447 | Ga0123356_109654472 | 204 |
| 33 | 3300010882 | Ga0123354_10240708 | Ga0123354_102407082 | 204 |
| 34 | 3300042620 | Ga0466728_183857 | Ga0466728_183857_3398_4012 | 204 |
| 35 | 3300042624 | Ga0466735_100070 | Ga0466735_100070_5654_6268 | 204 |
| 36 | 3300042597 | Ga0466699_077001 | Ga0466699_077001_722_1339 | 205 |
| 37 | 3300042605 | Ga0466716_371367 | Ga0466716_371367_3203_3820 | 205 |
| 38 | 3300042606 | Ga0466719_388414 | Ga0466719_388414_9781_10398 | 205 |
| 39 | 3300042643 | Ga0466704_396717 | Ga0466704_396717_714_1331 | 205 |
| 40 | 3300042550 | Ga0466656_064781 | Ga0466656_064781_5843_6463 | 206 |
| 41 | 3300042643 | Ga0466704_142594 | Ga0466704_142594_4061_4681 | 206 |
| 42 | 3300042643 | Ga0466704_186597 | Ga0466704_186597_246_866 | 206 |
| 43 | 3300010049 | Ga0123356_10838245 | Ga0123356_108382452 | 207 |
| 44 | 3300010167 | Ga0123353_10509141 | Ga0123353_105091412 | 207 |
| 45 | 3300042596 | Ga0466696_066752 | Ga0466696_066752_801_1424 | 207 |
| 46 | 3300042598 | Ga0466701_098080 | Ga0466701_098080_46392_47057 | 207 |
| 47 | 3300042612 | Ga0466705_335658 | Ga0466705_335658_22243_22866 | 207 |
| 48 | 3300042625 | Ga0466730_038353 | Ga0466730_038353_569_1192 | 207 |
| 49 | 3300042636 | Ga0466703_275677 | Ga0466703_275677_10846_11469 | 207 |
| 50 | 3300042655 | Ga0466727_180639 | Ga0466727_180639_1383_2006 | 207 |
| 51 | 3300042596 | Ga0466696_115856 | Ga0466696_115856_1720_2346 | 208 |
| 52 | 3300042601 | Ga0466707_404068 | Ga0466707_404068_1955_2581 | 208 |
| 53 | 3300042616 | Ga0466715_608206 | Ga0466715_608206_28924_29550 | 208 |
| 54 | 3300042624 | Ga0466735_008935 | Ga0466735_008935_528_1154 | 208 |
| 55 | 3300042624 | Ga0466735_012272 | Ga0466735_012272_3925_4551 | 208 |
| 56 | iso_pr_bacteria | 2820757377 | 2820759765 | 208 |
| 57 | iso_pr_bacteria | 2820762746 | 2820763182 | 208 |
| 58 | iso_pr_bacteria | 2940216256 | 2940217636 | 208 |
| 59 | 3300042601 | Ga0466707_323672 | Ga0466707_323672_2802_3431 | 209 |
| 60 | 3300042601 | Ga0466707_359464 | Ga0466707_359464_866_1495 | 209 |
| 61 | 3300042615 | Ga0466711_091216 | Ga0466711_091216_380_1009 | 209 |
| 62 | 3300042624 | Ga0466735_064452 | Ga0466735_064452_365_994 | 209 |
| 63 | 3300042624 | Ga0466735_090278 | Ga0466735_090278_1850_2479 | 209 |
| 64 | 3300042655 | Ga0466727_000612 | Ga0466727_000612_1669_2298 | 209 |
| 65 | 3300042612 | Ga0466705_032844 | Ga0466705_032844_4295_4927 | 210 |
| 66 | 3300042643 | Ga0466704_602482 | Ga0466704_602482_2129_2761 | 210 |
| 67 | 3300042599 | Ga0466706_283748 | Ga0466706_283748_1154_1789 | 211 |
| 68 | 3300042635 | Ga0466702_133169 | Ga0466702_133169_121_756 | 211 |
| 69 | 3300000062 | IMNBL1DRAFT_c0002877 | IMNBL1DRAFT_00028779 | 212 |
| 70 | 3300042600 | Ga0466700_032619 | Ga0466700_032619_2391_3053 | 212 |
| 71 | 3300042601 | Ga0466707_094849 | Ga0466707_094849_4221_4859 | 212 |
| 72 | 3300042621 | Ga0466729_096704 | Ga0466729_096704_10264_10902 | 212 |
| 73 | 3300042636 | Ga0466703_167618 | Ga0466703_167618_1335_1973 | 212 |
| 74 | 3300042648 | Ga0466709_231759 | Ga0466709_231759_4048_4686 | 212 |
| 75 | 3300042652 | Ga0466708_290083 | Ga0466708_290083_2847_3485 | 212 |
| 76 | 2225789004 | 2227265259 | 2227712672 | 213 |
| 77 | 2225789004 | 2227376385 | 2227822406 | 213 |
| 78 | 2225789004 | 2227548516 | 2228076073 | 213 |
| 79 | 3300000062 | IMNBL1DRAFT_c0058719 | IMNBL1DRAFT_00587192 | 213 |
| 80 | 3300042591 | Ga0466692_063786 | Ga0466692_063786_27821_28492 | 213 |
| 81 | 3300042596 | Ga0466696_151083 | Ga0466696_151083_15_656 | 213 |
| 82 | 3300042616 | Ga0466715_403844 | Ga0466715_403844_3418_4059 | 213 |
| 83 | iso_pr_bacteria | 2820759988 | 2820762544 | 213 |
| 84 | 3300000062 | IMNBL1DRAFT_c0051029 | IMNBL1DRAFT_00510292 | 214 |
| 85 | 3300002509 | JGI24699J35502_11134224 | JGI24699J35502_1113422440 | 214 |
| 86 | 3300009784 | Ga0123357_10002924 | Ga0123357_100029242 | 214 |
| 87 | 3300042605 | Ga0466716_244511 | Ga0466716_244511_3341_3985 | 214 |
| 88 | 3300042616 | Ga0466715_351050 | Ga0466715_351050_19621_20265 | 214 |
| 89 | 3300042648 | Ga0466709_245110 | Ga0466709_245110_16812_17456 | 214 |
| 90 | 3300000062 | IMNBL1DRAFT_c0000105 | IMNBL1DRAFT_000010542 | 215 |
| 91 | 3300042605 | Ga0466716_264400 | Ga0466716_264400_742_1389 | 215 |
| 92 | 3300042612 | Ga0466705_293721 | Ga0466705_293721_198_845 | 215 |
| 93 | 3300042598 | Ga0466701_098207 | Ga0466701_098207_6853_7503 | 216 |
| 94 | 3300042596 | Ga0466696_026812 | Ga0466696_026812_18100_18753 | 217 |
| 95 | 3300042609 | Ga0466722_225350 | Ga0466722_225350_4777_5430 | 217 |
| 96 | 3300042621 | Ga0466729_148330 | Ga0466729_148330_1046_1699 | 217 |
| 97 | 3300042624 | Ga0466735_108960 | Ga0466735_108960_24_710 | 217 |
| 98 | 3300042643 | Ga0466704_019741 | Ga0466704_019741_1376_2029 | 217 |
| 99 | 3300042643 | Ga0466704_243988 | Ga0466704_243988_2107_2760 | 217 |
| 100 | 3300042590 | Ga0466690_149899 | Ga0466690_149899_8166_8879 | 218 |
| 101 | 3300042601 | Ga0466707_093237 | Ga0466707_093237_8360_9016 | 218 |
| 102 | 3300042609 | Ga0466722_156750 | Ga0466722_156750_1216_1872 | 218 |
| 103 | 3300042622 | Ga0466731_428057 | Ga0466731_428057_57_713 | 218 |
| 104 | 3300010167 | Ga0123353_10073829 | Ga0123353_100738293 | 220 |
| 105 | 3300042594 | Ga0466694_016389 | Ga0466694_016389_264_926 | 220 |
| 106 | 3300042622 | Ga0466731_105697 | Ga0466731_105697_646_1308 | 220 |
| 107 | 3300042601 | Ga0466707_233145 | Ga0466707_233145_1111_1776 | 221 |
| 108 | 3300042636 | Ga0466703_418314 | Ga0466703_418314_1430_2095 | 221 |
| 109 | 3300042655 | Ga0466727_021040 | Ga0466727_021040_5548_6213 | 221 |
| 110 | 3300042609 | Ga0466722_237599 | Ga0466722_237599_1929_2597 | 222 |
| 111 | 3300042619 | Ga0466726_031616 | Ga0466726_031616_1066_1734 | 222 |
| 112 | 3300042655 | Ga0466727_334432 | Ga0466727_334432_974_1642 | 222 |
| 113 | 3300042655 | Ga0466727_167278 | Ga0466727_167278_21022_21693 | 223 |
| 114 | 3300042601 | Ga0466707_292031 | Ga0466707_292031_23946_24620 | 224 |
| 115 | 3300042618 | Ga0466723_094954 | Ga0466723_094954_4455_5132 | 225 |
| 116 | 3300042655 | Ga0466727_065684 | Ga0466727_065684_907_1590 | 227 |
| 117 | 3300042615 | Ga0466711_207811 | Ga0466711_207811_560_1246 | 228 |
| 118 | 3300042615 | Ga0466711_427983 | Ga0466711_427983_295_981 | 228 |
| 119 | 3300042601 | Ga0466707_106706 | Ga0466707_106706_104_799 | 231 |
| 120 | 3300042624 | Ga0466735_178283 | Ga0466735_178283_827_1522 | 231 |
| 121 | 3300042596 | Ga0466696_286508 | Ga0466696_286508_3245_3943 | 232 |
| 122 | 3300042659 | Ga0466733_130577 | Ga0466733_130577_13514_14284 | 244 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01058 | Oxidored_q6 | NADH ubiquinone oxidoreductase, 20 Kd subunit | 62 | 172 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01058 | GO:0051536 | iron-sulfur cluster binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.56 | 0.73 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.