Protein Family IF10320

Metagenome Isolate
165 Members
54 Samples
153 Scaffolds
249.92 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_112100|Ga0466733_112100_30_917
Length
295 aa
Sequence
VQCGAGSQKKVRYSFGVTAPQVILLTASRIRLYNVLKGAFMISYHGTDANFSLEGKIAIITGGAAGIGNATAEFFAKKGVNLVLADLNPNVDAAAKKLGPKNIGVSGDVCNAAYRKSVIDAGVKTFGKIDILVNSAGIVALEKAEAISEDFWNRTININLTASFMMAQVFGAYLIENKSPGSIVNIASQAGVIALDKHVAYCASKGGIISMTQVLALEWGKYGIRVNCVSPTVVLTELGHKAWDGPAGDAFKKEVPAERFAEPDEIASVIAFLCSQNAAMITGHNLLIDGGYTIK

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.1%
Kalotermitidae 26.4%
Unclassified 15.1%
Blattidae 7.5%
Rhinotermitidae 5.7%
Termopsidae 5.7%
Passalidae 3.8%
Armadillidiidae 1.9%
Culicidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
2 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
3 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
13 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
26 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
35 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
49 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_003217 3300042612 Bacteria 1342
2 Ga0466733_151573 3300042659 Bacteria 2463
3 Ga0466694_403587 3300042594 Bacteria 2357
4 Ga0466696_447669 3300042596 Bacteria 8481
5 Ga0123355_10146001 3300009826 Bacteria 3607
6 Ga0123356_10054229 3300010049 Bacteria 3734
7 Ga0123356_10064261 3300010049 Bacteria 3431
8 Ga0466711_423257 3300042615 Bacteria 16199
9 Ga0466715_166601 3300042616 Bacteria 13126
10 Ga0466723_335808 3300042618 Bacteria 17709
11 Ga0466728_244653 3300042620 Bacteria 23007
12 Ga0466703_170737 3300042636 Bacteria 1908
13 Ga0466703_297967 3300042636 Bacteria 2368
14 Ga0466703_337284 3300042636 Bacteria 10215
15 Ga0466709_024280 3300042648 Bacteria 10006
16 Ga0466727_165421 3300042655 Bacteria 1357
17 Ga0466714_133428 3300042603 Bacteria 1234
18 Ga0466716_334100 3300042605 Bacteria 6865
19 Ga0466722_197322 3300042609 Bacteria 3276
20 Ga0466697_225052 3300042611 Bacteria 1456
21 Ga0160436_1008124 3300012861 Bacteria 2375
22 Ga0466693_188007 3300042592 Bacteria 12515
23 Ga0466691_040484 3300042593 Bacteria 10503
24 Ga0466691_146581 3300042593 Bacteria 2477
25 Ga0466696_172317 3300042596 Bacteria 3457
26 Ga0466696_386114 3300042596 Bacteria 10545
27 Ga0123354_10234552 3300010882 Bacteria 1907
28 Ga0123354_10302148 3300010882 Bacteria 1512
29 Ga0466728_012520 3300042620 Bacteria 5349
30 Ga0466735_089162 3300042624 Bacteria 3448
31 Ga0466704_159497 3300042643 Bacteria 4879
32 Ga0466709_205157 3300042648 Unclassified 2326
33 Ga0466708_282228 3300042652 Bacteria 5807
34 Ga0466727_105970 3300042655 Bacteria 2682
35 Ga0466727_214238 3300042655 Unclassified 2063
36 Ga0466719_050240 3300042606 Bacteria 4664
37 Ga0466719_387795 3300042606 Bacteria 4855
38 Ga0466720_009917 3300042607 Bacteria 21943
39 Ga0466720_133393 3300042607 Bacteria 3059
40 Ga0466722_109879 3300042609 Bacteria 6565
41 Ga0466722_229342 3300042609 Bacteria 6009
42 Ga0074263_112815 3300005485 Unclassified 1160
43 Ga0466705_078997 3300042612 Unclassified 8714
44 Ga0466705_358466 3300042612 Bacteria 28470
45 Ga0466733_112100 3300042659 Bacteria 1084
46 Ga0466733_159365 3300042659 Bacteria 1028
47 Ga0466693_038556 3300042592 Bacteria 4343
48 Ga0466691_051253 3300042593 Bacteria 1864
49 Ga0466696_014778 3300042596 Bacteria 2221
50 Ga0123356_10046608 3300010049 Unclassified 4034
51 Ga0466705_513318 3300042612 Unclassified 2804
52 Ga0466711_203726 3300042615 Bacteria 10162
53 Ga0466723_072790 3300042618 Bacteria 4201
54 Ga0466723_129696 3300042618 Bacteria 10782
55 Ga0466723_300461 3300042618 Bacteria 2323
56 Ga0466726_374699 3300042619 Archaea 1613
57 Ga0466726_450643 3300042619 Bacteria 1404
58 Ga0466704_378199 3300042643 Bacteria 5754
59 Ga0466708_198459 3300042652 Bacteria 4031
60 IMNBL1DRAFT_c0036189 3300000062 Bacteria 1727
61 Ga0466732_108002 3300042656 Bacteria 31448
62 Ga0466696_191067 3300042596 Bacteria 1731
63 Ga0123357_10048219 3300009784 Bacteria 5772
64 Ga0123357_10081083 3300009784 Bacteria 4266
65 Ga0123353_10358645 3300010167 Bacteria 2192
66 Ga0466723_038665 3300042618 Bacteria 29336
67 Ga0466726_318933 3300042619 Bacteria 1412
68 Ga0466703_004099 3300042636 Bacteria 5306
69 Ga0466703_243376 3300042636 Bacteria 14739
70 Ga0466704_096871 3300042643 Bacteria 30593
71 Ga0466709_254615 3300042648 Bacteria 7118
72 Ga0466708_237342 3300042652 Bacteria 8970
73 Ga0466707_276400 3300042601 Bacteria 6533
74 Ga0466707_292596 3300042601 Bacteria 1719
75 Ga0466707_304206 3300042601 Bacteria 2851
76 Ga0466707_386056 3300042601 Bacteria 2109
77 Ga0466716_000191 3300042605 Bacteria 6614
78 JGI24695J34938_10012402 3300002450 Bacteria 4517
79 Ga0466705_313083 3300042612 Bacteria 7575
80 Ga0466732_081567 3300042656 Bacteria 4000
81 Ga0466733_001606 3300042659 Bacteria 14315
82 Ga0466733_122961 3300042659 Unclassified 4160
83 Ga0466733_219806 3300042659 Bacteria 2341
84 Ga0466690_357067 3300042590 Bacteria 6648
85 Ga0466691_015854 3300042593 Bacteria 6654
86 Ga0466691_224686 3300042593 Bacteria 13594
87 Ga0123353_10370030 3300010167 Bacteria 2149
88 Ga0466705_427665 3300042612 Bacteria 7925
89 Ga0466735_166722 3300042624 Bacteria 10307
90 Ga0466703_279892 3300042636 Bacteria 26432
91 Ga0466703_324943 3300042636 Bacteria 5739
92 Ga0466703_394316 3300042636 Bacteria 13173
93 Ga0466704_398294 3300042643 Bacteria 2631
94 Ga0466704_458544 3300042643 Bacteria 78073
95 Ga0466708_175549 3300042652 Bacteria 6408
96 Ga0466716_031134 3300042605 Bacteria 15582
97 Ga0466720_136664 3300042607 Bacteria 3252
98 Ga0466722_195548 3300042609 Bacteria 2436
99 JGI24700J35501_10930734 3300002508 Bacteria 20835
100 Ga0466733_025091 3300042659 Bacteria 1795
101 Ga0160467_100073 3300012829 Bacteria 152393
102 Ga0264413_122697 3300024493 Bacteria 3627
103 Ga0466692_189215 3300042591 Bacteria 7065
104 Ga0466693_262730 3300042592 Bacteria 1202
105 Ga0123355_10045451 3300009826 Bacteria 7142
106 Ga0466711_159728 3300042615 Bacteria 10173
107 Ga0466711_364981 3300042615 Bacteria 4376
108 Ga0466715_101206 3300042616 Bacteria 7746
109 Ga0466723_154017 3300042618 Bacteria 8183
110 Ga0466726_470355 3300042619 Bacteria 2851
111 Ga0466728_079655 3300042620 Bacteria 6842
112 Ga0466704_183426 3300042643 Bacteria 5093
113 Ga0466704_197751 3300042643 Bacteria 17703
114 Ga0466709_065314 3300042648 Bacteria 14122
115 Ga0466727_292880 3300042655 Bacteria 5897
116 Ga0466727_312009 3300042655 Bacteria 4220
117 Ga0466713_113309 3300042602 Bacteria 5401
118 JGI24695J34938_10010346 3300002450 Bacteria 5114
119 Ga0466733_030267 3300042659 Bacteria 2836
120 Ga0466733_039021 3300042659 Bacteria 1661
121 Ga0466733_094829 3300042659 Bacteria 1115
122 Ga0466691_111993 3300042593 Bacteria 26705
123 Ga0466696_135322 3300042596 Bacteria 6687
124 Ga0466696_341021 3300042596 Bacteria 2151
125 Ga0466715_423951 3300042616 Bacteria 3397
126 Ga0466726_336731 3300042619 Bacteria 1678
127 Ga0466728_108949 3300042620 Bacteria 7854
128 Ga0466728_226529 3300042620 Bacteria 7955
129 Ga0466729_165980 3300042621 Bacteria 4334
130 Ga0466735_030114 3300042624 Bacteria 1210
131 Ga0466703_002169 3300042636 Bacteria 1927
132 Ga0466703_206194 3300042636 Bacteria 1810
133 Ga0466709_275509 3300042648 Bacteria 18278
134 Ga0466720_109737 3300042607 Unclassified 3188
135 Ga0466722_217414 3300042609 Bacteria 1278
136 Ga0466705_197366 3300042612 Bacteria 5066
137 Ga0466690_070119 3300042590 Bacteria 4702
138 Ga0466692_116369 3300042591 Bacteria 30494
139 Ga0466691_173707 3300042593 Bacteria 9649
140 Ga0466696_439212 3300042596 Bacteria 1307
141 Ga0466699_070629 3300042597 Bacteria 1961
142 Ga0466723_178056 3300042618 Bacteria 1063
143 Ga0466723_264635 3300042618 Bacteria 13376
144 Ga0466703_079544 3300042636 Bacteria 22016
145 Ga0466704_581384 3300042643 Bacteria 2123
146 Ga0466709_236554 3300042648 Bacteria 25875
147 Ga0466708_166567 3300042652 Unclassified 9027
148 Ga0466727_178478 3300042655 Bacteria 13656
149 Ga0466716_109516 3300042605 Bacteria 6486
150 Ga0466716_506423 3300042605 Bacteria 1660
151 Ga0466719_039952 3300042606 Bacteria 1367
152 Ga0466722_070400 3300042609 Bacteria 9716
153 2227139141 2225789004 Bacteria 8783

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_129696 Ga0466723_129696_5509_6276 230
2 3300042643 Ga0466704_197751 Ga0466704_197751_11887_12654 232
3 3300042596 Ga0466696_439212 Ga0466696_439212_138_905 234
4 3300042636 Ga0466703_004099 Ga0466703_004099_221_988 236
5 2225789004 2227139141 2227540256 237
6 3300042616 Ga0466715_101206 Ga0466715_101206_5453_6220 237
7 3300000062 IMNBL1DRAFT_c0036189 IMNBL1DRAFT_00361892 238
8 3300042612 Ga0466705_003217 Ga0466705_003217_126_893 238
9 3300042619 Ga0466726_318933 Ga0466726_318933_70_837 238
10 3300042624 Ga0466735_030114 Ga0466735_030114_346_1113 238
11 3300042624 Ga0466735_089162 Ga0466735_089162_1369_2136 238
12 3300042636 Ga0466703_079544 Ga0466703_079544_10137_10904 238
13 3300042636 Ga0466703_297967 Ga0466703_297967_705_1472 238
14 3300042636 Ga0466703_337284 Ga0466703_337284_4545_5312 238
15 3300042648 Ga0466709_024280 Ga0466709_024280_5701_6468 238
16 3300042591 Ga0466692_116369 Ga0466692_116369_19988_20755 239
17 3300042593 Ga0466691_015854 Ga0466691_015854_1536_2303 239
18 3300042606 Ga0466719_050240 Ga0466719_050240_827_1594 239
19 3300042615 Ga0466711_423257 Ga0466711_423257_12220_12987 239
20 3300042619 Ga0466726_450643 Ga0466726_450643_309_1076 239
21 3300042620 Ga0466728_012520 Ga0466728_012520_4325_5092 239
22 3300042620 Ga0466728_226529 Ga0466728_226529_2362_3129 239
23 3300042636 Ga0466703_170737 Ga0466703_170737_561_1328 239
24 3300042643 Ga0466704_183426 Ga0466704_183426_659_1426 239
25 3300042655 Ga0466727_165421 Ga0466727_165421_243_1010 239
26 3300010882 Ga0123354_10302148 Ga0123354_103021482 240
27 3300042596 Ga0466696_341021 Ga0466696_341021_408_1175 240
28 3300042602 Ga0466713_113309 Ga0466713_113309_3734_4501 240
29 3300042612 Ga0466705_427665 Ga0466705_427665_4742_5509 240
30 3300042612 Ga0466705_513318 Ga0466705_513318_1338_2105 240
31 3300042615 Ga0466711_364981 Ga0466711_364981_2096_2869 240
32 3300042636 Ga0466703_206194 Ga0466703_206194_358_1125 240
33 3300042643 Ga0466704_398294 Ga0466704_398294_1767_2534 240
34 3300042593 Ga0466691_040484 Ga0466691_040484_2893_3660 241
35 3300042605 Ga0466716_506423 Ga0466716_506423_755_1522 241
36 3300042612 Ga0466705_197366 Ga0466705_197366_550_1317 241
37 3300042615 Ga0466711_203726 Ga0466711_203726_8601_9371 241
38 3300042656 Ga0466732_108002 Ga0466732_108002_19044_19811 241
39 iso_pr_bacteria 2711768164 2712505537 241
40 iso_pr_bacteria 2816332503 2818126684 241
41 iso_pr_bacteria 2816332545 2818334453 241
42 3300012861 Ga0160436_1008124 Ga0160436_10081242 242
43 3300042590 Ga0466690_357067 Ga0466690_357067_5771_6538 242
44 3300042605 Ga0466716_000191 Ga0466716_000191_4296_5063 242
45 3300042605 Ga0466716_109516 Ga0466716_109516_448_1227 242
46 3300042655 Ga0466727_105970 Ga0466727_105970_681_1448 242
47 3300042596 Ga0466696_191067 Ga0466696_191067_410_1177 243
48 3300042596 Ga0466696_386114 Ga0466696_386114_2858_3625 243
49 3300042616 Ga0466715_423951 Ga0466715_423951_2366_3166 243
50 3300042596 Ga0466696_135322 Ga0466696_135322_4009_4776 244
51 3300042619 Ga0466726_470355 Ga0466726_470355_1998_2765 244
52 3300042643 Ga0466704_378199 Ga0466704_378199_4484_5251 244
53 3300042648 Ga0466709_236554 Ga0466709_236554_7364_8131 244
54 3300042648 Ga0466709_254615 Ga0466709_254615_4045_4812 244
55 3300042652 Ga0466708_198459 Ga0466708_198459_430_1197 244
56 3300042652 Ga0466708_237342 Ga0466708_237342_5535_6320 244
57 3300009784 Ga0123357_10048219 Ga0123357_100482192 245
58 3300042612 Ga0466705_078997 Ga0466705_078997_1996_2763 245
59 3300042620 Ga0466728_108949 Ga0466728_108949_4275_5042 245
60 3300042636 Ga0466703_324943 Ga0466703_324943_4948_5715 245
61 3300042659 Ga0466733_159365 Ga0466733_159365_136_903 245
62 3300002508 JGI24700J35501_10930734 JGI24700J35501_109307345 246
63 3300024493 Ga0264413_122697 Ga0264413_1226973 246
64 3300042590 Ga0466690_070119 Ga0466690_070119_1959_2726 246
65 3300042601 Ga0466707_386056 Ga0466707_386056_1078_1845 246
66 3300042612 Ga0466705_358466 Ga0466705_358466_16456_17223 246
67 3300042620 Ga0466728_079655 Ga0466728_079655_1259_2026 246
68 3300042643 Ga0466704_096871 Ga0466704_096871_15662_16429 246
69 3300042659 Ga0466733_001606 Ga0466733_001606_3451_4218 246
70 3300042592 Ga0466693_262730 Ga0466693_262730_57_824 247
71 3300042593 Ga0466691_146581 Ga0466691_146581_397_1164 247
72 3300042594 Ga0466694_403587 Ga0466694_403587_920_1687 247
73 3300042609 Ga0466722_217414 Ga0466722_217414_71_838 247
74 3300042619 Ga0466726_336731 Ga0466726_336731_447_1214 247
75 3300042636 Ga0466703_279892 Ga0466703_279892_9729_10496 247
76 3300042655 Ga0466727_178478 Ga0466727_178478_3253_4020 247
77 3300042655 Ga0466727_312009 Ga0466727_312009_1056_1823 247
78 3300042659 Ga0466733_025091 Ga0466733_025091_781_1548 247
79 3300042659 Ga0466733_094829 Ga0466733_094829_316_1083 247
80 3300042597 Ga0466699_070629 Ga0466699_070629_504_1271 248
81 3300042618 Ga0466723_335808 Ga0466723_335808_5241_6062 248
82 3300042648 Ga0466709_065314 Ga0466709_065314_6767_7534 248
83 3300042596 Ga0466696_172317 Ga0466696_172317_2114_2908 249
84 3300042606 Ga0466719_039952 Ga0466719_039952_280_1047 249
85 3300010049 Ga0123356_10064261 Ga0123356_100642613 250
86 3300042643 Ga0466704_159497 Ga0466704_159497_2520_3287 250
87 3300042618 Ga0466723_038665 Ga0466723_038665_6076_6909 252
88 3300042618 Ga0466723_072790 Ga0466723_072790_3213_4025 254
89 3300042659 Ga0466733_219806 Ga0466733_219806_738_1502 254
90 3300009826 Ga0123355_10045451 Ga0123355_100454513 255
91 3300042591 Ga0466692_189215 Ga0466692_189215_840_1607 255
92 3300042592 Ga0466693_188007 Ga0466693_188007_10155_10922 255
93 3300042593 Ga0466691_051253 Ga0466691_051253_574_1341 255
94 3300042593 Ga0466691_111993 Ga0466691_111993_5531_6298 255
95 3300042593 Ga0466691_173707 Ga0466691_173707_2524_3291 255
96 3300042593 Ga0466691_224686 Ga0466691_224686_5410_6177 255
97 3300042596 Ga0466696_014778 Ga0466696_014778_497_1264 255
98 3300042596 Ga0466696_447669 Ga0466696_447669_2575_3342 255
99 3300042601 Ga0466707_276400 Ga0466707_276400_759_1526 255
100 3300042601 Ga0466707_292596 Ga0466707_292596_738_1505 255
101 3300042601 Ga0466707_304206 Ga0466707_304206_99_866 255
102 3300042603 Ga0466714_133428 Ga0466714_133428_319_1086 255
103 3300042605 Ga0466716_031134 Ga0466716_031134_1237_2004 255
104 3300042606 Ga0466719_387795 Ga0466719_387795_1092_1859 255
105 3300042607 Ga0466720_009917 Ga0466720_009917_1271_2038 255
106 3300042607 Ga0466720_109737 Ga0466720_109737_2394_3161 255
107 3300042607 Ga0466720_133393 Ga0466720_133393_874_1641 255
108 3300042607 Ga0466720_136664 Ga0466720_136664_803_1570 255
109 3300042609 Ga0466722_109879 Ga0466722_109879_352_1119 255
110 3300042609 Ga0466722_195548 Ga0466722_195548_566_1333 255
111 3300042609 Ga0466722_197322 Ga0466722_197322_1426_2193 255
112 3300042609 Ga0466722_229342 Ga0466722_229342_4816_5583 255
113 3300042612 Ga0466705_313083 Ga0466705_313083_1919_2686 255
114 3300042616 Ga0466715_166601 Ga0466715_166601_11567_12334 255
115 3300042618 Ga0466723_154017 Ga0466723_154017_6215_6982 255
116 3300042618 Ga0466723_300461 Ga0466723_300461_189_956 255
117 3300042619 Ga0466726_374699 Ga0466726_374699_657_1424 255
118 3300042620 Ga0466728_244653 Ga0466728_244653_6686_7453 255
119 3300042621 Ga0466729_165980 Ga0466729_165980_2726_3493 255
120 3300042624 Ga0466735_166722 Ga0466735_166722_8433_9200 255
121 3300042636 Ga0466703_002169 Ga0466703_002169_325_1092 255
122 3300042636 Ga0466703_243376 Ga0466703_243376_5428_6195 255
123 3300042636 Ga0466703_394316 Ga0466703_394316_11299_12066 255
124 3300042648 Ga0466709_205157 Ga0466709_205157_337_1104 255
125 3300042652 Ga0466708_166567 Ga0466708_166567_6244_7011 255
126 3300042652 Ga0466708_175549 Ga0466708_175549_2133_2900 255
127 3300042652 Ga0466708_282228 Ga0466708_282228_2601_3368 255
128 3300042655 Ga0466727_214238 Ga0466727_214238_482_1249 255
129 3300042655 Ga0466727_292880 Ga0466727_292880_3222_3989 255
130 3300042656 Ga0466732_081567 Ga0466732_081567_2961_3728 255
131 3300042659 Ga0466733_039021 Ga0466733_039021_252_1019 255
132 iso_pr_bacteria 2529293168 2531453981 255
133 iso_pr_bacteria 2781125690 2781428524 255
134 iso_pr_bacteria 2819994798 2819997217 255
135 iso_pr_bacteria 2940264388 2940267121 255
136 iso_pr_bacteria 2940267548 2940270216 255
137 iso_pr_bacteria 2940270707 2940273462 255
138 iso_pr_bacteria 2940273867 2940276604 255
139 iso_pr_bacteria 650716099 650878092 255
140 iso_pr_bacteria 650716099 650879486 255
141 3300002450 JGI24695J34938_10010346 JGI24695J34938_100103465 256
142 3300002450 JGI24695J34938_10012402 JGI24695J34938_100124026 256
143 3300005485 Ga0074263_112815 Ga0074263_1128151 256
144 3300009784 Ga0123357_10081083 Ga0123357_100810832 256
145 3300009826 Ga0123355_10146001 Ga0123355_101460013 256
146 3300010049 Ga0123356_10046608 Ga0123356_100466084 256
147 3300010049 Ga0123356_10054229 Ga0123356_100542295 256
148 3300010167 Ga0123353_10358645 Ga0123353_103586452 256
149 3300010167 Ga0123353_10370030 Ga0123353_103700302 256
150 3300010882 Ga0123354_10234552 Ga0123354_102345522 256
151 3300042648 Ga0466709_275509 Ga0466709_275509_5307_6119 256
152 3300042592 Ga0466693_038556 Ga0466693_038556_2916_3695 259
153 3300042659 Ga0466733_122961 Ga0466733_122961_40_855 263
154 3300042609 Ga0466722_070400 Ga0466722_070400_6510_7304 264
155 3300042659 Ga0466733_151573 Ga0466733_151573_999_1793 264
156 3300042611 Ga0466697_225052 Ga0466697_225052_28_825 265
157 3300042659 Ga0466733_030267 Ga0466733_030267_1968_2813 265
158 3300042615 Ga0466711_159728 Ga0466711_159728_2740_3540 266
159 3300042605 Ga0466716_334100 Ga0466716_334100_5950_6765 271
160 3300012829 Ga0160467_100073 Ga0160467_100073118 273
161 3300042618 Ga0466723_178056 Ga0466723_178056_158_1042 278
162 3300042618 Ga0466723_264635 Ga0466723_264635_6474_7325 283
163 3300042643 Ga0466704_458544 Ga0466704_458544_15533_16387 284
164 3300042643 Ga0466704_581384 Ga0466704_581384_1137_2000 287
165 3300042659 Ga0466733_112100 Ga0466733_112100_30_917 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 56 243 0.96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 63 293 0.95
PF08659 KR KR domain 59 204 0.88
PF23441 57 259 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.