Protein Family IF10313
Metagenome
Isolate
196
Members
126
Samples
116
Scaffolds
337.17
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_088459|Ga0466733_088459_10488_11579
- Length
- 363 aa
- Sequence
- MSEALVHAGGGVRVDKQKGEIMAKMFYDDDADLSIIQNRKVAVIGYGSQGHAHALSLRDSGVDVRVGLRPGSASRDKAEAEGLRVVPTETACEEADLIMILAPDQVQRGLYAAEIAPHLKTGDALFFAHGFNIRFGYIQPPAGVDVCMVAPKGPGHLVRREYAAGRGVPVVVAVEKDESGAAWPLTLAYAKGIGGLRAGGIATTFTEETETDLFGEQAVLCGGMSHLIQAGWETLVNAGYQPEVAYFECLHEMKLIVDLMYEGGIAKQRWSVSDTAEYGDYVSGPRIIDDHVRESMKAVLADIQSGAFAARFIADQDAGAPEFKALRAKEEAHPIEATGRELRQLMSWVKTADSDYTEGTAAR
Sample Types
Isolate
40.8%
Metagenome
59.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.8%
Termitidae
20.0%
Formicidae
9.2%
Anthocoridae
8.3%
Kalotermitidae
8.3%
Cambaridae
5.0%
Scarabaeidae
4.2%
Tenebrionidae
2.5%
Culicidae
2.5%
Dytiscidae
1.7%
Armadillidiidae
1.7%
Hydrophilidae
1.7%
Rhinotermitidae
1.7%
Curculionidae
1.7%
Termopsidae
1.7%
Pyralidae
0.8%
Thomisidae
0.8%
Hodotermitidae
0.8%
Chironomidae
0.8%
Apidae
0.8%
Taxonomy
Archaea
0
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 2 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 3 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 4 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 5 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 6 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 7 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 10 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 11 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 12 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 13 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 14 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 15 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 16 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 17 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 26 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 27 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 28 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 29 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 30 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 31 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 32 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 33 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 34 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 35 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 36 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 44 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 45 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 51 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 52 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 53 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 54 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 55 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 56 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 57 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 58 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 59 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 60 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 63 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 64 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 65 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 66 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 67 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 68 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 69 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 70 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 71 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 72 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 73 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 74 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 75 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 76 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 77 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 78 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 79 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 82 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 83 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 84 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 85 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 86 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 87 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 88 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 89 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 90 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 91 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 92 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 93 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 94 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 95 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 96 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 97 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 98 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 99 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 100 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 101 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 102 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 103 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 104 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 105 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 106 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 107 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 108 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 109 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 110 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 111 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 112 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 113 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 114 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 115 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 116 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 117 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 118 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 119 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 120 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 121 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 122 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 123 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 124 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 125 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 126 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10008501 | 3300009784 | Bacteria | 12838 |
| 2 | Ga0123353_10678503 | 3300010167 | Bacteria | 1452 |
| 3 | Ga0466733_016659 | 3300042659 | Bacteria | 19036 |
| 4 | Ga0466733_088459 | 3300042659 | Bacteria | 38396 |
| 5 | Ga0562378_0355 | 3300056814 | Bacteria | 89245 |
| 6 | Ga0562375_5239 | 3300056856 | Bacteria | 8246 |
| 7 | Ga0466713_115569 | 3300042602 | Bacteria | 9264 |
| 8 | Ga0466698_310049 | 3300042610 | Bacteria | 2391 |
| 9 | Ga0466723_349678 | 3300042618 | Bacteria | 2893 |
| 10 | Ga0466726_167792 | 3300042619 | Bacteria | 3810 |
| 11 | Ga0466729_039381 | 3300042621 | Bacteria | 1470 |
| 12 | Ga0466730_093937 | 3300042625 | Bacteria | 26828 |
| 13 | Ga0466703_403088 | 3300042636 | Bacteria | 1236 |
| 14 | Ga0466704_074527 | 3300042643 | Bacteria | 5220 |
| 15 | Ga0466704_215736 | 3300042643 | Unclassified | 30978 |
| 16 | Ga0466708_207070 | 3300042652 | Bacteria | 4434 |
| 17 | Ga0123354_10048845 | 3300010882 | Bacteria | 6425 |
| 18 | Ga0160459_101162 | 3300012831 | Unclassified | 6844 |
| 19 | Ga0466697_269804 | 3300042611 | Bacteria | 1699 |
| 20 | Ga0466713_075165 | 3300042602 | Bacteria | 11919 |
| 21 | Ga0466719_349854 | 3300042606 | Bacteria | 27287 |
| 22 | Ga0466719_522042 | 3300042606 | Bacteria | 3922 |
| 23 | Ga0466705_455057 | 3300042612 | Bacteria | 8149 |
| 24 | Ga0466710_147804 | 3300042613 | Bacteria | 1366 |
| 25 | Ga0466712_036137 | 3300042614 | Bacteria | 1590 |
| 26 | Ga0466723_054120 | 3300042618 | Bacteria | 26199 |
| 27 | Ga0466723_198703 | 3300042618 | Bacteria | 8878 |
| 28 | Ga0466723_330279 | 3300042618 | Bacteria | 8986 |
| 29 | Ga0466734_039779 | 3300042623 | Bacteria | 1796 |
| 30 | Ga0466703_081658 | 3300042636 | Bacteria | 26167 |
| 31 | Ga0123353_10599587 | 3300010167 | Bacteria | 1575 |
| 32 | Ga0160459_100664 | 3300012831 | Bacteria | 12004 |
| 33 | Ga0466692_021036 | 3300042591 | Bacteria | 4408 |
| 34 | Ga0466692_122739 | 3300042591 | Bacteria | 1326 |
| 35 | Ga0466696_074647 | 3300042596 | Bacteria | 5834 |
| 36 | Ga0466696_129064 | 3300042596 | Bacteria | 3714 |
| 37 | Ga0123357_10000026 | 3300009784 | Bacteria | 128045 |
| 38 | Ga0123357_10000037 | 3300009784 | Bacteria | 109871 |
| 39 | Ga0123357_10000647 | 3300009784 | Bacteria | 34620 |
| 40 | Ga0466707_093680 | 3300042601 | Bacteria | 71749 |
| 41 | Ga0466710_365453 | 3300042613 | Bacteria | 2064 |
| 42 | Ga0466704_360510 | 3300042643 | Bacteria | 7834 |
| 43 | Ga0466704_424257 | 3300042643 | Bacteria | 2427 |
| 44 | Ga0466727_149972 | 3300042655 | Bacteria | 8441 |
| 45 | Ga0123353_10000623 | 3300010167 | Bacteria | 43400 |
| 46 | Ga0123353_10355624 | 3300010167 | Bacteria | 2204 |
| 47 | Ga0123354_10261815 | 3300010882 | Bacteria | 1725 |
| 48 | Ga0160460_101647 | 3300012845 | Bacteria | 6861 |
| 49 | Ga0160433_104476 | 3300012846 | Bacteria | 2244 |
| 50 | Ga0466693_148230 | 3300042592 | Bacteria | 38546 |
| 51 | Ga0466706_007672 | 3300042599 | Bacteria | 1415 |
| 52 | Ga0466706_152187 | 3300042599 | Bacteria | 12959 |
| 53 | Ga0466713_090088 | 3300042602 | Bacteria | 4949 |
| 54 | Ga0466713_099015 | 3300042602 | Bacteria | 104926 |
| 55 | Ga0466723_128635 | 3300042618 | Bacteria | 45701 |
| 56 | Ga0466730_063873 | 3300042625 | Bacteria | 6893 |
| 57 | Ga0466703_349915 | 3300042636 | Bacteria | 3479 |
| 58 | Ga0466725_017989 | 3300042654 | Bacteria | 1473 |
| 59 | Ga0123356_10007105 | 3300010049 | Bacteria | 11215 |
| 60 | Ga0123356_10028704 | 3300010049 | Bacteria | 5212 |
| 61 | Ga0123353_10483118 | 3300010167 | Unclassified | 1812 |
| 62 | Ga0123354_10007651 | 3300010882 | Bacteria | 16311 |
| 63 | Ga0160455_102546 | 3300012837 | Bacteria | 3669 |
| 64 | Ga0466691_073277 | 3300042593 | Bacteria | 11125 |
| 65 | JGI24705J35276_12221159 | 3300002504 | Bacteria | 2319 |
| 66 | Ga0466700_137486 | 3300042600 | Bacteria | 5854 |
| 67 | Ga0466707_273399 | 3300042601 | Bacteria | 64548 |
| 68 | Ga0466715_020843 | 3300042616 | Bacteria | 77878 |
| 69 | Ga0466723_147233 | 3300042618 | Bacteria | 6176 |
| 70 | Ga0466703_238713 | 3300042636 | Bacteria | 47888 |
| 71 | Ga0123357_10014281 | 3300009784 | Bacteria | 10357 |
| 72 | Ga0123356_10000416 | 3300010049 | Bacteria | 48609 |
| 73 | Ga0466696_001102 | 3300042596 | Bacteria | 5376 |
| 74 | Ga0466696_320963 | 3300042596 | Bacteria | 13939 |
| 75 | Ga0466705_132655 | 3300042612 | Bacteria | 5536 |
| 76 | Ga0562378_0075 | 3300056814 | Bacteria | 280321 |
| 77 | Ga0562375_2359 | 3300056856 | Bacteria | 21367 |
| 78 | Ga0562376_0018 | 3300056857 | Bacteria | 481690 |
| 79 | JGI24699J35502_11133769 | 3300002509 | Bacteria | 15200 |
| 80 | Ga0466706_244626 | 3300042599 | Bacteria | 1203 |
| 81 | Ga0466713_050983 | 3300042602 | Bacteria | 10911 |
| 82 | Ga0466713_070278 | 3300042602 | Bacteria | 3529 |
| 83 | Ga0466713_137650 | 3300042602 | Bacteria | 20025 |
| 84 | Ga0466705_394808 | 3300042612 | Bacteria | 5372 |
| 85 | Ga0466728_314377 | 3300042620 | Bacteria | 6403 |
| 86 | Ga0466725_358960 | 3300042654 | Bacteria | 3878 |
| 87 | Ga0123357_10091579 | 3300009784 | Bacteria | 3959 |
| 88 | Ga0123356_10000068 | 3300010049 | Bacteria | 108740 |
| 89 | Ga0123356_10000676 | 3300010049 | Bacteria | 37752 |
| 90 | Ga0160446_100323 | 3300012835 | Bacteria | 27155 |
| 91 | Ga0466657_047195 | 3300042582 | Bacteria | 2098 |
| 92 | Ga0466691_004808 | 3300042593 | Bacteria | 2645 |
| 93 | JGI24699J35502_11099026 | 3300002509 | Bacteria | 2309 |
| 94 | JGI24699J35502_11122476 | 3300002509 | Bacteria | 3440 |
| 95 | Ga0466713_065581 | 3300042602 | Bacteria | 52137 |
| 96 | Ga0466713_079531 | 3300042602 | Bacteria | 32951 |
| 97 | Ga0466728_468570 | 3300042620 | Bacteria | 2585 |
| 98 | Ga0466730_053908 | 3300042625 | Bacteria | 1515 |
| 99 | Ga0466725_086751 | 3300042654 | Bacteria | 1458 |
| 100 | Ga0123357_10038044 | 3300009784 | Bacteria | 6551 |
| 101 | Ga0123356_10003864 | 3300010049 | Bacteria | 15608 |
| 102 | Ga0160432_102495 | 3300012818 | Bacteria | 3847 |
| 103 | Ga0160430_101833 | 3300012852 | Bacteria | 7368 |
| 104 | Ga0466705_003036 | 3300042612 | Bacteria | 5920 |
| 105 | Ga0466733_199171 | 3300042659 | Bacteria | 58555 |
| 106 | Ga0562376_3663 | 3300056857 | Bacteria | 14911 |
| 107 | JGI24699J35502_11118827 | 3300002509 | Unclassified | 3122 |
| 108 | Ga0072941_1037045 | 3300005201 | Bacteria | 16013 |
| 109 | Ga0123357_10000950 | 3300009784 | Bacteria | 29496 |
| 110 | Ga0466706_166351 | 3300042599 | Bacteria | 10416 |
| 111 | Ga0466706_228217 | 3300042599 | Bacteria | 67941 |
| 112 | Ga0466713_001026 | 3300042602 | Bacteria | 36059 |
| 113 | Ga0466715_059738 | 3300042616 | Bacteria | 13741 |
| 114 | Ga0466704_395985 | 3300042643 | Bacteria | 4741 |
| 115 | Ga0466724_08127 | 3300042649 | Bacteria | 26680 |
| 116 | Ga0466727_208222 | 3300042655 | Bacteria | 3805 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820814774 | 2820816333 | 291 |
| 2 | 3300042625 | Ga0466730_093937 | Ga0466730_093937_12774_13775 | 292 |
| 3 | 3300042643 | Ga0466704_215736 | Ga0466704_215736_6576_7595 | 292 |
| 4 | 3300042599 | Ga0466706_152187 | Ga0466706_152187_9929_10945 | 303 |
| 5 | 3300042619 | Ga0466726_167792 | Ga0466726_167792_1731_2759 | 307 |
| 6 | 3300042602 | Ga0466713_050983 | Ga0466713_050983_9394_10413 | 309 |
| 7 | 3300042625 | Ga0466730_063873 | Ga0466730_063873_2313_3311 | 313 |
| 8 | 3300009784 | Ga0123357_10091579 | Ga0123357_100915793 | 320 |
| 9 | 3300010049 | Ga0123356_10007105 | Ga0123356_100071058 | 320 |
| 10 | 3300012837 | Ga0160455_102546 | Ga0160455_1025462 | 320 |
| 11 | 3300042636 | Ga0466703_238713 | Ga0466703_238713_2679_3695 | 321 |
| 12 | 3300042654 | Ga0466725_358960 | Ga0466725_358960_398_1417 | 322 |
| 13 | iso_pr_bacteria | 2820834831 | 2820836379 | 322 |
| 14 | iso_pr_bacteria | 2820840446 | 2820841807 | 322 |
| 15 | 3300042602 | Ga0466713_099015 | Ga0466713_099015_58873_59901 | 323 |
| 16 | 3300042602 | Ga0466713_065581 | Ga0466713_065581_6978_8009 | 324 |
| 17 | 3300042602 | Ga0466713_137650 | Ga0466713_137650_15307_16335 | 324 |
| 18 | 3300042612 | Ga0466705_003036 | Ga0466705_003036_1469_2497 | 324 |
| 19 | 3300042610 | Ga0466698_310049 | Ga0466698_310049_1315_2343 | 325 |
| 20 | 3300042643 | Ga0466704_395985 | Ga0466704_395985_1108_2142 | 325 |
| 21 | 3300010049 | Ga0123356_10000416 | Ga0123356_100004168 | 326 |
| 22 | iso_pr_bacteria | 2856652821 | 2856656127 | 327 |
| 23 | iso_pr_bacteria | 2898589227 | 2898590416 | 327 |
| 24 | iso_pr_bacteria | 8073544309 | 8073551936 | 327 |
| 25 | 3300042599 | Ga0466706_166351 | Ga0466706_166351_3461_4480 | 328 |
| 26 | 3300042616 | Ga0466715_020843 | Ga0466715_020843_12131_13159 | 328 |
| 27 | 3300042636 | Ga0466703_403088 | Ga0466703_403088_181_1209 | 329 |
| 28 | 3300042582 | Ga0466657_047195 | Ga0466657_047195_707_1735 | 330 |
| 29 | 3300042652 | Ga0466708_207070 | Ga0466708_207070_2195_3223 | 330 |
| 30 | 3300042591 | Ga0466692_122739 | Ga0466692_122739_33_1061 | 331 |
| 31 | 3300042602 | Ga0466713_079531 | Ga0466713_079531_30049_31077 | 331 |
| 32 | 3300042612 | Ga0466705_394808 | Ga0466705_394808_4042_5061 | 331 |
| 33 | 3300042655 | Ga0466727_208222 | Ga0466727_208222_470_1498 | 331 |
| 34 | iso_pr_bacteria | 2518645556 | 2518832240 | 331 |
| 35 | 3300009784 | Ga0123357_10000037 | Ga0123357_1000003741 | 332 |
| 36 | iso_pr_bacteria | 2515154100 | 2515560093 | 332 |
| 37 | iso_pr_bacteria | 2515154106 | 2515604833 | 332 |
| 38 | iso_pr_bacteria | 2547132081 | 2547294950 | 332 |
| 39 | iso_pr_bacteria | 2648501322 | 2649446927 | 332 |
| 40 | iso_pr_bacteria | 2820857933 | 2820862319 | 332 |
| 41 | iso_pr_bacteria | 2896955351 | 2896960152 | 332 |
| 42 | iso_pr_bacteria | 2908241010 | 2908246112 | 332 |
| 43 | iso_pr_bacteria | 2912749649 | 2912756318 | 332 |
| 44 | iso_pr_bacteria | 3006468911 | 3006470582 | 332 |
| 45 | iso_pr_bacteria | 8077783556 | 8077788257 | 332 |
| 46 | 3300010049 | Ga0123356_10003864 | Ga0123356_1000386414 | 333 |
| 47 | 3300042592 | Ga0466693_148230 | Ga0466693_148230_27993_29021 | 333 |
| 48 | iso_pr_bacteria | 2862784999 | 2862788333 | 333 |
| 49 | iso_pr_bacteria | 2873196663 | 2873197617 | 333 |
| 50 | iso_pr_bacteria | 2912817845 | 2912821223 | 333 |
| 51 | iso_pr_bacteria | 647000328 | 647326447 | 333 |
| 52 | 3300042596 | Ga0466696_074647 | Ga0466696_074647_1672_2700 | 335 |
| 53 | 3300042599 | Ga0466706_244626 | Ga0466706_244626_115_1149 | 335 |
| 54 | 3300042659 | Ga0466733_199171 | Ga0466733_199171_38660_39688 | 336 |
| 55 | 3300002509 | JGI24699J35502_11099026 | JGI24699J35502_110990262 | 337 |
| 56 | 3300042591 | Ga0466692_021036 | Ga0466692_021036_372_1400 | 337 |
| 57 | 3300042602 | Ga0466713_070278 | Ga0466713_070278_164_1201 | 337 |
| 58 | 3300056856 | Ga0562375_5239 | Ga0562375_5239_2571_3599 | 337 |
| 59 | iso_pr_bacteria | 2671180625 | 2673532561 | 337 |
| 60 | iso_pr_bacteria | 2675903497 | 2678195112 | 337 |
| 61 | iso_pr_bacteria | 2772190761 | 2772882571 | 337 |
| 62 | iso_pr_bacteria | 2859977607 | 2859978614 | 337 |
| 63 | iso_pr_bacteria | 649989992 | 650091656 | 337 |
| 64 | iso_pr_bacteria | 8118075156 | 8118078578 | 337 |
| 65 | 3300002509 | JGI24699J35502_11118827 | JGI24699J35502_111188273 | 338 |
| 66 | 3300042655 | Ga0466727_149972 | Ga0466727_149972_310_1326 | 338 |
| 67 | iso_pr_bacteria | 8067071256 | 8067073657 | 338 |
| 68 | 3300012831 | Ga0160459_100664 | Ga0160459_1006646 | 339 |
| 69 | 3300042602 | Ga0466713_090088 | Ga0466713_090088_3684_4703 | 339 |
| 70 | 3300042611 | Ga0466697_269804 | Ga0466697_269804_127_1146 | 339 |
| 71 | 3300042623 | Ga0466734_039779 | Ga0466734_039779_537_1556 | 339 |
| 72 | iso_pr_bacteria | 2856671350 | 2856677229 | 339 |
| 73 | iso_pr_bacteria | 2856947901 | 2856952203 | 339 |
| 74 | iso_pr_bacteria | 2856966858 | 2856967861 | 339 |
| 75 | 3300009784 | Ga0123357_10000647 | Ga0123357_100006472 | 340 |
| 76 | 3300009784 | Ga0123357_10000950 | Ga0123357_1000095028 | 340 |
| 77 | 3300009784 | Ga0123357_10008501 | Ga0123357_100085017 | 340 |
| 78 | 3300010167 | Ga0123353_10483118 | Ga0123353_104831182 | 340 |
| 79 | 3300010167 | Ga0123353_10678503 | Ga0123353_106785032 | 340 |
| 80 | 3300010882 | Ga0123354_10007651 | Ga0123354_100076514 | 340 |
| 81 | 3300010882 | Ga0123354_10261815 | Ga0123354_102618152 | 340 |
| 82 | iso_pr_bacteria | 2820922474 | 2820923283 | 340 |
| 83 | 3300042596 | Ga0466696_001102 | Ga0466696_001102_1929_2954 | 341 |
| 84 | 3300042599 | Ga0466706_228217 | Ga0466706_228217_60847_61872 | 341 |
| 85 | 3300042600 | Ga0466700_137486 | Ga0466700_137486_4565_5590 | 341 |
| 86 | 3300042616 | Ga0466715_059738 | Ga0466715_059738_922_1947 | 341 |
| 87 | 3300042625 | Ga0466730_053908 | Ga0466730_053908_17_1042 | 341 |
| 88 | 3300042654 | Ga0466725_017989 | Ga0466725_017989_26_1051 | 341 |
| 89 | 3300042654 | Ga0466725_086751 | Ga0466725_086751_409_1434 | 341 |
| 90 | iso_pr_bacteria | 2524023214 | 2524488400 | 341 |
| 91 | iso_pr_bacteria | 2731957681 | 2732700030 | 341 |
| 92 | iso_pr_bacteria | 2734481968 | 2734843169 | 341 |
| 93 | iso_pr_bacteria | 2818991320 | 2819437829 | 341 |
| 94 | iso_pr_bacteria | 2873614151 | 2873614960 | 341 |
| 95 | iso_pr_bacteria | 2873620646 | 2873623043 | 341 |
| 96 | iso_pr_bacteria | 2884351759 | 2884353545 | 341 |
| 97 | iso_pr_bacteria | 2894897082 | 2894897218 | 341 |
| 98 | iso_pr_bacteria | 2894900265 | 2894900648 | 341 |
| 99 | iso_pr_bacteria | 2894926108 | 2894928237 | 341 |
| 100 | iso_pr_bacteria | 2894929448 | 2894929783 | 341 |
| 101 | iso_pr_bacteria | 2894932631 | 2894932946 | 341 |
| 102 | iso_pr_bacteria | 2894935787 | 2894936870 | 341 |
| 103 | iso_pr_bacteria | 2894944011 | 2894944480 | 341 |
| 104 | iso_pr_bacteria | 2894966443 | 2894966515 | 341 |
| 105 | iso_pr_bacteria | 2894974975 | 2894975241 | 341 |
| 106 | iso_pr_bacteria | 2894981435 | 2894981705 | 341 |
| 107 | iso_pr_bacteria | 2909881144 | 2909882347 | 341 |
| 108 | iso_pr_bacteria | 2910090113 | 2910090360 | 341 |
| 109 | iso_pr_bacteria | 2915157839 | 2915159275 | 341 |
| 110 | iso_pr_bacteria | 2915160415 | 2915162342 | 341 |
| 111 | iso_pr_bacteria | 2915166107 | 2915166701 | 341 |
| 112 | iso_pr_bacteria | 2915168811 | 2915169601 | 341 |
| 113 | iso_pr_bacteria | 8069511479 | 8069511716 | 341 |
| 114 | 3300012818 | Ga0160432_102495 | Ga0160432_1024954 | 342 |
| 115 | 3300012831 | Ga0160459_101162 | Ga0160459_1011625 | 342 |
| 116 | 3300012835 | Ga0160446_100323 | Ga0160446_10032315 | 342 |
| 117 | 3300012845 | Ga0160460_101647 | Ga0160460_1016473 | 342 |
| 118 | 3300012846 | Ga0160433_104476 | Ga0160433_1044763 | 342 |
| 119 | 3300012852 | Ga0160430_101833 | Ga0160430_1018334 | 342 |
| 120 | 3300042593 | Ga0466691_004808 | Ga0466691_004808_1041_2069 | 342 |
| 121 | 3300042593 | Ga0466691_073277 | Ga0466691_073277_7677_8705 | 342 |
| 122 | 3300042596 | Ga0466696_129064 | Ga0466696_129064_701_1729 | 342 |
| 123 | 3300042596 | Ga0466696_320963 | Ga0466696_320963_2774_3802 | 342 |
| 124 | 3300042599 | Ga0466706_007672 | Ga0466706_007672_310_1338 | 342 |
| 125 | 3300042601 | Ga0466707_093680 | Ga0466707_093680_989_2017 | 342 |
| 126 | 3300042601 | Ga0466707_273399 | Ga0466707_273399_4921_5949 | 342 |
| 127 | 3300042602 | Ga0466713_075165 | Ga0466713_075165_8479_9507 | 342 |
| 128 | 3300042602 | Ga0466713_115569 | Ga0466713_115569_6377_7405 | 342 |
| 129 | 3300042606 | Ga0466719_349854 | Ga0466719_349854_19548_20576 | 342 |
| 130 | 3300042606 | Ga0466719_522042 | Ga0466719_522042_2602_3630 | 342 |
| 131 | 3300042612 | Ga0466705_132655 | Ga0466705_132655_2587_3615 | 342 |
| 132 | 3300042612 | Ga0466705_455057 | Ga0466705_455057_210_1238 | 342 |
| 133 | 3300042613 | Ga0466710_147804 | Ga0466710_147804_132_1160 | 342 |
| 134 | 3300042613 | Ga0466710_365453 | Ga0466710_365453_743_1771 | 342 |
| 135 | 3300042614 | Ga0466712_036137 | Ga0466712_036137_189_1217 | 342 |
| 136 | 3300042618 | Ga0466723_054120 | Ga0466723_054120_1475_2503 | 342 |
| 137 | 3300042618 | Ga0466723_128635 | Ga0466723_128635_22583_23611 | 342 |
| 138 | 3300042618 | Ga0466723_147233 | Ga0466723_147233_2894_3922 | 342 |
| 139 | 3300042618 | Ga0466723_198703 | Ga0466723_198703_2262_3290 | 342 |
| 140 | 3300042618 | Ga0466723_330279 | Ga0466723_330279_130_1158 | 342 |
| 141 | 3300042618 | Ga0466723_349678 | Ga0466723_349678_969_1997 | 342 |
| 142 | 3300042620 | Ga0466728_314377 | Ga0466728_314377_391_1419 | 342 |
| 143 | 3300042620 | Ga0466728_468570 | Ga0466728_468570_661_1689 | 342 |
| 144 | 3300042621 | Ga0466729_039381 | Ga0466729_039381_375_1403 | 342 |
| 145 | 3300042643 | Ga0466704_074527 | Ga0466704_074527_209_1237 | 342 |
| 146 | 3300042643 | Ga0466704_360510 | Ga0466704_360510_6757_7785 | 342 |
| 147 | 3300042643 | Ga0466704_424257 | Ga0466704_424257_141_1169 | 342 |
| 148 | 3300042649 | Ga0466724_08127 | Ga0466724_08127_7237_8265 | 342 |
| 149 | 3300042659 | Ga0466733_016659 | Ga0466733_016659_16328_17356 | 342 |
| 150 | iso_pr_bacteria | 2681812870 | 2682013453 | 342 |
| 151 | iso_pr_bacteria | 2820807258 | 2820807789 | 342 |
| 152 | iso_pr_bacteria | 2820816657 | 2820817133 | 342 |
| 153 | iso_pr_bacteria | 2820829137 | 2820829910 | 342 |
| 154 | iso_pr_bacteria | 2820842553 | 2820845632 | 342 |
| 155 | iso_pr_bacteria | 2820849606 | 2820850421 | 342 |
| 156 | iso_pr_bacteria | 2820899690 | 2820900191 | 342 |
| 157 | iso_pr_bacteria | 2820901319 | 2820902289 | 342 |
| 158 | iso_pr_bacteria | 2820911766 | 2820911809 | 342 |
| 159 | iso_pr_bacteria | 2820914081 | 2820914512 | 342 |
| 160 | iso_pr_bacteria | 2820926697 | 2820927808 | 342 |
| 161 | iso_pr_bacteria | 2820944107 | 2820946159 | 342 |
| 162 | iso_pr_bacteria | 2841168549 | 2841170723 | 342 |
| 163 | iso_pr_bacteria | 2847305884 | 2847308884 | 342 |
| 164 | iso_pr_bacteria | 2873558832 | 2873562079 | 342 |
| 165 | iso_pr_bacteria | 2884613238 | 2884616368 | 342 |
| 166 | iso_pr_bacteria | 2931425734 | 2931426970 | 342 |
| 167 | iso_pr_bacteria | 2931430189 | 2931431308 | 342 |
| 168 | iso_pr_bacteria | 3002678670 | 3002681510 | 342 |
| 169 | iso_pr_bacteria | 8067987626 | 8067988973 | 342 |
| 170 | 3300002504 | JGI24705J35276_12221159 | JGI24705J35276_122211593 | 343 |
| 171 | 3300002509 | JGI24699J35502_11122476 | JGI24699J35502_111224763 | 343 |
| 172 | 3300002509 | JGI24699J35502_11133769 | JGI24699J35502_1113376911 | 343 |
| 173 | 3300005201 | Ga0072941_1037045 | Ga0072941_103704518 | 343 |
| 174 | 3300009784 | Ga0123357_10000026 | Ga0123357_10000026105 | 343 |
| 175 | 3300009784 | Ga0123357_10014281 | Ga0123357_100142813 | 343 |
| 176 | 3300009784 | Ga0123357_10038044 | Ga0123357_100380443 | 343 |
| 177 | 3300010049 | Ga0123356_10000068 | Ga0123356_1000006887 | 343 |
| 178 | 3300010049 | Ga0123356_10000676 | Ga0123356_1000067621 | 343 |
| 179 | 3300010049 | Ga0123356_10028704 | Ga0123356_100287043 | 343 |
| 180 | 3300010167 | Ga0123353_10000623 | Ga0123353_1000062315 | 343 |
| 181 | 3300010167 | Ga0123353_10355624 | Ga0123353_103556243 | 343 |
| 182 | 3300010167 | Ga0123353_10599587 | Ga0123353_105995871 | 343 |
| 183 | 3300010882 | Ga0123354_10048845 | Ga0123354_100488453 | 343 |
| 184 | 3300042602 | Ga0466713_001026 | Ga0466713_001026_7526_8557 | 343 |
| 185 | 3300056814 | Ga0562378_0075 | Ga0562378_0075_149045_150076 | 343 |
| 186 | 3300056814 | Ga0562378_0355 | Ga0562378_0355_23069_24100 | 343 |
| 187 | 3300056856 | Ga0562375_2359 | Ga0562375_2359_19270_20301 | 343 |
| 188 | 3300056857 | Ga0562376_0018 | Ga0562376_0018_344005_345036 | 343 |
| 189 | 3300056857 | Ga0562376_3663 | Ga0562376_3663_8202_9233 | 343 |
| 190 | iso_pr_bacteria | 2630969010 | 2634123905 | 343 |
| 191 | iso_pr_bacteria | 2820809073 | 2820811144 | 343 |
| 192 | iso_pr_bacteria | 2873589062 | 2873589744 | 343 |
| 193 | iso_pr_bacteria | 2918390780 | 2918393293 | 343 |
| 194 | 3300042636 | Ga0466703_349915 | Ga0466703_349915_2366_3415 | 349 |
| 195 | 3300042659 | Ga0466733_088459 | Ga0466733_088459_10488_11579 | 363 |
| 196 | 3300042636 | Ga0466703_081658 | Ga0466703_081658_21571_22710 | 379 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01450 | IlvC | Acetohydroxy acid isomeroreductase, catalytic domain | 205 | 348 | 1 |
| PF07991 | IlvN | Acetohydroxy acid isomeroreductase, NADPH-binding domain | 36 | 199 | 0.99 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 40 | 105 | 0.85 |
| PF02826 | 2-Hacid_dh_C | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | 31 | 111 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02826 | GO:0051287 | NAD binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.