Protein Family IF10303

Metagenome Isolate
196 Members
60 Samples
190 Scaffolds
133.34 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_072363|Ga0466733_072363_568_1047
Length
159 aa
Sequence
MRKYLLDTHTLVWAMLDKGKLSEPVLKILQDSNSQLFVSAVSFWEIAVKHGKGKLELENFLIGDIPGYCRRLRIEQIPLMPEEAINYSELPFFDNHKDPFDRMLIYQCIRDNYTLISKDRMFEQYMDAGLKLAWRNLAVAKNAANKEQPLYMEREQKKN

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 24.1%
Unclassified 12.1%
Rhinotermitidae 6.9%
Termopsidae 5.2%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 35

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
8 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
14 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 650716102 Treponema primitia ZAS-2 Isolate Unclassified
55 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_216887 3300042612 Bacteria 13606
2 Ga0264413_102130 3300024493 Bacteria 11483
3 Ga0466699_214363 3300042597 Unclassified 1026
4 Ga0466707_010264 3300042601 Bacteria 1052
5 Ga0466717_254524 3300042604 Bacteria 3933
6 Ga0466720_192567 3300042607 Bacteria 1679
7 Ga0466720_227306 3300042607 Unclassified 1711
8 Ga0466731_169735 3300042622 Bacteria 1662
9 Ga0466704_418637 3300042643 Unclassified 1369
10 Ga0466704_514884 3300042643 Bacteria 3212
11 Ga0466708_045495 3300042652 Bacteria 3222
12 Ga0466725_152332 3300042654 Bacteria 11510
13 Ga0466727_053741 3300042655 Bacteria 1191
14 Ga0466727_206302 3300042655 Bacteria 1287
15 Ga0466712_314887 3300042614 Bacteria 10326
16 Ga0466728_054375 3300042620 Bacteria 1677
17 Ga0123356_10619326 3300010049 Bacteria 1248
18 Ga0123356_11717661 3300010049 Bacteria 779
19 Ga0123353_10374985 3300010167 Unclassified 2131
20 Ga0072940_1109721 3300005200 Unclassified 781
21 Ga0072940_1409997 3300005200 Bacteria 710
22 Ga0466697_060221 3300042611 Bacteria 1090
23 Ga0264413_104132 3300024493 Bacteria 25431
24 Ga0466690_010791 3300042590 Bacteria 5058
25 Ga0466699_054860 3300042597 Bacteria 1518
26 Ga0466706_198488 3300042599 Unclassified 1959
27 Ga0466729_312574 3300042621 Bacteria 2856
28 Ga0466704_468920 3300042643 Bacteria 1795
29 Ga0466708_157271 3300042652 Unclassified 1833
30 Ga0466725_199932 3300042654 Bacteria 1143
31 Ga0466718_121077 3300042617 Bacteria 1511
32 Ga0466726_164520 3300042619 Bacteria 2365
33 Ga0466728_167793 3300042620 Bacteria 2630
34 Ga0123356_11098192 3300010049 Unclassified 964
35 Ga0123356_13502466 3300010049 Bacteria 544
36 Ga0072941_1031060 3300005201 Bacteria 10004
37 Ga0072941_1112085 3300005201 Unclassified 2375
38 Ga0466705_196362 3300042612 Bacteria 6706
39 Ga0466692_090077 3300042591 Bacteria 2290
40 Ga0466699_099435 3300042597 Unclassified 1349
41 Ga0466701_060472 3300042598 Bacteria 2948
42 Ga0466700_159960 3300042600 Bacteria 2599
43 Ga0466700_312029 3300042600 Bacteria 5922
44 Ga0466707_402360 3300042601 Bacteria 1456
45 Ga0466719_183553 3300042606 Unclassified 1122
46 Ga0466719_222435 3300042606 Bacteria 1077
47 Ga0466720_191140 3300042607 Bacteria 11274
48 Ga0466698_381291 3300042610 Bacteria 1724
49 Ga0466702_103892 3300042635 Bacteria 2911
50 Ga0466703_086583 3300042636 Bacteria 2501
51 Ga0466704_258618 3300042643 Bacteria 1676
52 Ga0466704_341635 3300042643 Bacteria 32677
53 Ga0466708_414482 3300042652 Bacteria 1674
54 Ga0466705_432689 3300042612 Bacteria 11828
55 Ga0466712_140672 3300042614 Bacteria 1557
56 Ga0466715_189900 3300042616 Bacteria 1296
57 Ga0466726_147772 3300042619 Bacteria 2869
58 Ga0466728_004271 3300042620 Bacteria 3812
59 Ga0466728_119322 3300042620 Unclassified 1105
60 Ga0123356_11214227 3300010049 Bacteria 920
61 Ga0123353_10595966 3300010167 Bacteria 1581
62 Ga0123353_10956661 3300010167 Unclassified 1157
63 Ga0123354_10121014 3300010882 Bacteria 3381
64 Ga0072941_1181765 3300005201 Bacteria 7743
65 Ga0466705_175795 3300042612 Bacteria 2606
66 Ga0466733_078893 3300042659 Bacteria 1529
67 Ga0466733_141686 3300042659 Bacteria 12353
68 Ga0264413_127705 3300024493 Bacteria 3540
69 Ga0456237_0006149 3300041968 Bacteria 1890
70 Ga0466701_041410 3300042598 Bacteria 2529
71 Ga0466707_015385 3300042601 Bacteria 25153
72 Ga0466707_111455 3300042601 Bacteria 3759
73 Ga0466719_138882 3300042606 Bacteria 2066
74 Ga0466720_045069 3300042607 Bacteria 18200
75 Ga0466722_176111 3300042609 Bacteria 2377
76 Ga0466698_308367 3300042610 Bacteria 1061
77 Ga0466731_235939 3300042622 Bacteria 1465
78 Ga0466731_403646 3300042622 Bacteria 1208
79 Ga0466703_011960 3300042636 Unclassified 1014
80 Ga0466704_049629 3300042643 Bacteria 6710
81 Ga0466704_573016 3300042643 Bacteria 11415
82 Ga0466709_410831 3300042648 Unclassified 1829
83 Ga0466725_353683 3300042654 Bacteria 13802
84 Ga0466727_069291 3300042655 Bacteria 1095
85 Ga0466727_200015 3300042655 Bacteria 3087
86 Ga0466711_116844 3300042615 Bacteria 1364
87 Ga0466726_049146 3300042619 Bacteria 5207
88 Ga0123355_10860950 3300009826 Bacteria 995
89 Ga0123356_10451806 3300010049 Bacteria 1433
90 Ga0123356_12583472 3300010049 Bacteria 636
91 Ga0123356_12977603 3300010049 Bacteria 591
92 Ga0123353_10063678 3300010167 Bacteria 5915
93 Ga0123353_10277281 3300010167 Unclassified 2578
94 Ga0123353_10335551 3300010167 Bacteria 2286
95 JGI24695J34938_10252397 3300002450 Bacteria 749
96 JGI24702J35022_10069963 3300002462 Bacteria 1888
97 JGI24702J35022_10139928 3300002462 Bacteria 1350
98 Ga0072940_1180263 3300005200 Bacteria 870
99 Ga0466693_210222 3300042592 Bacteria 16607
100 Ga0466691_116045 3300042593 Bacteria 2405
101 Ga0466699_010107 3300042597 Bacteria 11886
102 Ga0466707_201578 3300042601 Bacteria 1177
103 Ga0466707_247452 3300042601 Bacteria 17099
104 Ga0466720_004863 3300042607 Unclassified 1744
105 Ga0466721_335303 3300042608 Bacteria 1585
106 Ga0466704_332930 3300042643 Unclassified 1766
107 Ga0466708_011007 3300042652 Unclassified 1651
108 Ga0466708_036871 3300042652 Bacteria 10315
109 Ga0466708_268659 3300042652 Unclassified 2316
110 Ga0466711_003009 3300042615 Bacteria 1946
111 Ga0466723_028299 3300042618 Bacteria 6469
112 Ga0123356_10026849 3300010049 Bacteria 5401
113 Ga0466691_136138 3300042593 Bacteria 21997
114 Ga0466699_219094 3300042597 Bacteria 1302
115 Ga0466701_045977 3300042598 Bacteria 2492
116 Ga0466700_326399 3300042600 Bacteria 1021
117 Ga0466707_183175 3300042601 Bacteria 1852
118 Ga0466707_206217 3300042601 Bacteria 11154
119 Ga0466722_016514 3300042609 Bacteria 3194
120 Ga0466729_248667 3300042621 Unclassified 1318
121 Ga0466734_148542 3300042623 Bacteria 3622
122 Ga0466702_025742 3300042635 Bacteria 1262
123 Ga0466703_126815 3300042636 Bacteria 1486
124 Ga0466704_367914 3300042643 Bacteria 3352
125 Ga0466708_237222 3300042652 Unclassified 1126
126 Ga0466708_410766 3300042652 Unclassified 2031
127 Ga0466708_458270 3300042652 Bacteria 1050
128 Ga0466725_299883 3300042654 Bacteria 2651
129 Ga0466727_039761 3300042655 Unclassified 1819
130 Ga0466727_065816 3300042655 Bacteria 2540
131 Ga0466715_343151 3300042616 Bacteria 6523
132 Ga0466726_145287 3300042619 Bacteria 10654
133 Ga0123357_10292158 3300009784 Bacteria 1663
134 Ga0123356_10101965 3300010049 Bacteria 2755
135 Ga0123356_10519999 3300010049 Bacteria 1348
136 AustNasuHG_c1037888 3300000089 Bacteria 1223
137 JGI24695J34938_10000334 3300002450 Bacteria 46476
138 Ga0068302_10125193 3300005071 Bacteria 1770
139 Ga0466733_072363 3300042659 Unclassified 1155
140 Ga0264413_125672 3300024493 Unclassified 3675
141 Ga0466696_151999 3300042596 Bacteria 1659
142 Ga0466699_151252 3300042597 Bacteria 5953
143 Ga0466707_162975 3300042601 Bacteria 1301
144 Ga0466707_208689 3300042601 Bacteria 2015
145 Ga0466719_246303 3300042606 Bacteria 2700
146 Ga0466734_041376 3300042623 Bacteria 1221
147 Ga0466708_096932 3300042652 Bacteria 1706
148 Ga0466710_414215 3300042613 Bacteria 2360
149 Ga0466712_001059 3300042614 Unclassified 1296
150 Ga0466711_132179 3300042615 Bacteria 4399
151 Ga0466715_104612 3300042616 Bacteria 8147
152 Ga0466718_024692 3300042617 Bacteria 3486
153 Ga0466726_016357 3300042619 Bacteria 2310
154 Ga0123356_14006992 3300010049 Bacteria 507
155 JGI24698J34947_10123347 3300002449 Unclassified 1120
156 JGI24702J35022_10017686 3300002462 Bacteria 3893
157 JGI24702J35022_10079552 3300002462 Unclassified 1775
158 JGI24702J35022_10985210 3300002462 Bacteria 525
159 Ga0466697_231183 3300042611 Unclassified 1218
160 Ga0466697_242460 3300042611 Bacteria 1253
161 Ga0466705_170819 3300042612 Bacteria 1817
162 Ga0466705_372093 3300042612 Bacteria 2460
163 Ga0264413_106811 3300024493 Unclassified 7914
164 Ga0264413_125901 3300024493 Bacteria 3762
165 Ga0466656_045592 3300042550 Bacteria 9087
166 Ga0466691_023853 3300042593 Bacteria 11971
167 Ga0466694_209431 3300042594 Bacteria 5138
168 Ga0466694_361920 3300042594 Bacteria 1051
169 Ga0466701_099006 3300042598 Bacteria 7167
170 Ga0466717_098137 3300042604 Bacteria 2122
171 Ga0466716_121392 3300042605 Bacteria 28760
172 Ga0466719_416486 3300042606 Bacteria 3509
173 Ga0466719_487790 3300042606 Unclassified 2017
174 Ga0466697_042553 3300042611 Bacteria 1057
175 Ga0466731_004442 3300042622 Unclassified 1278
176 Ga0466731_113718 3300042622 Bacteria 1333
177 Ga0466709_213527 3300042648 Bacteria 23621
178 Ga0466712_219434 3300042614 Bacteria 3983
179 Ga0466712_279320 3300042614 Bacteria 6879
180 Ga0466723_177785 3300042618 Bacteria 7123
181 Ga0466726_461470 3300042619 Bacteria 1641
182 Ga0123357_10072289 3300009784 Bacteria 4571
183 Ga0123356_11133095 3300010049 Bacteria 950
184 Ga0123353_11385966 3300010167 Bacteria 905
185 Ga0123354_10424185 3300010882 Unclassified 1102
186 JGI24695J34938_10128876 3300002450 Bacteria 1031
187 JGI24702J35022_10211318 3300002462 Bacteria 1114
188 JGI24702J35022_10721667 3300002462 Bacteria 620
189 Ga0068305_10052779 3300005083 Bacteria 502
190 Ga0072940_1029184 3300005200 Unclassified 1065

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_332930 Ga0466704_332930_819_1145 108
2 3300042611 Ga0466697_231183 Ga0466697_231183_548_904 118
3 3300002450 JGI24695J34938_10128876 JGI24695J34938_101288761 121
4 3300042601 Ga0466707_010264 Ga0466707_010264_662_1033 123
5 3300005201 Ga0072941_1181765 Ga0072941_11817653 128
6 3300010049 Ga0123356_12583472 Ga0123356_125834721 128
7 3300042600 Ga0466700_326399 Ga0466700_326399_232_621 129
8 3300042601 Ga0466707_402360 Ga0466707_402360_735_1124 129
9 3300002462 JGI24702J35022_10079552 JGI24702J35022_100795524 130
10 3300024493 Ga0264413_104132 Ga0264413_10413215 132
11 3300024493 Ga0264413_106811 Ga0264413_1068115 132
12 3300024493 Ga0264413_125672 Ga0264413_1256726 132
13 3300024493 Ga0264413_127705 Ga0264413_1277052 132
14 3300042597 Ga0466699_099435 Ga0466699_099435_177_575 132
15 3300042597 Ga0466699_219094 Ga0466699_219094_157_555 132
16 3300042601 Ga0466707_201578 Ga0466707_201578_358_756 132
17 3300042601 Ga0466707_247452 Ga0466707_247452_14882_15280 132
18 3300042606 Ga0466719_138882 Ga0466719_138882_1596_1994 132
19 3300042606 Ga0466719_416486 Ga0466719_416486_2761_3159 132
20 3300042607 Ga0466720_004863 Ga0466720_004863_823_1221 132
21 3300042607 Ga0466720_191140 Ga0466720_191140_4999_5397 132
22 3300042607 Ga0466720_192567 Ga0466720_192567_944_1342 132
23 3300042607 Ga0466720_227306 Ga0466720_227306_1160_1558 132
24 3300042609 Ga0466722_016514 Ga0466722_016514_2147_2545 132
25 3300042609 Ga0466722_176111 Ga0466722_176111_1774_2172 132
26 3300042614 Ga0466712_279320 Ga0466712_279320_5232_5630 132
27 3300042617 Ga0466718_024692 Ga0466718_024692_2465_2863 132
28 3300042617 Ga0466718_121077 Ga0466718_121077_347_745 132
29 3300042635 Ga0466702_025742 Ga0466702_025742_668_1066 132
30 3300042635 Ga0466702_103892 Ga0466702_103892_370_768 132
31 3300042655 Ga0466727_065816 Ga0466727_065816_1370_1768 132
32 iso_pr_bacteria 2819992462 2819993477 132
33 iso_pr_bacteria 2820020240 2820020303 132
34 3300002449 JGI24698J34947_10123347 JGI24698J34947_101233472 133
35 3300005200 Ga0072940_1109721 Ga0072940_11097212 133
36 3300024493 Ga0264413_102130 Ga0264413_1021303 133
37 3300042590 Ga0466690_010791 Ga0466690_010791_4151_4552 133
38 3300042593 Ga0466691_116045 Ga0466691_116045_1001_1402 133
39 3300042593 Ga0466691_136138 Ga0466691_136138_1800_2201 133
40 3300042594 Ga0466694_209431 Ga0466694_209431_3492_3893 133
41 3300042594 Ga0466694_361920 Ga0466694_361920_295_696 133
42 3300042596 Ga0466696_151999 Ga0466696_151999_432_833 133
43 3300042597 Ga0466699_054860 Ga0466699_054860_218_619 133
44 3300042598 Ga0466701_041410 Ga0466701_041410_393_794 133
45 3300042598 Ga0466701_060472 Ga0466701_060472_1936_2337 133
46 3300042599 Ga0466706_198488 Ga0466706_198488_750_1151 133
47 3300042600 Ga0466700_159960 Ga0466700_159960_1355_1756 133
48 3300042601 Ga0466707_111455 Ga0466707_111455_1771_2172 133
49 3300042601 Ga0466707_162975 Ga0466707_162975_265_666 133
50 3300042601 Ga0466707_183175 Ga0466707_183175_640_1041 133
51 3300042601 Ga0466707_206217 Ga0466707_206217_1365_1766 133
52 3300042601 Ga0466707_208689 Ga0466707_208689_868_1269 133
53 3300042604 Ga0466717_254524 Ga0466717_254524_3394_3795 133
54 3300042605 Ga0466716_121392 Ga0466716_121392_19838_20239 133
55 3300042606 Ga0466719_183553 Ga0466719_183553_163_564 133
56 3300042606 Ga0466719_222435 Ga0466719_222435_466_867 133
57 3300042606 Ga0466719_487790 Ga0466719_487790_829_1230 133
58 3300042607 Ga0466720_045069 Ga0466720_045069_12784_13185 133
59 3300042608 Ga0466721_335303 Ga0466721_335303_644_1045 133
60 3300042610 Ga0466698_308367 Ga0466698_308367_94_495 133
61 3300042612 Ga0466705_170819 Ga0466705_170819_1193_1594 133
62 3300042612 Ga0466705_175795 Ga0466705_175795_380_781 133
63 3300042612 Ga0466705_196362 Ga0466705_196362_930_1331 133
64 3300042612 Ga0466705_216887 Ga0466705_216887_6297_6698 133
65 3300042612 Ga0466705_372093 Ga0466705_372093_1315_1716 133
66 3300042612 Ga0466705_432689 Ga0466705_432689_11300_11701 133
67 3300042614 Ga0466712_001059 Ga0466712_001059_269_670 133
68 3300042615 Ga0466711_003009 Ga0466711_003009_556_957 133
69 3300042615 Ga0466711_116844 Ga0466711_116844_247_648 133
70 3300042615 Ga0466711_132179 Ga0466711_132179_2912_3313 133
71 3300042616 Ga0466715_189900 Ga0466715_189900_23_424 133
72 3300042616 Ga0466715_343151 Ga0466715_343151_422_823 133
73 3300042618 Ga0466723_028299 Ga0466723_028299_818_1219 133
74 3300042618 Ga0466723_177785 Ga0466723_177785_4149_4550 133
75 3300042619 Ga0466726_016357 Ga0466726_016357_1884_2285 133
76 3300042619 Ga0466726_049146 Ga0466726_049146_4485_4886 133
77 3300042619 Ga0466726_145287 Ga0466726_145287_6116_6517 133
78 3300042619 Ga0466726_147772 Ga0466726_147772_1041_1442 133
79 3300042619 Ga0466726_164520 Ga0466726_164520_1714_2115 133
80 3300042620 Ga0466728_004271 Ga0466728_004271_3219_3620 133
81 3300042620 Ga0466728_054375 Ga0466728_054375_947_1348 133
82 3300042620 Ga0466728_119322 Ga0466728_119322_408_809 133
83 3300042620 Ga0466728_167793 Ga0466728_167793_2205_2606 133
84 3300042621 Ga0466729_248667 Ga0466729_248667_579_980 133
85 3300042621 Ga0466729_312574 Ga0466729_312574_824_1225 133
86 3300042636 Ga0466703_011960 Ga0466703_011960_222_623 133
87 3300042636 Ga0466703_086583 Ga0466703_086583_740_1141 133
88 3300042636 Ga0466703_126815 Ga0466703_126815_518_919 133
89 3300042643 Ga0466704_049629 Ga0466704_049629_4755_5156 133
90 3300042643 Ga0466704_258618 Ga0466704_258618_634_1035 133
91 3300042643 Ga0466704_341635 Ga0466704_341635_31439_31840 133
92 3300042643 Ga0466704_367914 Ga0466704_367914_1065_1466 133
93 3300042643 Ga0466704_418637 Ga0466704_418637_449_850 133
94 3300042643 Ga0466704_468920 Ga0466704_468920_633_1034 133
95 3300042643 Ga0466704_514884 Ga0466704_514884_2405_2806 133
96 3300042643 Ga0466704_573016 Ga0466704_573016_9824_10225 133
97 3300042648 Ga0466709_213527 Ga0466709_213527_14336_14737 133
98 3300042648 Ga0466709_410831 Ga0466709_410831_1196_1597 133
99 3300042652 Ga0466708_011007 Ga0466708_011007_184_585 133
100 3300042652 Ga0466708_036871 Ga0466708_036871_1308_1709 133
101 3300042652 Ga0466708_045495 Ga0466708_045495_14_415 133
102 3300042652 Ga0466708_096932 Ga0466708_096932_914_1315 133
103 3300042652 Ga0466708_157271 Ga0466708_157271_983_1384 133
104 3300042652 Ga0466708_237222 Ga0466708_237222_85_486 133
105 3300042652 Ga0466708_268659 Ga0466708_268659_1677_2078 133
106 3300042652 Ga0466708_410766 Ga0466708_410766_453_854 133
107 3300042652 Ga0466708_414482 Ga0466708_414482_826_1227 133
108 3300042652 Ga0466708_458270 Ga0466708_458270_136_537 133
109 3300042654 Ga0466725_152332 Ga0466725_152332_5416_5817 133
110 3300042654 Ga0466725_299883 Ga0466725_299883_370_771 133
111 3300042654 Ga0466725_353683 Ga0466725_353683_1165_1566 133
112 3300042655 Ga0466727_039761 Ga0466727_039761_1364_1765 133
113 3300042655 Ga0466727_053741 Ga0466727_053741_426_827 133
114 3300042655 Ga0466727_069291 Ga0466727_069291_323_724 133
115 3300042655 Ga0466727_200015 Ga0466727_200015_1896_2297 133
116 3300042655 Ga0466727_206302 Ga0466727_206302_503_904 133
117 3300042659 Ga0466733_078893 Ga0466733_078893_586_987 133
118 3300042659 Ga0466733_141686 Ga0466733_141686_8930_9331 133
119 iso_pr_bacteria 650716102 650880804 133
120 iso_pr_bacteria 650716102 650884282 133
121 3300000089 AustNasuHG_c1037888 AustNasuHG_10378883 134
122 3300002462 JGI24702J35022_10017686 JGI24702J35022_100176863 134
123 3300002462 JGI24702J35022_10069963 JGI24702J35022_100699633 134
124 3300002462 JGI24702J35022_10721667 JGI24702J35022_107216672 134
125 3300005071 Ga0068302_10125193 Ga0068302_101251933 134
126 3300005083 Ga0068305_10052779 Ga0068305_100527791 134
127 3300005200 Ga0072940_1409997 Ga0072940_14099971 134
128 3300010049 Ga0123356_10519999 Ga0123356_105199991 134
129 3300010049 Ga0123356_10619326 Ga0123356_106193262 134
130 3300010049 Ga0123356_11214227 Ga0123356_112142272 134
131 3300010049 Ga0123356_11717661 Ga0123356_117176612 134
132 3300010049 Ga0123356_13502466 Ga0123356_135024662 134
133 3300010049 Ga0123356_14006992 Ga0123356_140069921 134
134 3300010167 Ga0123353_11385966 Ga0123353_113859662 134
135 3300024493 Ga0264413_125901 Ga0264413_1259012 134
136 3300041968 Ga0456237_0006149 Ga0456237_0006149_1257_1661 134
137 3300042550 Ga0466656_045592 Ga0466656_045592_1817_2221 134
138 3300042591 Ga0466692_090077 Ga0466692_090077_1727_2131 134
139 3300042593 Ga0466691_023853 Ga0466691_023853_3764_4168 134
140 3300042598 Ga0466701_045977 Ga0466701_045977_1627_2031 134
141 3300042598 Ga0466701_099006 Ga0466701_099006_285_689 134
142 3300042600 Ga0466700_312029 Ga0466700_312029_5414_5818 134
143 3300042601 Ga0466707_015385 Ga0466707_015385_13019_13423 134
144 3300042604 Ga0466717_098137 Ga0466717_098137_1164_1568 134
145 3300042606 Ga0466719_246303 Ga0466719_246303_248_652 134
146 3300042610 Ga0466698_381291 Ga0466698_381291_942_1346 134
147 3300042611 Ga0466697_042553 Ga0466697_042553_50_454 134
148 3300042611 Ga0466697_060221 Ga0466697_060221_495_899 134
149 3300042613 Ga0466710_414215 Ga0466710_414215_1313_1717 134
150 3300042614 Ga0466712_140672 Ga0466712_140672_466_870 134
151 3300042622 Ga0466731_004442 Ga0466731_004442_123_527 134
152 3300042622 Ga0466731_113718 Ga0466731_113718_639_1043 134
153 3300042622 Ga0466731_169735 Ga0466731_169735_1121_1525 134
154 3300042622 Ga0466731_235939 Ga0466731_235939_497_901 134
155 3300042623 Ga0466734_041376 Ga0466734_041376_115_519 134
156 3300042654 Ga0466725_199932 Ga0466725_199932_652_1056 134
157 iso_pr_bacteria 2820741847 2820742839 134
158 iso_pr_bacteria 2820746860 2820747858 134
159 3300002462 JGI24702J35022_10139928 JGI24702J35022_101399283 135
160 3300002462 JGI24702J35022_10211318 JGI24702J35022_102113182 135
161 3300002462 JGI24702J35022_10985210 JGI24702J35022_109852101 135
162 3300009784 Ga0123357_10292158 Ga0123357_102921583 135
163 3300009826 Ga0123355_10860950 Ga0123355_108609502 135
164 3300010049 Ga0123356_10026849 Ga0123356_100268494 135
165 3300010049 Ga0123356_10451806 Ga0123356_104518061 135
166 3300010049 Ga0123356_11133095 Ga0123356_111330953 135
167 3300010049 Ga0123356_12977603 Ga0123356_129776031 135
168 3300010167 Ga0123353_10335551 Ga0123353_103355512 135
169 3300010167 Ga0123353_10374985 Ga0123353_103749853 135
170 3300010167 Ga0123353_10595966 Ga0123353_105959664 135
171 3300010167 Ga0123353_10956661 Ga0123353_109566613 135
172 3300010882 Ga0123354_10121014 Ga0123354_101210143 135
173 3300010882 Ga0123354_10424185 Ga0123354_104241853 135
174 3300042592 Ga0466693_210222 Ga0466693_210222_7710_8117 135
175 3300042597 Ga0466699_010107 Ga0466699_010107_9992_10399 135
176 3300042597 Ga0466699_151252 Ga0466699_151252_4618_5025 135
177 3300042597 Ga0466699_214363 Ga0466699_214363_174_581 135
178 3300042611 Ga0466697_242460 Ga0466697_242460_132_539 135
179 3300042614 Ga0466712_219434 Ga0466712_219434_2986_3393 135
180 3300042614 Ga0466712_314887 Ga0466712_314887_623_1030 135
181 3300042622 Ga0466731_403646 Ga0466731_403646_584_991 135
182 3300042623 Ga0466734_148542 Ga0466734_148542_965_1372 135
183 3300002450 JGI24695J34938_10000334 JGI24695J34938_1000033414 136
184 3300002450 JGI24695J34938_10252397 JGI24695J34938_102523971 136
185 3300005200 Ga0072940_1029184 Ga0072940_10291842 136
186 3300005200 Ga0072940_1180263 Ga0072940_11802631 136
187 3300005201 Ga0072941_1031060 Ga0072941_10310604 136
188 3300005201 Ga0072941_1112085 Ga0072941_11120851 136
189 3300009784 Ga0123357_10072289 Ga0123357_100722893 136
190 3300010049 Ga0123356_10101965 Ga0123356_101019653 136
191 3300010049 Ga0123356_11098192 Ga0123356_110981923 136
192 3300010167 Ga0123353_10063678 Ga0123353_100636784 136
193 3300010167 Ga0123353_10277281 Ga0123353_102772812 136
194 3300042619 Ga0466726_461470 Ga0466726_461470_499_918 139
195 3300042616 Ga0466715_104612 Ga0466715_104612_7492_7962 156
196 3300042659 Ga0466733_072363 Ga0466733_072363_568_1047 159

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01850 PIN PIN domain 4 125 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.