Protein Family IF10301

Metagenome Isolate
148 Members
54 Samples
128 Scaffolds
312.07 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_070581|Ga0466733_070581_4358_5398
Length
346 aa
Sequence
MRRSWLKYVNSGVFFRHLLFLPLKYEFNKFNKVKTKMKRRDFIKTGVAAGAALTLNFDGLQAALKSNNMVVEQVPDMVAVMGGEPEAMLDKALEELGGIGKFIKKGQKVVIKPNIGWDRKPELAANTNPGLVKALIKKCLDAGAEKVTVFDQTCDNWQRCYDNSGIAAAAKEAGAIVMPANEEKYFREVTIPNGVILKKAKIHEALVEADAWINMPILKNHGGAKLSCAMKNYMGIVWDRRFFHSNDLQQCIADICTWEKKPVLNIVDAYRIMHQNGPQGKSAADVATIKSLIASPNIIAVDTAALGMFNQVKKLDIAAVTHLGKGESLNLGSTDLKKINIKRVRM

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.8%
Kalotermitidae 26.4%
Termitidae 17.0%
Unclassified 7.5%
Passalidae 5.7%
Rhinotermitidae 3.8%
Termopsidae 3.8%

🌳 Taxonomy

Archaea 2
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
13 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
14 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
21 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
22 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
23 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
24 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
29 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
30 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
35 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
36 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
40 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
41 2923982719 Parabacteroides sp. 52 Isolate Blattidae
42 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
43 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
44 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_029464 3300042612 Bacteria 4892
2 Ga0123354_10218845 3300010882 Bacteria 2031
3 Ga0466705_400119 3300042612 Bacteria 34089
4 Ga0466711_420572 3300042615 Unclassified 4603
5 Ga0466715_150783 3300042616 Bacteria 2305
6 Ga0466715_521826 3300042616 Bacteria 60910
7 Ga0466713_065086 3300042602 Bacteria 42766
8 Ga0466713_152881 3300042602 Bacteria 22181
9 Ga0466697_008737 3300042611 Bacteria 1212
10 2227474635 2225789004 Bacteria 22751
11 JGI24696J40584_12950884 3300002834 Bacteria 2188
12 Ga0466703_072985 3300042636 Bacteria 12798
13 Ga0466704_137475 3300042643 Bacteria 11012
14 Ga0466708_080542 3300042652 Bacteria 14093
15 Ga0466690_092197 3300042590 Bacteria 28749
16 Ga0466693_262490 3300042592 Bacteria 2212
17 Ga0466696_393396 3300042596 Bacteria 4777
18 Ga0466705_102184 3300042612 Bacteria 2460
19 Ga0466733_136620 3300042659 Bacteria 3049
20 Ga0466711_000845 3300042615 Bacteria 8985
21 Ga0466711_485581 3300042615 Archaea 7989
22 Ga0466723_020739 3300042618 Bacteria 9278
23 Ga0466723_038195 3300042618 Bacteria 30632
24 Ga0466723_127056 3300042618 Bacteria 25983
25 Ga0466707_352060 3300042601 Bacteria 5193
26 IMNBL1DRAFT_c0000444 3300000062 Bacteria 34756
27 Ga0068305_10009986 3300005083 Bacteria 12441
28 Ga0466704_253595 3300042643 Unclassified 2820
29 Ga0466704_280705 3300042643 Bacteria 11568
30 Ga0466709_128894 3300042648 Bacteria 25011
31 Ga0466691_203112 3300042593 Bacteria 2891
32 Ga0466696_093668 3300042596 Bacteria 7745
33 Ga0466696_281250 3300042596 Bacteria 3332
34 Ga0466733_113177 3300042659 Bacteria 40710
35 Ga0123354_10014977 3300010882 Bacteria 12086
36 Ga0466715_138418 3300042616 Bacteria 28149
37 Ga0466715_284898 3300042616 Bacteria 18837
38 Ga0466713_143605 3300042602 Bacteria 4813
39 Ga0466719_553058 3300042606 Bacteria 14131
40 JGI24702J35022_10004215 3300002462 Unclassified 8586
41 Ga0072941_1404414 3300005201 Bacteria 2243
42 Ga0466703_267528 3300042636 Bacteria 11437
43 Ga0466709_070368 3300042648 Bacteria 3430
44 Ga0466709_345321 3300042648 Bacteria 16276
45 Ga0466708_099520 3300042652 Bacteria 3018
46 Ga0466690_246295 3300042590 Unclassified 2969
47 Ga0466690_344545 3300042590 Bacteria 20962
48 Ga0466696_207603 3300042596 Bacteria 8687
49 Ga0466696_253210 3300042596 Bacteria 201850
50 Ga0466696_253221 3300042596 Bacteria 1237
51 Ga0466732_207286 3300042656 Bacteria 11616
52 Ga0466726_325054 3300042619 Bacteria 2461
53 Ga0466716_009253 3300042605 Bacteria 2324
54 Ga0466716_417458 3300042605 Bacteria 20964
55 2227075224 2225789003 Bacteria 11325
56 2227571857 2225789004 Bacteria 13830
57 IMNBL1DRAFT_c0000468 3300000062 Bacteria 33779
58 Ga0466704_007745 3300042643 Unclassified 1559
59 Ga0466704_146857 3300042643 Bacteria 17615
60 Ga0466704_247727 3300042643 Bacteria 2686
61 Ga0466704_270760 3300042643 Bacteria 29721
62 Ga0466725_284162 3300042654 Bacteria 9060
63 Ga0466727_049674 3300042655 Bacteria 3148
64 Ga0466690_123196 3300042590 Bacteria 6940
65 Ga0466690_180916 3300042590 Bacteria 5118
66 Ga0466705_126183 3300042612 Bacteria 3488
67 Ga0466733_120112 3300042659 Bacteria 197910
68 Ga0466711_019964 3300042615 Bacteria 4618
69 Ga0466715_143523 3300042616 Bacteria 2564
70 Ga0466726_000993 3300042619 Bacteria 7440
71 Ga0466713_035097 3300042602 Bacteria 3720
72 Ga0466719_245504 3300042606 Bacteria 8163
73 Ga0466722_148343 3300042609 Bacteria 9523
74 Ga0068305_10080837 3300005083 Bacteria 4334
75 Ga0068305_10110809 3300005083 Bacteria 18257
76 Ga0466729_273653 3300042621 Archaea 2463
77 Ga0466704_032095 3300042643 Bacteria 1052
78 Ga0466727_110672 3300042655 Bacteria 2037
79 Ga0466727_178354 3300042655 Bacteria 10201
80 Ga0466727_254056 3300042655 Bacteria 3439
81 Ga0466690_393445 3300042590 Bacteria 25549
82 Ga0466691_093818 3300042593 Unclassified 1622
83 Ga0466705_325816 3300042612 Unclassified 8680
84 Ga0466733_008528 3300042659 Bacteria 2399
85 Ga0466733_070581 3300042659 Bacteria 40188
86 Ga0466711_277914 3300042615 Bacteria 30814
87 Ga0466728_415375 3300042620 Bacteria 16610
88 Ga0466707_041894 3300042601 Bacteria 3554
89 Ga0466713_067986 3300042602 Bacteria 4362
90 Ga0466719_343973 3300042606 Bacteria 2054
91 2227131093 2225789004 Unclassified 1660
92 Ga0466704_266903 3300042643 Bacteria 41558
93 Ga0466709_129537 3300042648 Bacteria 3023
94 Ga0466727_083279 3300042655 Bacteria 5020
95 Ga0466727_219718 3300042655 Bacteria 37959
96 Ga0466727_327235 3300042655 Bacteria 2558
97 Ga0466711_002120 3300042615 Bacteria 20160
98 Ga0466711_010079 3300042615 Bacteria 1292
99 Ga0466726_012021 3300042619 Bacteria 19051
100 Ga0466726_167458 3300042619 Unclassified 2833
101 Ga0466707_183401 3300042601 Bacteria 17213
102 Ga0466707_351567 3300042601 Bacteria 1187
103 Ga0466716_114211 3300042605 Bacteria 30877
104 Ga0466716_249040 3300042605 Bacteria 9709
105 Ga0466703_088036 3300042636 Unclassified 12760
106 Ga0466703_097689 3300042636 Bacteria 37276
107 Ga0466703_336099 3300042636 Bacteria 22653
108 Ga0466727_196200 3300042655 Bacteria 12184
109 Ga0466690_172624 3300042590 Bacteria 11627
110 Ga0466705_164285 3300042612 Unclassified 1129
111 Ga0123357_10035419 3300009784 Bacteria 6786
112 Ga0466715_320122 3300042616 Bacteria 8709
113 Ga0466715_563767 3300042616 Bacteria 24196
114 Ga0466726_344322 3300042619 Bacteria 3164
115 Ga0466728_131636 3300042620 Bacteria 2113
116 Ga0466728_218686 3300042620 Bacteria 4809
117 Ga0466707_007887 3300042601 Bacteria 2116
118 Ga0466713_115337 3300042602 Bacteria 64305
119 Ga0466719_233836 3300042606 Bacteria 4229
120 Ga0466719_484373 3300042606 Bacteria 5427
121 Ga0466722_146634 3300042609 Bacteria 6827
122 IMNBL1DRAFT_c0000713 3300000062 Bacteria 26512
123 Ga0466703_148080 3300042636 Bacteria 3916
124 Ga0466727_115846 3300042655 Bacteria 8491
125 Ga0466690_045334 3300042590 Bacteria 11475
126 Ga0466696_192998 3300042596 Bacteria 8888
127 Ga0466696_492998 3300042596 Bacteria 11047
128 Ga0466696_493255 3300042596 Bacteria 6560

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_246295 Ga0466690_246295_30_839 269
2 3300042619 Ga0466726_167458 Ga0466726_167458_1588_2517 289
3 3300042593 Ga0466691_093818 Ga0466691_093818_333_1262 290
4 3300042619 Ga0466726_012021 Ga0466726_012021_7452_8381 290
5 2225789004 2227131093 2227528235 291
6 3300042655 Ga0466727_110672 Ga0466727_110672_594_1523 292
7 3300005083 Ga0068305_10110809 Ga0068305_1011080919 296
8 3300042596 Ga0466696_393396 Ga0466696_393396_1813_2754 297
9 3300042611 Ga0466697_008737 Ga0466697_008737_27_920 297
10 3300042643 Ga0466704_032095 Ga0466704_032095_123_1022 299
11 3300042615 Ga0466711_010079 Ga0466711_010079_71_1006 300
12 3300042590 Ga0466690_344545 Ga0466690_344545_3502_4425 307
13 3300042609 Ga0466722_148343 Ga0466722_148343_4091_5014 307
14 3300042590 Ga0466690_045334 Ga0466690_045334_8592_9521 309
15 3300042596 Ga0466696_207603 Ga0466696_207603_5916_6845 309
16 3300042602 Ga0466713_035097 Ga0466713_035097_2598_3527 309
17 3300042602 Ga0466713_065086 Ga0466713_065086_17619_18548 309
18 3300042602 Ga0466713_152881 Ga0466713_152881_21050_21979 309
19 3300042605 Ga0466716_009253 Ga0466716_009253_775_1704 309
20 3300042605 Ga0466716_114211 Ga0466716_114211_23365_24294 309
21 3300042621 Ga0466729_273653 Ga0466729_273653_1019_1948 309
22 3300042656 Ga0466732_207286 Ga0466732_207286_4862_5791 309
23 2225789003 2227075224 2227439993 310
24 2225789004 2227474635 2227925213 310
25 3300009784 Ga0123357_10035419 Ga0123357_100354193 310
26 3300010882 Ga0123354_10014977 Ga0123354_100149777 310
27 3300010882 Ga0123354_10218845 Ga0123354_102188452 310
28 3300042590 Ga0466690_092197 Ga0466690_092197_5664_6596 310
29 3300042590 Ga0466690_123196 Ga0466690_123196_5707_6639 310
30 3300042593 Ga0466691_203112 Ga0466691_203112_1046_1978 310
31 3300042596 Ga0466696_253210 Ga0466696_253210_137136_138068 310
32 3300042606 Ga0466719_245504 Ga0466719_245504_5621_6553 310
33 3300042612 Ga0466705_164285 Ga0466705_164285_108_1040 310
34 3300042615 Ga0466711_000845 Ga0466711_000845_5988_6920 310
35 3300042615 Ga0466711_019964 Ga0466711_019964_1578_2510 310
36 3300042615 Ga0466711_420572 Ga0466711_420572_3463_4395 310
37 3300042616 Ga0466715_284898 Ga0466715_284898_11053_11985 310
38 3300042616 Ga0466715_521826 Ga0466715_521826_6017_6949 310
39 3300042616 Ga0466715_563767 Ga0466715_563767_15899_16831 310
40 3300042618 Ga0466723_020739 Ga0466723_020739_2104_3036 310
41 3300042620 Ga0466728_131636 Ga0466728_131636_608_1540 310
42 3300042620 Ga0466728_415375 Ga0466728_415375_6180_7112 310
43 3300042636 Ga0466703_072985 Ga0466703_072985_6449_7381 310
44 3300042636 Ga0466703_097689 Ga0466703_097689_20700_21632 310
45 3300042643 Ga0466704_007745 Ga0466704_007745_195_1127 310
46 3300042643 Ga0466704_146857 Ga0466704_146857_14977_15909 310
47 3300042643 Ga0466704_270760 Ga0466704_270760_19157_20089 310
48 3300042643 Ga0466704_280705 Ga0466704_280705_7087_8019 310
49 3300042648 Ga0466709_070368 Ga0466709_070368_2432_3364 310
50 3300042648 Ga0466709_129537 Ga0466709_129537_389_1321 310
51 3300042659 Ga0466733_008528 Ga0466733_008528_1125_2057 310
52 iso_pr_bacteria 2923982719 2923983600 310
53 iso_pr_bacteria 2940195863 2940196829 310
54 iso_pr_bacteria 2940199050 2940199104 310
55 iso_pr_bacteria 2940202316 2940202662 310
56 iso_pr_bacteria 2940205530 2940206485 310
57 iso_pr_bacteria 2940209341 2940210244 310
58 iso_pr_bacteria 2940212447 2940213241 310
59 iso_pr_bacteria 2940298504 2940299455 310
60 iso_pr_bacteria 2940302308 2940303102 310
61 iso_pr_bacteria 2940306115 2940306984 310
62 iso_pr_bacteria 2940309933 2940310801 310
63 iso_pr_bacteria 2940313741 2940314484 310
64 iso_pr_bacteria 2940317558 2940318298 310
65 iso_pr_bacteria 2940321370 2940322111 310
66 iso_pr_bacteria 2940325180 2940325974 310
67 iso_pr_bacteria 2940328985 2940329939 310
68 iso_pr_bacteria 2940332795 2940333664 310
69 iso_pr_bacteria 2940346213 2940346568 310
70 iso_pr_bacteria 2940371297 2940371531 310
71 3300000062 IMNBL1DRAFT_c0000444 IMNBL1DRAFT_000044425 311
72 3300000062 IMNBL1DRAFT_c0000713 IMNBL1DRAFT_00007139 311
73 3300042609 Ga0466722_146634 Ga0466722_146634_1794_2729 311
74 3300042655 Ga0466727_178354 Ga0466727_178354_7652_8587 311
75 3300042659 Ga0466733_120112 Ga0466733_120112_117020_117955 311
76 3300042619 Ga0466726_000993 Ga0466726_000993_3523_4461 312
77 3300042655 Ga0466727_254056 Ga0466727_254056_967_1905 312
78 iso_pr_bacteria 2740892545 2743906557 312
79 2225789004 2227571857 2228117555 313
80 3300000062 IMNBL1DRAFT_c0000468 IMNBL1DRAFT_000046815 313
81 3300005083 Ga0068305_10080837 Ga0068305_100808372 313
82 3300005201 Ga0072941_1404414 Ga0072941_14044142 313
83 3300042590 Ga0466690_172624 Ga0466690_172624_3379_4320 313
84 3300042592 Ga0466693_262490 Ga0466693_262490_941_1882 313
85 3300042596 Ga0466696_253221 Ga0466696_253221_99_1040 313
86 3300042596 Ga0466696_281250 Ga0466696_281250_1962_2903 313
87 3300042596 Ga0466696_492998 Ga0466696_492998_4976_5917 313
88 3300042596 Ga0466696_493255 Ga0466696_493255_1657_2598 313
89 3300042601 Ga0466707_007887 Ga0466707_007887_298_1239 313
90 3300042601 Ga0466707_041894 Ga0466707_041894_743_1684 313
91 3300042602 Ga0466713_067986 Ga0466713_067986_3162_4103 313
92 3300042602 Ga0466713_115337 Ga0466713_115337_53696_54637 313
93 3300042602 Ga0466713_143605 Ga0466713_143605_3803_4744 313
94 3300042605 Ga0466716_249040 Ga0466716_249040_2180_3121 313
95 3300042605 Ga0466716_417458 Ga0466716_417458_9093_10034 313
96 3300042606 Ga0466719_343973 Ga0466719_343973_807_1748 313
97 3300042606 Ga0466719_484373 Ga0466719_484373_2739_3680 313
98 3300042606 Ga0466719_553058 Ga0466719_553058_4388_5329 313
99 3300042612 Ga0466705_029464 Ga0466705_029464_1978_2919 313
100 3300042612 Ga0466705_126183 Ga0466705_126183_1186_2127 313
101 3300042612 Ga0466705_325816 Ga0466705_325816_381_1322 313
102 3300042615 Ga0466711_002120 Ga0466711_002120_9188_10129 313
103 3300042615 Ga0466711_277914 Ga0466711_277914_959_1900 313
104 3300042616 Ga0466715_138418 Ga0466715_138418_15271_16212 313
105 3300042616 Ga0466715_150783 Ga0466715_150783_871_1812 313
106 3300042616 Ga0466715_320122 Ga0466715_320122_1036_1977 313
107 3300042618 Ga0466723_038195 Ga0466723_038195_27686_28627 313
108 3300042618 Ga0466723_127056 Ga0466723_127056_7403_8344 313
109 3300042619 Ga0466726_325054 Ga0466726_325054_426_1367 313
110 3300042619 Ga0466726_344322 Ga0466726_344322_462_1403 313
111 3300042620 Ga0466728_218686 Ga0466728_218686_2132_3073 313
112 3300042636 Ga0466703_148080 Ga0466703_148080_411_1352 313
113 3300042636 Ga0466703_267528 Ga0466703_267528_8080_9021 313
114 3300042643 Ga0466704_137475 Ga0466704_137475_4126_5067 313
115 3300042643 Ga0466704_266903 Ga0466704_266903_21645_22586 313
116 3300042648 Ga0466709_128894 Ga0466709_128894_15836_16777 313
117 3300042652 Ga0466708_080542 Ga0466708_080542_3634_4575 313
118 3300042655 Ga0466727_049674 Ga0466727_049674_1866_2807 313
119 3300042655 Ga0466727_115846 Ga0466727_115846_1406_2347 313
120 3300042655 Ga0466727_196200 Ga0466727_196200_4289_5230 313
121 3300042655 Ga0466727_219718 Ga0466727_219718_28657_29598 313
122 3300042655 Ga0466727_327235 Ga0466727_327235_261_1202 313
123 3300002462 JGI24702J35022_10004215 JGI24702J35022_100042152 314
124 3300002834 JGI24696J40584_12950884 JGI24696J40584_129508842 314
125 3300005083 Ga0068305_10009986 Ga0068305_100099867 314
126 3300042654 Ga0466725_284162 Ga0466725_284162_2313_3257 314
127 3300042659 Ga0466733_136620 Ga0466733_136620_321_1310 314
128 3300042601 Ga0466707_183401 Ga0466707_183401_5955_6902 315
129 3300042612 Ga0466705_102184 Ga0466705_102184_233_1183 316
130 3300042636 Ga0466703_088036 Ga0466703_088036_356_1306 316
131 3300042643 Ga0466704_247727 Ga0466704_247727_1371_2321 316
132 3300042643 Ga0466704_253595 Ga0466704_253595_393_1343 316
133 3300042606 Ga0466719_233836 Ga0466719_233836_1273_2226 317
134 3300042616 Ga0466715_143523 Ga0466715_143523_836_1789 317
135 3300042652 Ga0466708_099520 Ga0466708_099520_66_1025 319
136 3300042596 Ga0466696_093668 Ga0466696_093668_2000_2962 320
137 3300042596 Ga0466696_192998 Ga0466696_192998_2173_3135 320
138 3300042590 Ga0466690_393445 Ga0466690_393445_23007_23972 321
139 3300042612 Ga0466705_400119 Ga0466705_400119_17165_18130 321
140 3300042636 Ga0466703_336099 Ga0466703_336099_17481_18446 321
141 3300042615 Ga0466711_485581 Ga0466711_485581_6749_7717 322
142 3300042601 Ga0466707_352060 Ga0466707_352060_2096_3079 327
143 3300042655 Ga0466727_083279 Ga0466727_083279_327_1316 329
144 3300042590 Ga0466690_180916 Ga0466690_180916_539_1531 330
145 3300042601 Ga0466707_351567 Ga0466707_351567_44_1042 332
146 3300042659 Ga0466733_113177 Ga0466733_113177_1633_2637 334
147 3300042659 Ga0466733_070581 Ga0466733_070581_4358_5398 346
148 3300042648 Ga0466709_345321 Ga0466709_345321_161_1402 413

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04015 DUF362 Domain of unknown function (DUF362) 109 306 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.