Protein Family IF10296

Metagenome Isolate
508 Members
395 Samples
192 Scaffolds
242.84 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_058172|Ga0466733_058172_64_930
Length
288 aa
Sequence
LLSFDVFFEIPVFTDCFKWHHCRYFMLLLGNAMPDSETNDMTPPEFQRSYGRALDEMRPITFERNFTRHAEGSVLTVFGDTKIICTASIEQRVPPFLRGTGRGWLTAEYGMLPRATHTRSDREAARGRQTGRTQEIQRLIGRSLRAAFDLDAFGERTLQLDCDVIQADGGTRTASICGAMIAAYDALSEMVDDGIIERVPLRHFVGAISVGMMQGVPLLDLDYQEDSMCDADVNVVMTEEGKFVEVQGTAEGEVFDRAALDRMLIIAEKGIAELIGLQKAILNLDGRY

πŸ“Š Sample Types

Isolate 62.2%
Metagenome 37.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Apidae 22.9%
Coreidae 19.5%
Unclassified 18.8%
Termitidae 6.5%
Drosophilidae 4.7%
Formicidae 3.4%
Kalotermitidae 3.4%
Anthocoridae 2.6%
Elmidae 2.3%
Armadillidiidae 1.3%
Cambaridae 1.3%
Sarcophagidae 1.0%
Hydrophilidae 1.0%
Rhinotermitidae 0.8%
Talitridae 0.8%
Dytiscidae 0.8%
Termopsidae 0.8%
Culicidae 0.8%
Largidae 0.5%
Palinuridae 0.5%
Passalidae 0.5%
Tenebrionidae 0.5%
Scarabaeidae 0.5%
Ixodidae 0.5%
Berytidae 0.5%
Aleyrodidae 0.5%
Alydidae 0.5%
Chironomidae 0.3%
Trigoniulidae 0.3%
Daphniidae 0.3%
Thomisidae 0.3%
Hodotermitidae 0.3%
Pediculidae 0.3%
Artemiidae 0.3%
Penaeidae 0.3%
Gryllidae 0.3%
Curculionidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 493
Eukaryota 0
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2511231129 Vibrio sp. EJY3 Isolate Unclassified
2 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
3 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
4 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
5 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
6 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
7 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
8 2820098966 Unclassified Proteobacteria Lab288P1bin49 Isolate Unclassified
9 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
10 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
11 2834098943 Gilliamella apis NO3 Isolate Apidae
12 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
13 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
14 2846480698 Gilliamella apis N-G4 Isolate Apidae
15 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
16 2857881114 Gilliamella apis N-G3 Isolate Apidae
17 2864755708 Massilia timonae S00006 Isolate Elmidae
18 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
19 2868494745 Gilliamella apis NO1 Isolate Apidae
20 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
21 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
22 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
23 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
24 2876016455 Gilliamella apicola N6 Isolate Apidae
25 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
26 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
27 2908136803 Vibrio owensii 1700302 Isolate Unclassified
28 2967491045 Entomobacter blattae G55GP Isolate Unclassified
29 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
30 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
31 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
32 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
33 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 640963010 Vibrio harveyi HY01 Isolate Unclassified
41 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
42 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
43 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
44 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
45 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
46 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
47 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
48 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
49 8073544309 Actinomadura sp. RB99 Isolate Termitidae
50 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
51 8088486376 Gilliamella apis ESL0172 Isolate Apidae
52 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
53 8102102351 Caballeronia sp. INML1 Isolate Coreidae
54 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
55 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
59 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
60 2556921669 Shinella sp. DD12 Isolate Daphniidae
61 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
62 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
63 2684622921 Frischella perrara Fp_167 Isolate Unclassified
64 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
65 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
66 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
67 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
68 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
69 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
70 2833532623 Frischella perrara ESL0167 Isolate Apidae
71 2840795165 Gilliamella apicola N-22 Isolate Apidae
72 2846483029 Gilliamella apis AM1 Isolate Apidae
73 2849466174 Gilliamella apis P83G Isolate Apidae
74 2854144746 Gilliamella apicola NO6 Isolate Apidae
75 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
76 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
77 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
78 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
79 2868492035 Gilliamella apicola Occ4-3 Isolate Apidae
80 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
81 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
82 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
83 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
84 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
85 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
86 3300000472 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 Metagenome Apidae
87 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
88 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
89 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
90 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
91 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
92 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
93 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
94 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
95 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
96 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
97 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
98 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
99 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
100 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
101 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
102 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
103 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
104 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
105 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
106 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
107 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
108 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
109 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
110 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
111 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
112 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
113 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
114 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
115 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
116 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
117 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
118 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
119 2841195917 Gilliamella apicola wkB7 Isolate Apidae
120 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
121 2849452216 Gilliamella apicola AW11 Isolate Apidae
122 2849455045 Gilliamella apicola NO8 Isolate Apidae
123 2850895757 Vibrio campbellii 170502 Isolate Unclassified
124 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
125 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
126 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
127 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
128 2868504459 Gilliamella apis NO4 Isolate Apidae
129 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
130 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
131 2870917785 Gilliamella apis NO15 Isolate Apidae
132 2872471378 Vibrio owensii V180403 Isolate Unclassified
133 2873636219 Gilliamella apicola App2-1 Isolate Apidae
134 2876033458 Gilliamella apicola AM6 Isolate Apidae
135 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
136 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
137 2878464769 Gilliamella apis ESL0169 Isolate Apidae
138 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
139 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
140 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
141 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
142 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
143 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
144 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
145 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
146 8022087107 Vibrio sp. OULL4 Isolate Unclassified
147 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
148 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
149 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
150 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
151 8062637095 Yimella sp. cx-51 Isolate Cambaridae
152 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
153 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
154 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
155 8102117041 Caballeronia sp. INML3 Isolate Coreidae
156 8102131453 Caballeronia sp. INML5 Isolate Coreidae
157 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
158 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
159 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
160 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
161 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
162 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
163 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
164 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
165 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
166 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
167 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
168 2684622551 Vibrio campbellii E1 Isolate Unclassified
169 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
170 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
171 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
172 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
173 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
174 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
175 2846472545 Gilliamella sp. N-W3 Isolate Apidae
176 2846475167 Gilliamella apicola N-G5 Isolate Apidae
177 2846493360 Gilliamella apis N-G1 Isolate Apidae
178 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
179 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
180 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
181 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
182 2870908367 Gilliamella apis NO13 Isolate Apidae
183 2870910722 Gilliamella apicola wkB112 Isolate Apidae
184 2873648542 Gilliamella apicola NO10 Isolate Apidae
185 2873653628 Gilliamella apicola App6-5 Isolate Apidae
186 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
187 2876014139 Gilliamella apicola wkB18 Isolate Apidae
188 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
189 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
190 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
191 2909412500 Yimella sp. cx-573 Isolate Cambaridae
192 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
193 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
194 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
195 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
196 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
197 8022096067 Vibrio sp. SALL6 Isolate Unclassified
198 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
199 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
200 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
201 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
202 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
203 8051461712 Vibrio vulnificus Vv002 Isolate
204 8060845732 Vibrio vulnificus Vv006 Isolate
205 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
206 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
207 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
208 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
209 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
210 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
211 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
212 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
213 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
214 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
215 2603880165 Burkholderiales A1 Isolate Unclassified
216 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
217 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
218 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
219 2785510746 Gilliamella sp. ESL0441 Isolate Apidae
220 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
221 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
222 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
223 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
224 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
225 2833859439 Arsenophonus endosymbiont of Aleurodicus dispersus ARAD Isolate Aleyrodidae
226 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
227 2846485327 Gilliamella apicola AM4 Isolate Apidae
228 2849471304 Gilliamella apicola NO5 Isolate Apidae
229 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
230 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
231 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
232 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
233 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
234 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
235 2873643457 Gilliamella apis A-4-12 Isolate Apidae
236 2876011797 Gilliamella apis NO16 Isolate Apidae
237 2876022486 Gilliamella apicola A8 Isolate Apidae
238 2876027665 Gilliamella apicola P54G Isolate Apidae
239 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
240 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
241 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
242 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
243 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
244 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
245 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
246 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
247 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
248 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
249 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
250 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
251 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
252 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
253 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
254 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
255 8102124461 Caballeronia sp. INML3B Isolate Coreidae
256 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
257 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
258 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
259 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
260 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
261 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
262 2515154049 Candidatus Gilliamella apicola wkB30 Isolate Apidae
263 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
264 2554235022 Vibrio parahaemolyticus v110 Isolate
265 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
266 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
267 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
268 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
269 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
270 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
271 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
272 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
273 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
274 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
275 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
276 2868489326 Gilliamella apicola N10 Isolate Apidae
277 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
278 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
279 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
280 2873633977 Gilliamella apicola wkB178 Isolate Apidae
281 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
282 2876025319 Gilliamella apis NO12 Isolate Apidae
283 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
284 2912570088 Vibrio parahaemolyticus CHN25 Isolate
285 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
286 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
287 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
288 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
289 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
290 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
291 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
292 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
293 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
294 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
295 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
296 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
297 8051551332 Vibrio vulnificus Vv003 Isolate
298 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
299 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
300 8088493931 Gilliamella apis K-MP18 Isolate Apidae
301 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
302 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
303 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
304 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
305 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
306 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
307 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
308 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
309 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
310 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
311 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
312 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
313 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
314 2832201259 Rickettsiella grylli TrM1 Isolate Unclassified
315 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
316 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
317 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
318 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
319 2857868033 Gilliamella apis P62G Isolate Apidae
320 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
321 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
322 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
323 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
324 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
325 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
326 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
327 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
328 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
329 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
330 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
331 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
332 8051534459 Vibrio vulnificus Vv004 Isolate
333 8069748016 Caballeronia sp. LP003 Isolate Coreidae
334 8088488961 Gilliamella apis ESL0169 Isolate Apidae
335 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
336 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
337 8102109360 Caballeronia sp. INML2 Isolate Coreidae
338 8102145433 Caballeronia sp. LP006 Isolate Coreidae
339 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
340 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
341 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
342 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
343 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
344 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
345 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
346 2515154034 Frischella perrara PEB0191 Isolate Apidae
347 2630968947 Frischella perrara PEB0191 Isolate Apidae
348 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
349 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
350 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
351 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
352 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
353 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
354 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
355 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
356 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
357 2846490831 Gilliamella apis ESL0172 Isolate Apidae
358 2849468476 Gilliamella apicola N-28 Isolate Apidae
359 2854129949 Gilliamella apis M1-2G Isolate Apidae
360 2854137290 Gilliamella apicola Imp1-6 Isolate Apidae
361 2854139540 Gilliamella apicola Imp1-1 Isolate Apidae
362 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
363 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
364 2857883421 Gilliamella apicola N2 Isolate Apidae
365 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
366 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
367 2868486652 Gilliamella sp. N-G2 Isolate Apidae
368 2868506828 Gilliamella apicola App4-10 Isolate Apidae
369 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
370 2870900452 Gilliamella apis NO14 Isolate Apidae
371 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
372 2873640908 Gilliamella apicola wkB308 Isolate Apidae
373 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
374 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
375 3006667155 Streptomyces sp. SID9727 Isolate
376 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
377 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
378 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
379 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
380 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
381 8023757577 Caballeronia peredens LP006 Isolate Coreidae
382 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
383 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
384 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
385 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
386 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
387 8062747827 Yimella sp. cx-51 Isolate Cambaridae
388 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
389 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
390 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
391 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
392 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
393 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
394 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
395 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_084358 3300042659 Bacteria 46146
2 IMNBL1DRAFT_c0001946 3300000062 Bacteria 14879
3 JGI24699J35502_11095727 3300002509 Bacteria 2232
4 JGI24699J35502_11132987 3300002509 Bacteria 8245
5 Ga0068305_10073451 3300005083 Bacteria 3232
6 Ga0102737_1006592 3300007142 Bacteria 2195
7 Ga0123357_10000037 3300009784 Bacteria 109871
8 Ga0466701_061643 3300042598 Bacteria 58895
9 Ga0466713_046353 3300042602 Bacteria 12193
10 Ga0466713_122186 3300042602 Bacteria 17261
11 Ga0466717_216992 3300042604 Bacteria 5329
12 Ga0466719_016151 3300042606 Bacteria 6596
13 Ga0466691_152199 3300042593 Bacteria 5641
14 Ga0466715_095407 3300042616 Bacteria 1993
15 Ga0466730_062088 3300042625 Bacteria 25879
16 Ga0466703_108854 3300042636 Bacteria 1088
17 Ga0466704_493045 3300042643 Bacteria 6344
18 Ga0466709_052678 3300042648 Bacteria 44819
19 Ga0466709_153372 3300042648 Bacteria 17249
20 Ga0466725_189606 3300042654 Bacteria 34016
21 Ga0123356_10089851 3300010049 Bacteria 2923
22 Ga0123353_10431830 3300010167 Bacteria 1947
23 Ga0466705_120833 3300042612 Bacteria 1404
24 Ga0466705_288171 3300042612 Bacteria 13351
25 Ga0466732_222761 3300042656 Bacteria 3140
26 gam1t_NODE_374822_length=207960_GC=33_9_Contigs=10 2189573031 Bacteria 208050
27 JGI24699J35502_11101689 3300002509 Unclassified 2382
28 JGI24699J35502_11112937 3300002509 Bacteria 2784
29 Ga0074278_128980 3300005721 Unclassified 78604
30 Ga0074278_133724 3300005721 Unclassified 6342
31 Ga0466700_245533 3300042600 Bacteria 11703
32 Ga0466713_077973 3300042602 Bacteria 33468
33 Ga0466713_096139 3300042602 Bacteria 4396
34 Ga0466713_151451 3300042602 Bacteria 19289
35 Ga0466719_023442 3300042606 Bacteria 6423
36 Ga0415639_203312 3300038395 Bacteria 3160
37 Ga0466711_377422 3300042615 Bacteria 2797
38 Ga0466723_144422 3300042618 Bacteria 4866
39 Ga0466729_220327 3300042621 Bacteria 13815
40 Ga0466703_071793 3300042636 Bacteria 8973
41 Ga0466703_381612 3300042636 Unclassified 3700
42 Ga0466708_220293 3300042652 Bacteria 1995
43 Ga0123357_10109738 3300009784 Bacteria 3524
44 Ga0530661_000146 3300056564 Bacteria 62976
45 gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 2189573031 Bacteria 78604
46 JGI24705J35276_12234406 3300002504 Bacteria 5489
47 JGI24705J35276_12238054 3300002504 Bacteria 15400
48 Ga0072941_1072916 3300005201 Bacteria 2792
49 Ga0103265_1001396 3300007068 Bacteria 3922
50 Ga0103267_1000031 3300007190 Bacteria 50962
51 Ga0466713_111641 3300042602 Bacteria 61633
52 Ga0466657_014324 3300042582 Bacteria 70293
53 Ga0466696_455260 3300042596 Bacteria 8121
54 Ga0466696_465936 3300042596 Bacteria 2300
55 Ga0466729_220759 3300042621 Bacteria 5801
56 Ga0466729_304783 3300042621 Bacteria 3746
57 Ga0466730_042581 3300042625 Bacteria 1449
58 Ga0466703_200343 3300042636 Bacteria 10378
59 Ga0466724_42462 3300042649 Bacteria 351483
60 Ga0123356_10066267 3300010049 Bacteria 3380
61 gam1t_NODE_660692_length=10177_GC=33_5_Contigs=5 2189573031 Unclassified 10217
62 JGI24695J34938_10013390 3300002450 Bacteria 4311
63 Ga0063521_1000329 3300003973 Bacteria 27961
64 Ga0074278_104946 3300005721 Unclassified 10217
65 Ga0074278_109978 3300005721 Bacteria 208050
66 Ga0102739_1000051 3300007095 Bacteria 57178
67 Ga0102739_1004396 3300007095 Bacteria 1992
68 Ga0103264_1000684 3300007188 Bacteria 16050
69 Ga0103267_1001917 3300007190 Bacteria 5196
70 Ga0123357_10002325 3300009784 Bacteria 21114
71 Ga0466706_009610 3300042599 Bacteria 2930
72 Ga0466707_096633 3300042601 Bacteria 37053
73 Ga0466713_150165 3300042602 Bacteria 4270
74 Ga0466722_207268 3300042609 Bacteria 29030
75 Ga0160470_101455 3300012813 Bacteria 5662
76 Ga0160467_100179 3300012829 Bacteria 86706
77 Ga0466657_103727 3300042582 Bacteria 3315
78 Ga0466657_281718 3300042582 Bacteria 25446
79 Ga0466692_129845 3300042591 Bacteria 6378
80 Ga0466691_000120 3300042593 Bacteria 1396
81 Ga0466691_114506 3300042593 Bacteria 46394
82 Ga0466696_224708 3300042596 Bacteria 2109
83 Ga0466710_011931 3300042613 Bacteria 1238
84 Ga0466715_611400 3300042616 Bacteria 26472
85 Ga0466726_019495 3300042619 Bacteria 15772
86 Ga0466729_270745 3300042621 Bacteria 3399
87 Ga0466734_024748 3300042623 Bacteria 7843
88 Ga0466734_116050 3300042623 Bacteria 12189
89 Ga0466730_003163 3300042625 Bacteria 80945
90 Ga0466730_049581 3300042625 Bacteria 1586
91 Ga0466724_29532 3300042649 Bacteria 2193
92 Ga0466708_016675 3300042652 Bacteria 4507
93 Ga0123357_10041740 3300009784 Bacteria 6239
94 Ga0123355_10049749 3300009826 Unclassified 6812
95 Ga0123356_10019575 3300010049 Unclassified 6415
96 Ga0466733_088459 3300042659 Bacteria 38396
97 gam1t_NODE_682365_length=11761_GC=35_2_Contigs=1 2189573031 Unclassified 11761
98 CVPL010W_10004317 3300002931 Bacteria 15865
99 Ga0104045_1022698 3300007085 Unclassified 2164
100 Ga0103264_1000054 3300007188 Bacteria 66003
101 Ga0466701_046493 3300042598 Bacteria 1432
102 Ga0466701_069317 3300042598 Bacteria 1512
103 Ga0160456_104575 3300012820 Bacteria 1797
104 Ga0160430_116857 3300012852 Bacteria 1074
105 Ga0415639_065045 3300038395 Bacteria 3208
106 Ga0466691_011223 3300042593 Bacteria 5266
107 Ga0466696_037061 3300042596 Bacteria 11147
108 Ga0466711_152100 3300042615 Bacteria 3436
109 Ga0466731_002256 3300042622 Unclassified 1132
110 Ga0466734_132045 3300042623 Bacteria 2940
111 Ga0466703_234749 3300042636 Bacteria 65854
112 Ga0466724_61258 3300042649 Bacteria 49653
113 Ga0466727_056365 3300042655 Bacteria 24162
114 Ga0123357_10077273 3300009784 Bacteria 4392
115 Ga0123353_10022930 3300010167 Bacteria 9432
116 Ga0123354_10069896 3300010882 Bacteria 5086
117 Ga0466733_029496 3300042659 Bacteria 46820
118 IMNBGM34_c000052 3300000036 Bacteria 32474
119 HBC_ctgsDRAFT_1000003 3300000333 Bacteria 65414
120 JGI24699J35502_11116952 3300002509 Bacteria 2999
121 CVPL005L_10000980 3300002938 Bacteria 31881
122 Ga0103261_1004370 3300007083 Bacteria 2129
123 Ga0102734_1002466 3300007129 Bacteria 4336
124 Ga0123357_10000171 3300009784 Bacteria 59266
125 Ga0466706_069943 3300042599 Bacteria 7581
126 Ga0466706_096626 3300042599 Bacteria 3835
127 Ga0466706_107907 3300042599 Bacteria 2073
128 Ga0466713_065971 3300042602 Bacteria 3431
129 Ga0466722_076839 3300042609 Bacteria 8280
130 Ga0160440_100007 3300012815 Bacteria 490758
131 Ga0160468_100001 3300012819 Bacteria 1115787
132 Ga0160433_100137 3300012846 Bacteria 65404
133 Ga0466710_075469 3300042613 Bacteria 20747
134 Ga0466715_004927 3300042616 Bacteria 2541
135 Ga0466718_010454 3300042617 Bacteria 3522
136 Ga0466718_137343 3300042617 Bacteria 1708
137 Ga0466730_096308 3300042625 Bacteria 1021
138 Ga0466704_132704 3300042643 Bacteria 1843
139 Ga0466709_023004 3300042648 Bacteria 14132
140 Ga0466709_176648 3300042648 Bacteria 3457
141 Ga0466725_170870 3300042654 Bacteria 6565
142 Ga0123357_10045972 3300009784 Bacteria 5921
143 Ga0123356_10001639 3300010049 Bacteria 24569
144 Ga0123353_10212196 3300010167 Bacteria 3036
145 Ga0123353_10518019 3300010167 Bacteria 1731
146 Ga0123353_10582566 3300010167 Bacteria 1605
147 Ga0160471_100706 3300012812 Bacteria 8230
148 Ga0466733_058172 3300042659 Bacteria 2001
149 SCG598B02_13083 3300000472 Bacteria 33080
150 SCG598I20_12800 3300000473 Bacteria 61526
151 Ga0074278_101544 3300005721 Unclassified 1625
152 Ga0102738_1000052 3300007141 Bacteria 76723
153 Ga0103268_1000181 3300007192 Bacteria 23761
154 Ga0466707_036532 3300042601 Bacteria 2369
155 Ga0466713_027056 3300042602 Bacteria 19683
156 Ga0466713_075957 3300042602 Bacteria 4872
157 Ga0466717_005498 3300042604 Bacteria 1711
158 Ga0160460_100975 3300012845 Bacteria 12027
159 Ga0316159_12540 3300030930 Bacteria 2761
160 Ga0466657_038757 3300042582 Bacteria 4094
161 Ga0466657_070440 3300042582 Bacteria 10556
162 Ga0466701_005004 3300042598 Bacteria 169673
163 Ga0466710_032552 3300042613 Bacteria 43117
164 Ga0466715_144086 3300042616 Bacteria 2130
165 Ga0466728_136843 3300042620 Bacteria 1672
166 Ga0466734_172835 3300042623 Bacteria 1810
167 Ga0466703_062598 3300042636 Bacteria 2911
168 Ga0466725_022206 3300042654 Bacteria 59646
169 Ga0466727_300247 3300042655 Bacteria 5314
170 Ga0123357_10242585 3300009784 Bacteria 1948
171 Ga0123353_10169487 3300010167 Bacteria 3467
172 Ga0123353_10644104 3300010167 Bacteria 1502
173 Ga0466697_230830 3300042611 Bacteria 1085
174 Ga0466705_343740 3300042612 Bacteria 7642
175 gam1t_NODE_182659_length=6312_GC=34_4_Contigs=4 2189573031 Unclassified 6342
176 gam1t_NODE_77359_length=1625_GC=38_3_Contigs=1 2189573031 Unclassified 1625
177 Ga0103265_1000437 3300007068 Bacteria 7066
178 Ga0127657_169364 3300009457 Bacteria 2086
179 Ga0123357_10000016 3300009784 Bacteria 146511
180 Ga0466701_052541 3300042598 Unclassified 2192
181 Ga0466707_417707 3300042601 Bacteria 3220
182 Ga0466690_001033 3300042590 Bacteria 4903
183 Ga0466705_410800 3300042612 Bacteria 3428
184 Ga0466715_161467 3300042616 Bacteria 4844
185 Ga0466729_305895 3300042621 Bacteria 5939
186 Ga0466734_039580 3300042623 Bacteria 3839
187 Ga0466735_210944 3300042624 Bacteria 2054
188 Ga0466730_083470 3300042625 Bacteria 1406
189 Ga0123353_10288775 3300010167 Bacteria 2512
190 Ga0123353_11600638 3300010167 Bacteria 823
191 Ga0123354_10069573 3300010882 Bacteria 5102
192 Ga0123354_10110813 3300010882 Bacteria 3626

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_114506 Ga0466691_114506_19836_20417 193
2 3300042620 Ga0466728_136843 Ga0466728_136843_974_1588 204
3 3300042625 Ga0466730_083470 Ga0466730_083470_755_1387 210
4 3300038395 Ga0415639_203312 Ga0415639_203312_2435_3106 223
5 3300042612 Ga0466705_120833 Ga0466705_120833_16_690 224
6 iso_pr_bacteria 8067071256 8067072303 224
7 3300038395 Ga0415639_065045 Ga0415639_065045_632_1309 225
8 iso_pr_bacteria 2821316722 2821317051 225
9 3300009784 Ga0123357_10000037 Ga0123357_1000003733 227
10 3300042596 Ga0466696_465936 Ga0466696_465936_427_1110 227
11 3300042659 Ga0466733_029496 Ga0466733_029496_8214_8900 228
12 3300010882 Ga0123354_10069573 Ga0123354_100695732 230
13 3300010882 Ga0123354_10110813 Ga0123354_101108133 231
14 3300042596 Ga0466696_455260 Ga0466696_455260_1731_2453 232
15 3300042612 Ga0466705_343740 Ga0466705_343740_2447_3145 232
16 3300042598 Ga0466701_046493 Ga0466701_046493_76_801 235
17 3300042602 Ga0466713_122186 Ga0466713_122186_6518_7258 235
18 3300042599 Ga0466706_069943 Ga0466706_069943_4454_5167 237
19 3300042601 Ga0466707_096633 Ga0466707_096633_24836_25549 237
20 3300042602 Ga0466713_096139 Ga0466713_096139_2897_3610 237
21 iso_pr_bacteria 2517487021 2517564391 237
22 iso_pr_bacteria 2562617066 2562864727 237
23 iso_pr_bacteria 2832201259 2832202609 237
24 2189573031 gam1t_NODE_182659_length=6312_GC=34_4_Contigs=4 gam1t_00063950 238
25 2189573031 gam1t_NODE_374822_length=207960_GC=33_9_Contigs=10 gam1t_00101560 238
26 2189573031 gam1t_NODE_660692_length=10177_GC=33_5_Contigs=5 gam1t_00028070 238
27 2189573031 gam1t_NODE_682365_length=11761_GC=35_2_Contigs=1 gam1t_00037160 238
28 2189573031 gam1t_NODE_77359_length=1625_GC=38_3_Contigs=1 gam1t_00153080 238
29 3300007142 Ga0102737_1006592 Ga0102737_10065922 238
30 3300007190 Ga0103267_1000031 Ga0103267_100003113 238
31 3300007192 Ga0103268_1000181 Ga0103268_100018117 238
32 3300012819 Ga0160468_100001 Ga0160468_100001609 238
33 3300030930 Ga0316159_12540 Ga0316159_125402 238
34 3300042593 Ga0466691_152199 Ga0466691_152199_178_894 238
35 3300042596 Ga0466696_037061 Ga0466696_037061_2610_3326 238
36 3300042598 Ga0466701_005004 Ga0466701_005004_118520_119236 238
37 3300042598 Ga0466701_052541 Ga0466701_052541_91_807 238
38 3300042598 Ga0466701_069317 Ga0466701_069317_700_1416 238
39 3300042601 Ga0466707_417707 Ga0466707_417707_407_1123 238
40 3300042602 Ga0466713_111641 Ga0466713_111641_52903_53619 238
41 3300042604 Ga0466717_216992 Ga0466717_216992_3389_4105 238
42 3300042609 Ga0466722_207268 Ga0466722_207268_18795_19511 238
43 3300042615 Ga0466711_377422 Ga0466711_377422_86_802 238
44 3300042616 Ga0466715_004927 Ga0466715_004927_1237_1953 238
45 3300042616 Ga0466715_095407 Ga0466715_095407_248_964 238
46 3300042616 Ga0466715_161467 Ga0466715_161467_1881_2597 238
47 3300042619 Ga0466726_019495 Ga0466726_019495_5219_5935 238
48 3300042621 Ga0466729_220327 Ga0466729_220327_9429_10145 238
49 3300042621 Ga0466729_270745 Ga0466729_270745_686_1402 238
50 3300042622 Ga0466731_002256 Ga0466731_002256_361_1077 238
51 3300042623 Ga0466734_024748 Ga0466734_024748_359_1075 238
52 3300042623 Ga0466734_132045 Ga0466734_132045_328_1044 238
53 3300042624 Ga0466735_210944 Ga0466735_210944_513_1229 238
54 3300042625 Ga0466730_003163 Ga0466730_003163_34600_35316 238
55 3300042625 Ga0466730_062088 Ga0466730_062088_7033_7749 238
56 3300042636 Ga0466703_062598 Ga0466703_062598_505_1221 238
57 3300042643 Ga0466704_132704 Ga0466704_132704_995_1711 238
58 3300042643 Ga0466704_493045 Ga0466704_493045_4775_5491 238
59 3300042648 Ga0466709_052678 Ga0466709_052678_16313_17029 238
60 3300042649 Ga0466724_61258 Ga0466724_61258_13_729 238
61 3300042654 Ga0466725_189606 Ga0466725_189606_29590_30306 238
62 3300042655 Ga0466727_300247 Ga0466727_300247_146_862 238
63 3300056564 Ga0530661_000146 Ga0530661_000146_56692_57408 238
64 iso_pr_bacteria 2511231129 2511729622 238
65 iso_pr_bacteria 2515154047 2515333730 238
66 iso_pr_bacteria 2515154049 2515338029 238
67 iso_pr_bacteria 2531839005 2531867911 238
68 iso_pr_bacteria 2551306507 2553345517 238
69 iso_pr_bacteria 2554235022 2554337951 238
70 iso_pr_bacteria 2556921669 2558277135 238
71 iso_pr_bacteria 2571042430 2572511489 238
72 iso_pr_bacteria 2571042554 2572926049 238
73 iso_pr_bacteria 2599185261 2599816173 238
74 iso_pr_bacteria 2600255074 2600846258 238
75 iso_pr_bacteria 2636415586 2637163717 238
76 iso_pr_bacteria 2654587515 2654661936 238
77 iso_pr_bacteria 2663763317 2666538769 238
78 iso_pr_bacteria 2667527830 2669652655 238
79 iso_pr_bacteria 2667527887 2669887055 238
80 iso_pr_bacteria 2684622551 2684817742 238
81 iso_pr_bacteria 2684622922 2686093414 238
82 iso_pr_bacteria 2684622923 2686095754 238
83 iso_pr_bacteria 2684622924 2686098289 238
84 iso_pr_bacteria 2684622925 2686101619 238
85 iso_pr_bacteria 2684622926 2686103910 238
86 iso_pr_bacteria 2700989396 2702443026 238
87 iso_pr_bacteria 2731957638 2732531077 238
88 iso_pr_bacteria 2756170265 2756753249 238
89 iso_pr_bacteria 2785510744 2785738449 238
90 iso_pr_bacteria 2785510745 2785740917 238
91 iso_pr_bacteria 2785510746 2785742914 238
92 iso_pr_bacteria 2785510762 2785800767 238
93 iso_pr_bacteria 2820053807 2820054249 238
94 iso_pr_bacteria 2820110010 2820111579 238
95 iso_pr_bacteria 2820134530 2820135003 238
96 iso_pr_bacteria 2820166269 2820166467 238
97 iso_pr_bacteria 2820168331 2820169916 238
98 iso_pr_bacteria 2820170025 2820170578 238
99 iso_pr_bacteria 2820327087 2820327940 238
100 iso_pr_bacteria 2820820509 2820821450 238
101 iso_pr_bacteria 2833859439 2833859477 238
102 iso_pr_bacteria 2834098943 2834099377 238
103 iso_pr_bacteria 2837615801 2837616932 238
104 iso_pr_bacteria 2837618715 2837621410 238
105 iso_pr_bacteria 2838840603 2838842282 238
106 iso_pr_bacteria 2840795165 2840797061 238
107 iso_pr_bacteria 2841195917 2841198435 238
108 iso_pr_bacteria 2843334863 2843337106 238
109 iso_pr_bacteria 2843337836 2843338359 238
110 iso_pr_bacteria 2846472545 2846474193 238
111 iso_pr_bacteria 2846475167 2846475381 238
112 iso_pr_bacteria 2846480698 2846481509 238
113 iso_pr_bacteria 2846483029 2846484504 238
114 iso_pr_bacteria 2846485327 2846485838 238
115 iso_pr_bacteria 2846490831 2846491900 238
116 iso_pr_bacteria 2846493360 2846495490 238
117 iso_pr_bacteria 2846495668 2846497278 238
118 iso_pr_bacteria 2848317263 2848322205 238
119 iso_pr_bacteria 2849452216 2849454737 238
120 iso_pr_bacteria 2849455045 2849456277 238
121 iso_pr_bacteria 2849463436 2849463941 238
122 iso_pr_bacteria 2849466174 2849468074 238
123 iso_pr_bacteria 2849468476 2849469109 238
124 iso_pr_bacteria 2849471304 2849471790 238
125 iso_pr_bacteria 2850895757 2850895949 238
126 iso_pr_bacteria 2854127928 2854129533 238
127 iso_pr_bacteria 2854129949 2854130379 238
128 iso_pr_bacteria 2854137290 2854137303 238
129 iso_pr_bacteria 2854139540 2854140749 238
130 iso_pr_bacteria 2854141978 2854142623 238
131 iso_pr_bacteria 2854144746 2854145178 238
132 iso_pr_bacteria 2854149989 2854150670 238
133 iso_pr_bacteria 2857868033 2857870243 238
134 iso_pr_bacteria 2857870431 2857871147 238
135 iso_pr_bacteria 2857878760 2857880628 238
136 iso_pr_bacteria 2857881114 2857882913 238
137 iso_pr_bacteria 2857883421 2857884550 238
138 iso_pr_bacteria 2857888719 2857890363 238
139 iso_pr_bacteria 2860776474 2860779330 238
140 iso_pr_bacteria 2864804954 2864808313 238
141 iso_pr_bacteria 2864840607 2864843683 238
142 iso_pr_bacteria 2864843793 2864845596 238
143 iso_pr_bacteria 2864863795 2864866872 238
144 iso_pr_bacteria 2868486652 2868488650 238
145 iso_pr_bacteria 2868489326 2868490718 238
146 iso_pr_bacteria 2868492035 2868493260 238
147 iso_pr_bacteria 2868494745 2868495754 238
148 iso_pr_bacteria 2868497104 2868499394 238
149 iso_pr_bacteria 2868499409 2868501110 238
150 iso_pr_bacteria 2868504459 2868505860 238
151 iso_pr_bacteria 2868506828 2868506996 238
152 iso_pr_bacteria 2870897478 2870899039 238
153 iso_pr_bacteria 2870900452 2870902037 238
154 iso_pr_bacteria 2870902796 2870903925 238
155 iso_pr_bacteria 2870908367 2870908768 238
156 iso_pr_bacteria 2870910722 2870912118 238
157 iso_pr_bacteria 2870913170 2870913843 238
158 iso_pr_bacteria 2870915472 2870917389 238
159 iso_pr_bacteria 2870917785 2870919561 238
160 iso_pr_bacteria 2872471378 2872474321 238
161 iso_pr_bacteria 2873633977 2873635432 238
162 iso_pr_bacteria 2873636219 2873636463 238
163 iso_pr_bacteria 2873640908 2873641238 238
164 iso_pr_bacteria 2873643457 2873643841 238
165 iso_pr_bacteria 2873648542 2873649912 238
166 iso_pr_bacteria 2873651485 2873653544 238
167 iso_pr_bacteria 2873653628 2873655522 238
168 iso_pr_bacteria 2873656248 2873658383 238
169 iso_pr_bacteria 2875320051 2875323113 238
170 iso_pr_bacteria 2876011797 2876011934 238
171 iso_pr_bacteria 2876014139 2876015609 238
172 iso_pr_bacteria 2876016455 2876017283 238
173 iso_pr_bacteria 2876019154 2876020443 238
174 iso_pr_bacteria 2876022486 2876025149 238
175 iso_pr_bacteria 2876025319 2876027108 238
176 iso_pr_bacteria 2876027665 2876030321 238
177 iso_pr_bacteria 2876033458 2876034526 238
178 iso_pr_bacteria 2876036378 2876037882 238
179 iso_pr_bacteria 2877638525 2877640343 238
180 iso_pr_bacteria 2877647439 2877650318 238
181 iso_pr_bacteria 2878462549 2878464301 238
182 iso_pr_bacteria 2878464769 2878465709 238
183 iso_pr_bacteria 2880115952 2880116131 238
184 iso_pr_bacteria 2891720358 2891722938 238
185 iso_pr_bacteria 2898589227 2898594157 238
186 iso_pr_bacteria 2908136803 2908140065 238
187 iso_pr_bacteria 2912570088 2912570291 238
188 iso_pr_bacteria 2997380424 2997383623 238
189 iso_pr_bacteria 3003178663 3003181268 238
190 iso_pr_bacteria 640963010 641030486 238
191 iso_pr_bacteria 641522603 641582761 238
192 iso_pr_bacteria 8008122225 8008126575 238
193 iso_pr_bacteria 8022087107 8022088487 238
194 iso_pr_bacteria 8022096067 8022096211 238
195 iso_pr_bacteria 8022439116 8022443774 238
196 iso_pr_bacteria 8024031916 8024032693 238
197 iso_pr_bacteria 8042061949 8042064241 238
198 iso_pr_bacteria 8051461712 8051466028 238
199 iso_pr_bacteria 8051534459 8051538552 238
200 iso_pr_bacteria 8051551332 8051554818 238
201 iso_pr_bacteria 8060845732 8060846153 238
202 iso_pr_bacteria 8088486376 8088488198 238
203 iso_pr_bacteria 8088488961 8088490579 238
204 iso_pr_bacteria 8088491222 8088492518 238
205 iso_pr_bacteria 8088493931 8088495697 238
206 3300000333 HBC_ctgsDRAFT_1000003 HBC_ctgsDRAFT_100000312 239
207 3300000472 SCG598B02_13083 SCG598B02_1308312 239
208 3300000473 SCG598I20_12800 SCG598I20_1280018 239
209 3300002450 JGI24695J34938_10013390 JGI24695J34938_100133903 239
210 3300005721 Ga0074278_101544 Ga0074278_1015442 239
211 3300005721 Ga0074278_104946 Ga0074278_1049462 239
212 3300005721 Ga0074278_109978 Ga0074278_109978217 239
213 3300005721 Ga0074278_133724 Ga0074278_1337246 239
214 3300007085 Ga0104045_1022698 Ga0104045_10226983 239
215 3300007188 Ga0103264_1000684 Ga0103264_10006847 239
216 3300009457 Ga0127657_169364 Ga0127657_1693642 239
217 3300009784 Ga0123357_10000171 Ga0123357_1000017130 239
218 3300009784 Ga0123357_10045972 Ga0123357_100459723 239
219 3300009784 Ga0123357_10077273 Ga0123357_100772732 239
220 3300009784 Ga0123357_10242585 Ga0123357_102425852 239
221 3300009826 Ga0123355_10049749 Ga0123355_100497497 239
222 3300010049 Ga0123356_10019575 Ga0123356_100195755 239
223 3300010049 Ga0123356_10089851 Ga0123356_100898514 239
224 3300010167 Ga0123353_10169487 Ga0123353_101694871 239
225 3300012813 Ga0160470_101455 Ga0160470_1014557 239
226 3300012829 Ga0160467_100179 Ga0160467_10017986 239
227 3300012845 Ga0160460_100975 Ga0160460_10097510 239
228 3300042613 Ga0466710_032552 Ga0466710_032552_31702_32421 239
229 3300042616 Ga0466715_611400 Ga0466715_611400_4716_5435 239
230 3300042625 Ga0466730_096308 Ga0466730_096308_124_843 239
231 3300042654 Ga0466725_170870 Ga0466725_170870_2220_2939 239
232 3300042659 Ga0466733_088459 Ga0466733_088459_26784_27503 239
233 iso_pr_bacteria 2718217749 2718707301 239
234 iso_pr_bacteria 2775506951 2776480392 239
235 iso_pr_bacteria 2820834831 2820836613 239
236 iso_pr_bacteria 2856652821 2856656670 239
237 iso_pr_bacteria 2864847319 2864848768 239
238 iso_pr_bacteria 2864903489 2864908922 239
239 iso_pr_bacteria 2864926767 2864932997 239
240 iso_pr_bacteria 3002773460 3002773777 239
241 iso_pr_bacteria 8011357093 8011361578 239
242 iso_pr_bacteria 8073544309 8073545082 239
243 2189573031 gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 gam1t_00016240 240
244 3300003973 Ga0063521_1000329 Ga0063521_100032922 240
245 3300005201 Ga0072941_1072916 Ga0072941_10729164 240
246 3300007190 Ga0103267_1001917 Ga0103267_10019174 240
247 3300009784 Ga0123357_10002325 Ga0123357_100023254 240
248 3300010049 Ga0123356_10001639 Ga0123356_1000163910 240
249 3300010882 Ga0123354_10069896 Ga0123354_100698962 240
250 3300012852 Ga0160430_116857 Ga0160430_1168572 240
251 3300042600 Ga0466700_245533 Ga0466700_245533_4678_5400 240
252 3300042601 Ga0466707_036532 Ga0466707_036532_294_1016 240
253 3300042606 Ga0466719_023442 Ga0466719_023442_787_1509 240
254 3300042613 Ga0466710_011931 Ga0466710_011931_86_808 240
255 3300042636 Ga0466703_071793 Ga0466703_071793_1114_1836 240
256 3300042636 Ga0466703_108854 Ga0466703_108854_14_736 240
257 3300042636 Ga0466703_381612 Ga0466703_381612_1935_2657 240
258 3300042648 Ga0466709_176648 Ga0466709_176648_2259_2981 240
259 3300042652 Ga0466708_220293 Ga0466708_220293_46_768 240
260 iso_pr_bacteria 2515154034 2515297459 240
261 iso_pr_bacteria 2582581321 2585354193 240
262 iso_pr_bacteria 2630968947 2633886826 240
263 iso_pr_bacteria 2684622921 2686091380 240
264 iso_pr_bacteria 2756170266 2756753909 240
265 iso_pr_bacteria 2820098966 2820099527 240
266 iso_pr_bacteria 2820901319 2820902280 240
267 iso_pr_bacteria 2820914081 2820914571 240
268 iso_pr_bacteria 2833532623 2833533855 240
269 iso_pr_bacteria 2848339753 2848342010 240
270 iso_pr_bacteria 3000478755 3000481552 240
271 3300005721 Ga0074278_128980 Ga0074278_12898013 241
272 3300007083 Ga0103261_1004370 Ga0103261_10043702 241
273 3300010167 Ga0123353_10644104 Ga0123353_106441041 241
274 3300042602 Ga0466713_046353 Ga0466713_046353_5451_6176 241
275 3300042602 Ga0466713_075957 Ga0466713_075957_3355_4080 241
276 3300042602 Ga0466713_151451 Ga0466713_151451_6120_6845 241
277 3300042621 Ga0466729_304783 Ga0466729_304783_1635_2360 241
278 3300042636 Ga0466703_200343 Ga0466703_200343_9415_10140 241
279 iso_pr_bacteria 2820829137 2820829300 241
280 iso_pr_bacteria 2870361953 2870364848 241
281 iso_pr_bacteria 2873558832 2873559284 241
282 3300007068 Ga0103265_1000437 Ga0103265_10004376 242
283 3300007068 Ga0103265_1001396 Ga0103265_10013962 242
284 3300007095 Ga0102739_1000051 Ga0102739_100005110 242
285 3300012820 Ga0160456_104575 Ga0160456_1045752 242
286 3300042599 Ga0466706_096626 Ga0466706_096626_2576_3304 242
287 3300042602 Ga0466713_150165 Ga0466713_150165_1116_1844 242
288 3300042617 Ga0466718_010454 Ga0466718_010454_1298_2026 242
289 3300042623 Ga0466734_172835 Ga0466734_172835_772_1500 242
290 iso_pr_bacteria 2597490292 2598960330 242
291 iso_pr_bacteria 2816332478 2818029029 242
292 iso_pr_bacteria 2832037495 2832039342 242
293 iso_pr_bacteria 2832039703 2832041866 242
294 iso_pr_bacteria 2834852038 2834853599 242
295 iso_pr_bacteria 2854536247 2854538858 242
296 iso_pr_bacteria 2854548700 2854551194 242
297 iso_pr_bacteria 2858084324 2858085726 242
298 iso_pr_bacteria 2858089842 2858093374 242
299 iso_pr_bacteria 2858105562 2858106686 242
300 iso_pr_bacteria 2858119979 2858121050 242
301 iso_pr_bacteria 2868683769 2868685938 242
302 iso_pr_bacteria 8065338428 8065340283 242
303 3300012812 Ga0160471_100706 Ga0160471_1007062 243
304 3300042582 Ga0466657_038757 Ga0466657_038757_3158_3889 243
305 3300042625 Ga0466730_049581 Ga0466730_049581_348_1079 243
306 3300042636 Ga0466703_234749 Ga0466703_234749_42774_43505 243
307 3300042652 Ga0466708_016675 Ga0466708_016675_847_1578 243
308 3300042654 Ga0466725_022206 Ga0466725_022206_54984_55715 243
309 iso_pr_bacteria 2603880165 2606014566 243
310 iso_pr_bacteria 2630969010 2634125690 243
311 iso_pr_bacteria 2820123897 2820125351 243
312 iso_pr_bacteria 2820899690 2820900758 243
313 iso_pr_bacteria 2837204985 2837207179 243
314 iso_pr_bacteria 2858102877 2858104295 243
315 iso_pr_bacteria 2858129007 2858129699 243
316 iso_pr_bacteria 2864755708 2864759203 243
317 iso_pr_bacteria 2868677537 2868679390 243
318 iso_pr_bacteria 2883683260 2883685475 243
319 3300000036 IMNBGM34_c000052 IMNBGM34_00005219 244
320 3300002931 CVPL010W_10004317 CVPL010W_100043176 244
321 3300009784 Ga0123357_10000016 Ga0123357_1000001695 244
322 3300010167 Ga0123353_11600638 Ga0123353_116006381 244
323 3300042593 Ga0466691_000120 Ga0466691_000120_395_1129 244
324 3300042596 Ga0466696_224708 Ga0466696_224708_610_1344 244
325 3300042615 Ga0466711_152100 Ga0466711_152100_2105_2839 244
326 3300042621 Ga0466729_220759 Ga0466729_220759_4713_5447 244
327 3300042623 Ga0466734_116050 Ga0466734_116050_5030_5764 244
328 iso_pr_bacteria 2617271320 2619531933 244
329 iso_pr_bacteria 2786546124 2786628079 244
330 iso_pr_bacteria 2820803007 2820804235 244
331 iso_pr_bacteria 2843864159 2843866603 244
332 iso_pr_bacteria 2854520951 2854521822 244
333 iso_pr_bacteria 2854576727 2854578425 244
334 iso_pr_bacteria 2915166107 2915167988 244
335 iso_pr_bacteria 2915168811 2915170062 244
336 iso_pr_bacteria 8030347546 8030348162 244
337 3300002509 JGI24699J35502_11101689 JGI24699J35502_111016892 245
338 3300002509 JGI24699J35502_11112937 JGI24699J35502_111129374 245
339 3300002509 JGI24699J35502_11116952 JGI24699J35502_111169524 245
340 3300002509 JGI24699J35502_11132987 JGI24699J35502_111329877 245
341 3300009784 Ga0123357_10109738 Ga0123357_101097383 245
342 3300010167 Ga0123353_10431830 Ga0123353_104318302 245
343 3300010167 Ga0123353_10582566 Ga0123353_105825662 245
344 3300042582 Ga0466657_103727 Ga0466657_103727_2294_3031 245
345 3300042616 Ga0466715_144086 Ga0466715_144086_523_1260 245
346 3300042623 Ga0466734_039580 Ga0466734_039580_2713_3450 245
347 3300042648 Ga0466709_023004 Ga0466709_023004_9708_10445 245
348 3300042649 Ga0466724_42462 Ga0466724_42462_143495_144232 245
349 iso_pr_bacteria 2515154104 2515584345 245
350 iso_pr_bacteria 2967491045 2967491339 245
351 iso_pr_bacteria 3006667155 3006667738 245
352 iso_pr_bacteria 8053361298 8053367825 245
353 3300007129 Ga0102734_1002466 Ga0102734_10024663 246
354 3300042598 Ga0466701_061643 Ga0466701_061643_14126_14866 246
355 3300042611 Ga0466697_230830 Ga0466697_230830_323_1063 246
356 3300042649 Ga0466724_29532 Ga0466724_29532_268_1008 246
357 3300042655 Ga0466727_056365 Ga0466727_056365_4315_5055 246
358 iso_pr_bacteria 2820089333 2820091117 246
359 iso_pr_bacteria 2820121232 2820123689 246
360 iso_pr_bacteria 3003869270 3003870021 246
361 iso_pr_bacteria 3003878002 3003878853 246
362 3300007141 Ga0102738_1000052 Ga0102738_10000524 247
363 3300010167 Ga0123353_10212196 Ga0123353_102121962 247
364 3300042591 Ga0466692_129845 Ga0466692_129845_2778_3521 247
365 3300042602 Ga0466713_027056 Ga0466713_027056_3439_4182 247
366 3300042602 Ga0466713_065971 Ga0466713_065971_1250_1993 247
367 3300042604 Ga0466717_005498 Ga0466717_005498_639_1382 247
368 3300042606 Ga0466719_016151 Ga0466719_016151_3294_4037 247
369 iso_pr_bacteria 2820818506 2820819000 247
370 iso_pr_bacteria 2834230000 2834230218 247
371 iso_pr_bacteria 2873565274 2873568648 247
372 3300005083 Ga0068305_10073451 Ga0068305_100734514 248
373 3300042582 Ga0466657_014324 Ga0466657_014324_65871_66617 248
374 3300042582 Ga0466657_070440 Ga0466657_070440_8275_9021 248
375 3300042582 Ga0466657_281718 Ga0466657_281718_17729_18475 248
376 3300042590 Ga0466690_001033 Ga0466690_001033_3479_4225 248
377 3300042609 Ga0466722_076839 Ga0466722_076839_3093_3839 248
378 3300042613 Ga0466710_075469 Ga0466710_075469_16909_17655 248
379 3300042618 Ga0466723_144422 Ga0466723_144422_3264_4010 248
380 3300042659 Ga0466733_084358 Ga0466733_084358_3948_4694 248
381 iso_pr_bacteria 2820042117 2820043097 248
382 iso_pr_bacteria 2820062699 2820064344 248
383 iso_pr_bacteria 2820065746 2820067416 248
384 iso_pr_bacteria 2873589062 2873591167 248
385 3300000062 IMNBL1DRAFT_c0001946 IMNBL1DRAFT_00019469 249
386 3300002504 JGI24705J35276_12238054 JGI24705J35276_122380542 249
387 3300009784 Ga0123357_10041740 Ga0123357_100417404 249
388 3300010049 Ga0123356_10066267 Ga0123356_100662672 249
389 3300010167 Ga0123353_10022930 Ga0123353_1002293010 249
390 3300012815 Ga0160440_100007 Ga0160440_100007302 249
391 3300042602 Ga0466713_077973 Ga0466713_077973_9551_10300 249
392 3300042617 Ga0466718_137343 Ga0466718_137343_468_1217 249
393 3300042656 Ga0466732_222761 Ga0466732_222761_74_823 249
394 iso_pr_bacteria 2864968865 2864971196 249
395 3300007095 Ga0102739_1004396 Ga0102739_10043964 250
396 iso_pr_bacteria 2873571580 2873572640 250
397 iso_pr_bacteria 2873614151 2873614663 250
398 iso_pr_bacteria 2873617540 2873619898 250
399 iso_pr_bacteria 2873620646 2873622669 250
400 3300010167 Ga0123353_10288775 Ga0123353_102887753 251
401 iso_pr_bacteria 2524023214 2524489463 251
402 iso_pr_bacteria 2820131053 2820132419 251
403 iso_pr_bacteria 2909412500 2909413206 251
404 iso_pr_bacteria 2597489944 2598056864 252
405 iso_pr_bacteria 8023724303 8023728827 252
406 iso_pr_bacteria 8023747282 8023751962 252
407 iso_pr_bacteria 8023752828 8023755763 252
408 iso_pr_bacteria 8023757577 8023762101 252
409 iso_pr_bacteria 8023764196 8023768830 252
410 iso_pr_bacteria 8024001094 8024001819 252
411 iso_pr_bacteria 8024014383 8024015054 252
412 iso_pr_bacteria 8024019580 8024021720 252
413 iso_pr_bacteria 8024025509 8024027595 252
414 iso_pr_bacteria 8024037630 8024038308 252
415 iso_pr_bacteria 8024044713 8024045408 252
416 iso_pr_bacteria 8025650824 8025651504 252
417 iso_pr_bacteria 8025658853 8025659875 252
418 iso_pr_bacteria 8025666332 8025667026 252
419 iso_pr_bacteria 8025671076 8025671735 252
420 iso_pr_bacteria 8025678175 8025678873 252
421 iso_pr_bacteria 8025685901 8025686963 252
422 iso_pr_bacteria 8025694439 8025695208 252
423 iso_pr_bacteria 8025708040 8025708789 252
424 iso_pr_bacteria 8025723035 8025723701 252
425 iso_pr_bacteria 8025735396 8025735475 252
426 iso_pr_bacteria 8025740903 8025741578 252
427 iso_pr_bacteria 8025747911 8025748633 252
428 iso_pr_bacteria 8025756023 8025756745 252
429 iso_pr_bacteria 8069748016 8069751202 252
430 iso_pr_bacteria 8069755105 8069755827 252
431 iso_pr_bacteria 8069763219 8069763894 252
432 iso_pr_bacteria 8069770227 8069774907 252
433 iso_pr_bacteria 8069775773 8069778708 252
434 iso_pr_bacteria 8078130113 8078130790 252
435 iso_pr_bacteria 8101951471 8101952181 252
436 iso_pr_bacteria 8101960468 8101961179 252
437 iso_pr_bacteria 8101967387 8101968097 252
438 iso_pr_bacteria 8101974301 8101975015 252
439 iso_pr_bacteria 8101981714 8101982485 252
440 iso_pr_bacteria 8101988189 8101988985 252
441 iso_pr_bacteria 8102001125 8102001756 252
442 iso_pr_bacteria 8102007614 8102008326 252
443 iso_pr_bacteria 8102014801 8102015491 252
444 iso_pr_bacteria 8102020860 8102021859 252
445 iso_pr_bacteria 8102026984 8102027804 252
446 iso_pr_bacteria 8102033761 8102034714 252
447 iso_pr_bacteria 8102041249 8102041929 252
448 iso_pr_bacteria 8102047609 8102048467 252
449 iso_pr_bacteria 8102054868 8102055593 252
450 iso_pr_bacteria 8102060671 8102061503 252
451 iso_pr_bacteria 8102067727 8102068522 252
452 iso_pr_bacteria 8102074813 8102075585 252
453 iso_pr_bacteria 8102081745 8102082617 252
454 iso_pr_bacteria 8102087471 8102088222 252
455 iso_pr_bacteria 8102094248 8102095229 252
456 iso_pr_bacteria 8102102351 8102103062 252
457 iso_pr_bacteria 8102109360 8102110087 252
458 iso_pr_bacteria 8102117041 8102117720 252
459 iso_pr_bacteria 8102124461 8102125343 252
460 iso_pr_bacteria 8102131453 8102131970 252
461 iso_pr_bacteria 8102138357 8102139026 252
462 iso_pr_bacteria 8102145433 8102149957 252
463 iso_pr_bacteria 8102152052 8102156686 252
464 iso_pr_bacteria 8102161003 8102165535 252
465 iso_pr_bacteria 8102169119 8102169198 252
466 iso_pr_bacteria 8102181083 8102181749 252
467 iso_pr_bacteria 8102193924 8102194672 252
468 iso_pr_bacteria 8102208438 8102209118 252
469 iso_pr_bacteria 8102216467 8102217236 252
470 iso_pr_bacteria 8102223607 8102224266 252
471 iso_pr_bacteria 8102230706 8102231768 252
472 iso_pr_bacteria 8102239244 8102239942 252
473 iso_pr_bacteria 8102251710 8102252732 252
474 iso_pr_bacteria 8102264549 8102265367 252
475 iso_pr_bacteria 8102271933 8102272830 252
476 iso_pr_bacteria 8102279326 8102280021 252
477 iso_pr_bacteria 8102286609 8102287542 252
478 iso_pr_bacteria 8102312426 8102313205 252
479 3300042625 Ga0466730_042581 Ga0466730_042581_44_805 253
480 iso_pr_bacteria 8025701579 8025705230 253
481 iso_pr_bacteria 8025728939 8025729665 253
482 iso_pr_bacteria 8102174626 8102175352 253
483 3300002504 JGI24705J35276_12234406 JGI24705J35276_122344067 254
484 3300042612 Ga0466705_410800 Ga0466705_410800_695_1459 254
485 3300042648 Ga0466709_153372 Ga0466709_153372_13004_13768 254
486 3300012846 Ga0160433_100137 Ga0160433_10013716 256
487 3300042599 Ga0466706_009610 Ga0466706_009610_808_1578 256
488 iso_pr_bacteria 2894897082 2894897584 256
489 iso_pr_bacteria 2894900265 2894902830 256
490 iso_pr_bacteria 2894926108 2894928536 256
491 iso_pr_bacteria 2894929448 2894930932 256
492 iso_pr_bacteria 2894932631 2894933961 256
493 iso_pr_bacteria 2894935787 2894936762 256
494 iso_pr_bacteria 2894944011 2894945757 256
495 iso_pr_bacteria 2894966443 2894968046 256
496 iso_pr_bacteria 2894974975 2894977360 256
497 iso_pr_bacteria 2894981435 2894983377 256
498 3300042593 Ga0466691_011223 Ga0466691_011223_3084_3857 257
499 iso_pr_bacteria 8062637095 8062639166 258
500 iso_pr_bacteria 8062747827 8062749658 258
501 3300002938 CVPL005L_10000980 CVPL005L_100009807 259
502 3300042612 Ga0466705_288171 Ga0466705_288171_977_1756 259
503 3300007188 Ga0103264_1000054 Ga0103264_100005424 261
504 3300010167 Ga0123353_10518019 Ga0123353_105180191 268
505 3300042621 Ga0466729_305895 Ga0466729_305895_2595_3401 268
506 3300002509 JGI24699J35502_11095727 JGI24699J35502_110957272 273
507 3300042599 Ga0466706_107907 Ga0466706_107907_1100_1933 277
508 3300042659 Ga0466733_058172 Ga0466733_058172_64_930 288

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03725 RNase_PH_C 3' exoribonuclease family, domain 2 203 269 0.97
PF01138 RNase_PH 3' exoribonuclease family, domain 1 56 186 0.94

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.