Protein Family IF10292

Metagenome Isolate
135 Members
53 Samples
119 Scaffolds
213.41 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_054986|Ga0466733_054986_2365_3057
Length
230 aa
Sequence
MQDQKIRTGTLKRIDKMSLENDKEIEAYILSHIDEEGELLRELNRDAHVNLLKPRMLSGHLQGRMLKMFCRMMQPRFILEIGTYTAYATLCMAEGAADDAEIHTIEVNDELEDFIMKYLHKTKLGDKIHLHIGDAEEIIPKLDYTFDLVFIDANKRHYVEYYDLVFDKVRPGGLIIADNTLWDGHVLETAKPSDKQTIGIQRFNDVIVQDTRVEKVILPVRDGLTLIWKK

📊 Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 26.4%
Termitidae 24.5%
Blattidae 18.9%
Unclassified 9.4%
Termopsidae 7.5%
Rhinotermitidae 5.7%
Passalidae 3.8%
Hydrophilidae 3.8%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
3 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
23 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
24 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
31 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
38 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
39 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
44 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
45 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
52 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
53 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_192834 3300042612 Bacteria 18879
2 Ga0466703_352425 3300042636 Bacteria 19219
3 Ga0466709_051603 3300042648 Bacteria 8093
4 Ga0466700_391349 3300042600 Bacteria 41227
5 Ga0466713_085218 3300042602 Bacteria 7683
6 Ga0466713_101065 3300042602 Bacteria 7585
7 Ga0466715_391466 3300042616 Bacteria 8202
8 Ga0466726_092894 3300042619 Bacteria 13437
9 Ga0466703_419545 3300042636 Bacteria 23140
10 Ga0466704_009787 3300042643 Bacteria 9138
11 Ga0466704_125587 3300042643 Bacteria 8682
12 Ga0466704_365380 3300042643 Bacteria 8062
13 Ga0466724_08545 3300042649 Bacteria 3093
14 Ga0466727_005013 3300042655 Bacteria 19666
15 Ga0466719_085693 3300042606 Bacteria 13259
16 Ga0466715_005617 3300042616 Bacteria 10530
17 Ga0466715_578588 3300042616 Bacteria 9243
18 Ga0466715_581537 3300042616 Bacteria 21882
19 Ga0466728_195400 3300042620 Bacteria 87109
20 Ga0466729_065454 3300042621 Bacteria 33563
21 Ga0466733_153195 3300042659 Unclassified 2006
22 Ga0466703_153258 3300042636 Bacteria 10822
23 Ga0466704_439030 3300042643 Bacteria 6196
24 Ga0466709_058605 3300042648 Bacteria 1405
25 Ga0466709_313475 3300042648 Bacteria 1166
26 Ga0466708_179718 3300042652 Bacteria 26911
27 Ga0466696_226153 3300042596 Bacteria 17145
28 Ga0466696_319002 3300042596 Bacteria 14830
29 Ga0466707_339814 3300042601 Bacteria 1769
30 Ga0466707_341012 3300042601 Bacteria 2132
31 Ga0466713_117216 3300042602 Bacteria 74221
32 Ga0466716_021231 3300042605 Bacteria 6893
33 Ga0466711_011959 3300042615 Bacteria 7923
34 Ga0466715_014665 3300042616 Bacteria 23433
35 Ga0466715_470418 3300042616 Bacteria 18054
36 Ga0466728_106676 3300042620 Bacteria 7774
37 Ga0466728_431241 3300042620 Bacteria 10879
38 Ga0466733_088004 3300042659 Bacteria 203974
39 Ga0466705_125662 3300042612 Bacteria 11298
40 JGI24702J35022_10059242 3300002462 Bacteria 2045
41 Ga0466703_250777 3300042636 Bacteria 1265
42 Ga0466704_150943 3300042643 Bacteria 32243
43 Ga0466709_302402 3300042648 Bacteria 78498
44 Ga0466727_188930 3300042655 Bacteria 2235
45 Ga0466693_286697 3300042592 Bacteria 1505
46 Ga0466707_244742 3300042601 Bacteria 8418
47 Ga0466713_059113 3300042602 Bacteria 26058
48 Ga0466711_141028 3300042615 Bacteria 2473
49 Ga0466705_067670 3300042612 Bacteria 8645
50 2227513242 2225789004 Bacteria 3508
51 Ga0466735_234539 3300042624 Bacteria 43852
52 Ga0466703_342417 3300042636 Bacteria 9745
53 Ga0466704_180515 3300042643 Bacteria 40267
54 Ga0466690_046717 3300042590 Bacteria 12327
55 Ga0466691_048450 3300042593 Bacteria 11729
56 Ga0466713_061077 3300042602 Bacteria 19471
57 Ga0466713_073756 3300042602 Bacteria 34943
58 Ga0466698_078477 3300042610 Bacteria 1621
59 Ga0466711_360836 3300042615 Bacteria 9906
60 Ga0466715_505487 3300042616 Bacteria 39495
61 Ga0466723_044507 3300042618 Bacteria 6391
62 Ga0466726_365365 3300042619 Unclassified 6416
63 Ga0466728_019100 3300042620 Bacteria 22777
64 Ga0466733_149816 3300042659 Bacteria 9214
65 Ga0466733_187897 3300042659 Bacteria 13973
66 Ga0466705_308399 3300042612 Bacteria 10128
67 JGI24702J35022_10000833 3300002462 Bacteria 19056
68 Ga0068305_10029659 3300005083 Bacteria 21730
69 Ga0068305_10045022 3300005083 Bacteria 9413
70 Ga0466731_400850 3300042622 Bacteria 1543
71 Ga0466703_396633 3300042636 Bacteria 1634
72 Ga0466725_179846 3300042654 Bacteria 2696
73 Ga0466727_296028 3300042655 Unclassified 1052
74 Ga0466690_027629 3300042590 Bacteria 4237
75 Ga0466696_057612 3300042596 Bacteria 41759
76 Ga0466713_034129 3300042602 Bacteria 3390
77 Ga0466713_117895 3300042602 Bacteria 41399
78 Ga0466714_074006 3300042603 Bacteria 2295
79 Ga0466716_475173 3300042605 Bacteria 6848
80 Ga0466719_249669 3300042606 Bacteria 7418
81 Ga0466719_451834 3300042606 Bacteria 2754
82 Ga0466723_148662 3300042618 Bacteria 50232
83 Ga0466728_117118 3300042620 Bacteria 1314
84 Ga0466732_187503 3300042656 Bacteria 1839
85 IMNBL1DRAFT_c0001750 3300000062 Unclassified 15923
86 Ga0068302_10043952 3300005071 Bacteria 5124
87 Ga0068305_10195053 3300005083 Bacteria 1796
88 Ga0466704_379014 3300042643 Bacteria 4370
89 Ga0466708_189255 3300042652 Bacteria 25954
90 Ga0466725_177811 3300042654 Bacteria 17602
91 Ga0466727_117496 3300042655 Bacteria 8664
92 Ga0466727_121667 3300042655 Bacteria 10729
93 Ga0466696_163030 3300042596 Bacteria 1033
94 Ga0466707_059812 3300042601 Bacteria 1900
95 Ga0466707_294139 3300042601 Bacteria 6269
96 Ga0466713_129892 3300042602 Bacteria 2427
97 Ga0466714_118870 3300042603 Bacteria 6647
98 Ga0466716_120083 3300042605 Bacteria 33522
99 Ga0466719_178196 3300042606 Bacteria 4559
100 Ga0466728_116130 3300042620 Bacteria 22142
101 Ga0466733_054986 3300042659 Bacteria 147644
102 Ga0466705_133981 3300042612 Bacteria 5258
103 Ga0466705_188110 3300042612 Bacteria 12832
104 IMNBL1DRAFT_c0068661 3300000062 Unclassified 1032
105 JGI24702J35022_10050720 3300002462 Bacteria 2211
106 Ga0466730_009756 3300042625 Bacteria 1331
107 Ga0466704_076578 3300042643 Bacteria 2531
108 Ga0466727_135651 3300042655 Bacteria 11196
109 Ga0466656_145389 3300042550 Bacteria 3672
110 Ga0466690_402089 3300042590 Bacteria 24510
111 Ga0466691_026472 3300042593 Bacteria 14277
112 Ga0466695_380910 3300042595 Bacteria 1001
113 Ga0466713_103961 3300042602 Bacteria 6433
114 Ga0466719_150647 3300042606 Bacteria 3898
115 Ga0466711_117158 3300042615 Bacteria 26788
116 Ga0466715_068340 3300042616 Bacteria 17803
117 Ga0466715_157508 3300042616 Bacteria 1826
118 Ga0466715_185370 3300042616 Bacteria 7280
119 Ga0466723_090613 3300042618 Bacteria 9009

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_296028 Ga0466727_296028_208_831 196
2 3300042606 Ga0466719_178196 Ga0466719_178196_2408_3037 201
3 3300042616 Ga0466715_578588 Ga0466715_578588_3927_4556 201
4 3300042602 Ga0466713_061077 Ga0466713_061077_16666_17289 207
5 3300042602 Ga0466713_085218 Ga0466713_085218_3766_4389 207
6 3300042602 Ga0466713_034129 Ga0466713_034129_2043_2669 208
7 3300042602 Ga0466713_103961 Ga0466713_103961_835_1461 208
8 3300042648 Ga0466709_313475 Ga0466709_313475_222_848 208
9 3300042655 Ga0466727_188930 Ga0466727_188930_279_905 208
10 3300042601 Ga0466707_341012 Ga0466707_341012_1194_1823 209
11 3300042602 Ga0466713_059113 Ga0466713_059113_8983_9612 209
12 3300042602 Ga0466713_129892 Ga0466713_129892_1643_2272 209
13 3300042603 Ga0466714_118870 Ga0466714_118870_3155_3784 209
14 3300042606 Ga0466719_451834 Ga0466719_451834_2071_2700 209
15 3300042612 Ga0466705_192834 Ga0466705_192834_2782_3411 209
16 3300042615 Ga0466711_117158 Ga0466711_117158_14577_15206 209
17 3300042616 Ga0466715_581537 Ga0466715_581537_7785_8414 209
18 3300042619 Ga0466726_365365 Ga0466726_365365_1342_1971 209
19 3300042643 Ga0466704_180515 Ga0466704_180515_29847_30476 209
20 3300042655 Ga0466727_135651 Ga0466727_135651_4121_4750 209
21 2225789004 2227513242 2228009380 210
22 3300005083 Ga0068305_10029659 Ga0068305_100296596 210
23 3300042590 Ga0466690_046717 Ga0466690_046717_6230_6862 210
24 3300042592 Ga0466693_286697 Ga0466693_286697_525_1157 210
25 3300042593 Ga0466691_026472 Ga0466691_026472_7847_8479 210
26 3300042593 Ga0466691_048450 Ga0466691_048450_5509_6141 210
27 3300042596 Ga0466696_057612 Ga0466696_057612_34965_35597 210
28 3300042596 Ga0466696_226153 Ga0466696_226153_937_1569 210
29 3300042596 Ga0466696_319002 Ga0466696_319002_5624_6256 210
30 3300042602 Ga0466713_073756 Ga0466713_073756_14670_15302 210
31 3300042606 Ga0466719_085693 Ga0466719_085693_5484_6116 210
32 3300042612 Ga0466705_067670 Ga0466705_067670_779_1411 210
33 3300042612 Ga0466705_125662 Ga0466705_125662_8009_8641 210
34 3300042612 Ga0466705_133981 Ga0466705_133981_3002_3634 210
35 3300042612 Ga0466705_308399 Ga0466705_308399_4106_4738 210
36 3300042616 Ga0466715_391466 Ga0466715_391466_2077_2709 210
37 3300042618 Ga0466723_090613 Ga0466723_090613_3315_3947 210
38 3300042636 Ga0466703_153258 Ga0466703_153258_6532_7164 210
39 3300042636 Ga0466703_419545 Ga0466703_419545_14554_15186 210
40 3300042643 Ga0466704_076578 Ga0466704_076578_510_1142 210
41 3300042643 Ga0466704_125587 Ga0466704_125587_4107_4739 210
42 3300042643 Ga0466704_365380 Ga0466704_365380_3222_3854 210
43 3300042643 Ga0466704_379014 Ga0466704_379014_1389_2021 210
44 3300042648 Ga0466709_058605 Ga0466709_058605_97_729 210
45 3300042649 Ga0466724_08545 Ga0466724_08545_768_1400 210
46 3300042654 Ga0466725_177811 Ga0466725_177811_2660_3292 210
47 3300042655 Ga0466727_121667 Ga0466727_121667_4308_4940 210
48 3300042659 Ga0466733_187897 Ga0466733_187897_4729_5361 210
49 iso_pr_bacteria 2695420931 2698108996 210
50 iso_pr_bacteria 2910930387 2910930533 210
51 3300000062 IMNBL1DRAFT_c0068661 IMNBL1DRAFT_00686612 211
52 3300042596 Ga0466696_163030 Ga0466696_163030_253_888 211
53 3300042600 Ga0466700_391349 Ga0466700_391349_31428_32063 211
54 3300042616 Ga0466715_014665 Ga0466715_014665_139_774 211
55 3300042616 Ga0466715_185370 Ga0466715_185370_6574_7209 211
56 3300042620 Ga0466728_195400 Ga0466728_195400_16969_17604 211
57 3300042622 Ga0466731_400850 Ga0466731_400850_46_681 211
58 iso_pr_bacteria 2695420317 2695486302 211
59 iso_pr_bacteria 2873600114 2873601293 211
60 iso_pr_bacteria 2873610414 2873611649 211
61 iso_pr_bacteria 8100157865 8100160569 211
62 3300002462 JGI24702J35022_10000833 JGI24702J35022_1000083310 212
63 3300042601 Ga0466707_339814 Ga0466707_339814_815_1453 212
64 3300042616 Ga0466715_005617 Ga0466715_005617_5584_6222 212
65 3300042616 Ga0466715_470418 Ga0466715_470418_12214_12852 212
66 3300042620 Ga0466728_019100 Ga0466728_019100_5443_6081 212
67 3300042643 Ga0466704_009787 Ga0466704_009787_2192_2830 212
68 3300042643 Ga0466704_150943 Ga0466704_150943_14639_15277 212
69 3300042603 Ga0466714_074006 Ga0466714_074006_868_1509 213
70 3300042605 Ga0466716_021231 Ga0466716_021231_1571_2212 213
71 3300042616 Ga0466715_068340 Ga0466715_068340_11899_12540 213
72 3300042618 Ga0466723_044507 Ga0466723_044507_5539_6180 213
73 3300042620 Ga0466728_106676 Ga0466728_106676_1390_2031 213
74 3300042620 Ga0466728_116130 Ga0466728_116130_20894_21535 213
75 3300042624 Ga0466735_234539 Ga0466735_234539_22786_23427 213
76 3300042655 Ga0466727_005013 Ga0466727_005013_1644_2285 213
77 3300002462 JGI24702J35022_10059242 JGI24702J35022_100592421 214
78 3300042590 Ga0466690_027629 Ga0466690_027629_3513_4157 214
79 3300042595 Ga0466695_380910 Ga0466695_380910_266_910 214
80 3300042601 Ga0466707_059812 Ga0466707_059812_269_913 214
81 3300042601 Ga0466707_244742 Ga0466707_244742_610_1254 214
82 3300042602 Ga0466713_101065 Ga0466713_101065_6689_7333 214
83 3300042602 Ga0466713_117216 Ga0466713_117216_22850_23494 214
84 3300042602 Ga0466713_117895 Ga0466713_117895_31957_32601 214
85 3300042612 Ga0466705_188110 Ga0466705_188110_1465_2109 214
86 3300042615 Ga0466711_141028 Ga0466711_141028_1575_2219 214
87 3300042616 Ga0466715_505487 Ga0466715_505487_32405_33049 214
88 3300042621 Ga0466729_065454 Ga0466729_065454_17897_18541 214
89 3300042625 Ga0466730_009756 Ga0466730_009756_340_984 214
90 3300042636 Ga0466703_342417 Ga0466703_342417_5657_6301 214
91 3300042636 Ga0466703_352425 Ga0466703_352425_16119_16763 214
92 3300042648 Ga0466709_302402 Ga0466709_302402_53854_54498 214
93 3300042652 Ga0466708_189255 Ga0466708_189255_10655_11299 214
94 3300042654 Ga0466725_179846 Ga0466725_179846_1789_2433 214
95 3300042656 Ga0466732_187503 Ga0466732_187503_1009_1653 214
96 3300042659 Ga0466733_088004 Ga0466733_088004_49925_50569 214
97 3300042659 Ga0466733_149816 Ga0466733_149816_39_683 214
98 3300042659 Ga0466733_153195 Ga0466733_153195_1300_1944 214
99 iso_pr_bacteria 2910926975 2910930188 214
100 iso_pr_bacteria 2910942425 2910945231 214
101 iso_pr_bacteria 2910959314 2910960466 214
102 iso_pr_bacteria 2940193328 2940194618 214
103 iso_pr_bacteria 2940244548 2940244997 214
104 iso_pr_bacteria 2940248789 2940249237 214
105 iso_pr_bacteria 2940253009 2940253037 214
106 iso_pr_bacteria 2940257232 2940257911 214
107 iso_pr_bacteria 2940336608 2940337894 214
108 iso_pr_bacteria 8100166142 8100168272 214
109 3300000062 IMNBL1DRAFT_c0001750 IMNBL1DRAFT_00017506 215
110 3300005083 Ga0068305_10195053 Ga0068305_101950533 215
111 3300042610 Ga0466698_078477 Ga0466698_078477_928_1575 215
112 3300042619 Ga0466726_092894 Ga0466726_092894_9584_10231 215
113 3300042636 Ga0466703_396633 Ga0466703_396633_925_1572 215
114 3300005071 Ga0068302_10043952 Ga0068302_100439524 216
115 3300042590 Ga0466690_402089 Ga0466690_402089_7498_8148 216
116 3300042605 Ga0466716_475173 Ga0466716_475173_772_1422 216
117 3300042618 Ga0466723_148662 Ga0466723_148662_46305_46955 216
118 3300042620 Ga0466728_117118 Ga0466728_117118_14_664 216
119 3300042648 Ga0466709_051603 Ga0466709_051603_7092_7742 216
120 3300005083 Ga0068305_10045022 Ga0068305_100450225 217
121 3300042606 Ga0466719_249669 Ga0466719_249669_5085_5738 217
122 3300042615 Ga0466711_360836 Ga0466711_360836_3551_4204 217
123 3300042636 Ga0466703_250777 Ga0466703_250777_443_1096 217
124 3300042643 Ga0466704_439030 Ga0466704_439030_3784_4440 218
125 3300002462 JGI24702J35022_10050720 JGI24702J35022_100507203 219
126 3300042601 Ga0466707_294139 Ga0466707_294139_1170_1829 219
127 3300042606 Ga0466719_150647 Ga0466719_150647_2806_3471 221
128 3300042616 Ga0466715_157508 Ga0466715_157508_166_831 221
129 3300042652 Ga0466708_179718 Ga0466708_179718_21151_21819 222
130 3300042550 Ga0466656_145389 Ga0466656_145389_2169_2846 225
131 3300042659 Ga0466733_054986 Ga0466733_054986_2365_3057 230
132 3300042655 Ga0466727_117496 Ga0466727_117496_3126_3836 236
133 3300042620 Ga0466728_431241 Ga0466728_431241_5760_6473 237
134 3300042605 Ga0466716_120083 Ga0466716_120083_11779_12531 250
135 3300042615 Ga0466711_011959 Ga0466711_011959_6009_6833 274

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01596 Methyltransf_3 O-methyltransferase 35 229 0.93
PF13578 Methyltransf_24 Methyltransferase domain 79 179 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01596 GO:0008171 O-methyltransferase activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3tfw-assembly1.cif.gz_B-2 Crystal structure of a putative O-methyltransferase from Klebsiella pneumoniae 0.936 25 230
2hnk-assembly1.cif.gz_C Crystal structure of SAM-dependent O-methyltransferase from pathogenic bacterium Leptospira interrogans 0.935 24 230
5log-assembly1.cif.gz_A Crystal Structure of SafC from Myxococcus xanthus bound to SAM 0.935 23 230
7cvv-assembly1.cif.gz_A Crystal structure of Catechol o-methyl transferase (COMT) from Niastella koreensis 0.931 24 230
3tr6-assembly1.cif.gz_A-2 Structure of a O-methyltransferase from Coxiella burnetii 0.93 24 230
IDDescriptionScoreStartEndSuperfamily
af_Q86IC9_10_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9378 24 230 3.40.50.150
2hnkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9292 24 230 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9292 24 230 3.40.50.150
af_Q86VU5_34_262_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9215 27 230 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9166 62 229 3.40.50.150
IDDescriptionScoreStartEndGO Terms
AF-A0A351NGD7-F1-model_v4 Uncharacterized/unreviewed 0.9845 125 230
AF-A0A0D8JCH9-F1-model_v4 Uncharacterized/unreviewed 0.9762 21 230 GO:0008171
GO:0008757
GO:0032259

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.