Protein Family IF10291

Metagenome Isolate
277 Members
167 Samples
180 Scaffolds
198.71 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_054280|Ga0466733_054280_2952_3611
Length
219 aa
Sequence
MVYDGPIQDLIAELSRLPGIGPKGAQRIAFFLLDAEVADVKALADAIVRAKQTVKFCQICFNATEDDICRICRDPRRDHAQICVVEESKDIIAIERTREFKGLYHVLGGAISPIDNRGPADLHIRELVLRLEDGTVTEIILATNPNTEGEATASYLSRLLSPLGVEISRLASGLPVGGDLEYADDITLGRAFEGRRVLNAPTATPSLDGAALASTGATP

📊 Sample Types

Isolate 35.0%
Metagenome 65.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.1%
Termitidae 19.7%
Apidae 7.6%
Kalotermitidae 7.6%
Anthocoridae 6.4%
Scarabaeidae 5.1%
Culicidae 4.5%
Tenebrionidae 3.8%
Elmidae 2.5%
Cambaridae 1.9%
Formicidae 1.9%
Rhinotermitidae 1.9%
Armadillidiidae 1.9%
Termopsidae 1.3%
Passalidae 1.3%
Dytiscidae 1.3%
Siricidae 0.6%
Cimicidae 0.6%
Chironomidae 0.6%
Stratiomyidae 0.6%
Hydrophilidae 0.6%
Thomisidae 0.6%
Hodotermitidae 0.6%
Cerambycidae 0.6%

🌳 Taxonomy

Archaea 1
Bacteria 255
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
2 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
3 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
4 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
5 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
6 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
7 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
8 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
9 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
10 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
11 2568526170 Bifidobacterium sp. A11 Isolate Apidae
12 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
13 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
14 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
15 3002678670 Agromyces sp. G127AT Isolate Unclassified
16 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
17 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
18 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
26 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
27 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
28 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
29 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
30 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
31 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
32 2908241010 Streptomyces sp. HF10 Isolate Termitidae
33 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
34 3006468911 Streptomyces sp. RB17 Isolate Termitidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
37 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
38 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
39 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
40 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
41 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
42 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
43 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
50 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
51 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
52 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
53 2821312900 Unclassified Proteobacteria Lab288P4bin16 Isolate Unclassified
54 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
55 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
56 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
57 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
58 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
61 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
62 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
63 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
64 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
65 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
66 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
67 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
68 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
69 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
70 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
71 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
72 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
73 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
74 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
75 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
76 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
77 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
78 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
79 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
80 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
81 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
82 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
83 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
84 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
85 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
86 8073544309 Actinomadura sp. RB99 Isolate Termitidae
87 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
88 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
89 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
90 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
91 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
92 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
93 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
94 2931430189 Tessaracoccus palaemonis J1M15 Isolate
95 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
96 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
97 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
98 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
99 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
100 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
101 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
102 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
103 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
104 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
105 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
106 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
107 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
108 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
109 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
110 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
111 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
112 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
113 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
114 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
115 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
116 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
117 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
118 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
119 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
120 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
121 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
122 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
123 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
124 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
125 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
126 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
127 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
128 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
129 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
130 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
131 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
132 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
133 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
134 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
135 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
136 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
137 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
138 2912749649 Streptomyces sp. GS7 Isolate Termitidae
139 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
140 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
141 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
142 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
143 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
144 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
145 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
146 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
147 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
148 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
149 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
150 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
151 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
152 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
153 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
154 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
155 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
156 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
157 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
158 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
159 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
160 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
161 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
162 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
163 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
164 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
165 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
166 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
167 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_005862 3300042612 Unclassified 7964
2 Ga0466706_232817 3300042599 Bacteria 3072
3 Ga0466707_290060 3300042601 Bacteria 3067
4 Ga0466707_301351 3300042601 Bacteria 1366
5 Ga0466714_091053 3300042603 Bacteria 33736
6 Ga0466723_367892 3300042618 Bacteria 6757
7 Ga0160432_100170 3300012818 Bacteria 59840
8 Ga0160430_100027 3300012852 Bacteria 204805
9 Ga0160430_100107 3300012852 Bacteria 72484
10 Ga0160430_100999 3300012852 Bacteria 12043
11 Ga0466657_044751 3300042582 Bacteria 1376
12 Ga0466657_216528 3300042582 Bacteria 22067
13 Ga0466693_177220 3300042592 Bacteria 1478
14 Ga0466693_320853 3300042592 Bacteria 7105
15 Ga0466696_114571 3300042596 Bacteria 3471
16 Ga0466730_026005 3300042625 Unclassified 66948
17 Ga0466703_140736 3300042636 Bacteria 1982
18 Ga0466703_200137 3300042636 Bacteria 99141
19 Ga0466703_271211 3300042636 Bacteria 2208
20 Ga0123356_10008941 3300010049 Bacteria 9916
21 Ga0123356_10084121 3300010049 Bacteria 3015
22 Ga0123354_10032039 3300010882 Bacteria 8243
23 Ga0123354_10032163 3300010882 Unclassified 8225
24 Ga0123354_10323729 3300010882 Bacteria 1418
25 Ga0160442_102621 3300012806 Bacteria 1950
26 IMNBL1DRAFT_c0127315 3300000062 Unclassified 665
27 JGI24705J35276_12238733 3300002504 Bacteria 47947
28 JGI24699J35502_11039096 3300002509 Bacteria 1562
29 Ga0123357_10000064 3300009784 Bacteria 85199
30 Ga0466733_054280 3300042659 Bacteria 11634
31 Ga0562378_4135 3300056814 Unclassified 6376
32 Ga0562375_0215 3300056856 Unclassified 160264
33 Ga0562375_1695 3300056856 Bacteria 28151
34 Ga0466701_039436 3300042598 Bacteria 2309
35 Ga0466706_061522 3300042599 Bacteria 89301
36 Ga0466706_157849 3300042599 Bacteria 1192
37 Ga0466707_084824 3300042601 Bacteria 11382
38 Ga0466707_352466 3300042601 Unclassified 22110
39 Ga0466713_106670 3300042602 Bacteria 7555
40 Ga0466705_480700 3300042612 Bacteria 3219
41 Ga0466705_491639 3300042612 Bacteria 1607
42 Ga0466718_019237 3300042617 Bacteria 2179
43 Ga0466723_318753 3300042618 Bacteria 3611
44 Ga0160469_108107 3300012824 Bacteria 974
45 Ga0160434_105361 3300012850 Unclassified 2126
46 Ga0466691_016906 3300042593 Bacteria 3751
47 Ga0466703_310091 3300042636 Bacteria 21772
48 Ga0466704_451521 3300042643 Bacteria 2421
49 Ga0123356_11786317 3300010049 Bacteria 764
50 Ga0123353_10000006 3300010167 Bacteria 279423
51 Ga0123353_10397176 3300010167 Bacteria 2054
52 Ga0123353_10420127 3300010167 Bacteria 1982
53 Ga0123353_10458966 3300010167 Bacteria 1873
54 Ga0123353_11094636 3300010167 Bacteria 1059
55 Ga0123354_10285603 3300010882 Bacteria 1592
56 Ga0123354_10400579 3300010882 Bacteria 1162
57 Ga0466707_253655 3300042601 Bacteria 8450
58 Ga0466713_046305 3300042602 Bacteria 2140
59 Ga0466713_137560 3300042602 Bacteria 64710
60 Ga0466717_233423 3300042604 Bacteria 4627
61 Ga0466719_362579 3300042606 Bacteria 29160
62 Ga0466710_264543 3300042613 Bacteria 2808
63 Ga0466711_212599 3300042615 Unclassified 3528
64 Ga0466711_364129 3300042615 Bacteria 4185
65 Ga0466723_167969 3300042618 Bacteria 59160
66 Ga0466723_352448 3300042618 Bacteria 9857
67 Ga0160431_100918 3300012828 Unclassified 9395
68 Ga0466657_388091 3300042582 Bacteria 1710
69 Ga0466696_443284 3300042596 Bacteria 1941
70 Ga0466729_267774 3300042621 Bacteria 1740
71 Ga0466703_390040 3300042636 Bacteria 11700
72 Ga0123357_10083143 3300009784 Bacteria 4202
73 Ga0123357_10131948 3300009784 Bacteria 3106
74 Ga0123357_10135533 3300009784 Bacteria 3047
75 Ga0123356_11309743 3300010049 Unclassified 887
76 Ga0123353_10447341 3300010167 Bacteria 1903
77 Ga0123354_10454380 3300010882 Bacteria 1035
78 Ga0160464_101258 3300012805 Bacteria 9928
79 JGI24697J35500_11274203 3300002507 Bacteria 6731
80 Ga0123357_10002911 3300009784 Bacteria 19316
81 Ga0530661_000086 3300056564 Bacteria 87401
82 Ga0562377_1273 3300056842 Unclassified 27916
83 Ga0562376_3815 3300056857 Bacteria 14273
84 Ga0466713_008347 3300042602 Bacteria 126123
85 Ga0466712_319172 3300042614 Archaea 1165
86 Ga0466723_294765 3300042618 Bacteria 13548
87 Ga0160440_104226 3300012815 Unclassified 1365
88 Ga0160430_101330 3300012852 Bacteria 9473
89 Ga0160448_130832 3300012854 Bacteria 778
90 Ga0160457_1008491 3300012858 Unclassified 1479
91 Ga0466657_147054 3300042582 Bacteria 1726
92 Ga0466730_098120 3300042625 Bacteria 1446
93 Ga0466725_126666 3300042654 Unclassified 2206
94 Ga0123353_10380910 3300010167 Bacteria 2110
95 JGI24699J35502_11132731 3300002509 Bacteria 7495
96 Ga0466705_027162 3300042612 Bacteria 7767
97 Ga0466733_042532 3300042659 Bacteria 28799
98 Ga0562378_0478 3300056814 Bacteria 67323
99 Ga0562377_3056 3300056842 Unclassified 9932
100 Ga0466713_098330 3300042602 Bacteria 2736
101 Ga0466716_541513 3300042605 Bacteria 2758
102 Ga0466711_007779 3300042615 Bacteria 22172
103 Ga0466693_270909 3300042592 Bacteria 2511
104 Ga0466696_057259 3300042596 Bacteria 1357
105 Ga0466696_357997 3300042596 Bacteria 1869
106 Ga0466704_508228 3300042643 Bacteria 66197
107 Ga0466727_203488 3300042655 Bacteria 1227
108 Ga0123355_10251489 3300009826 Bacteria 2487
109 Ga0123356_10821902 3300010049 Bacteria 1100
110 Ga0123353_10950488 3300010167 Bacteria 1162
111 Ga0123354_10000563 3300010882 Bacteria 38245
112 JGI24702J35022_10000412 3300002462 Bacteria 25593
113 JGI24705J35276_12199079 3300002504 Bacteria 1579
114 Ga0466705_351490 3300042612 Bacteria 2735
115 Ga0466713_121738 3300042602 Bacteria 1452
116 Ga0466705_391293 3300042612 Bacteria 1785
117 Ga0160469_100404 3300012824 Bacteria 22467
118 Ga0160469_105707 3300012824 Bacteria 1286
119 Ga0160460_114051 3300012845 Bacteria 928
120 Ga0160435_1000767 3300012857 Bacteria 9071
121 Ga0466692_071366 3300042591 Bacteria 4505
122 Ga0466694_266518 3300042594 Bacteria 2785
123 Ga0466730_068437 3300042625 Unclassified 2216
124 Ga0466730_096986 3300042625 Bacteria 1437
125 Ga0466724_33525 3300042649 Bacteria 14940
126 Ga0466725_169626 3300042654 Bacteria 7026
127 Ga0123354_10023730 3300010882 Bacteria 9670
128 JGI24705J35276_12226572 3300002504 Bacteria 2875
129 Ga0466705_021968 3300042612 Bacteria 1157
130 Ga0562376_2636 3300056857 Bacteria 20764
131 Ga0466700_234943 3300042600 Bacteria 10370
132 Ga0466722_080885 3300042609 Bacteria 53116
133 Ga0466722_225517 3300042609 Bacteria 2932
134 Ga0466698_060228 3300042610 Bacteria 1573
135 Ga0466715_364312 3300042616 Bacteria 1084
136 Ga0466726_386853 3300042619 Bacteria 1213
137 Ga0160456_115023 3300012820 Bacteria 746
138 Ga0160446_104471 3300012835 Unclassified 2076
139 Ga0160457_1005458 3300012858 Unclassified 1938
140 Ga0466696_386489 3300042596 Bacteria 2952
141 Ga0466734_145307 3300042623 Bacteria 1588
142 Ga0466730_021593 3300042625 Bacteria 2946
143 Ga0466704_073364 3300042643 Bacteria 257471
144 Ga0466704_151212 3300042643 Bacteria 3309
145 Ga0466704_417905 3300042643 Bacteria 3532
146 Ga0466704_483633 3300042643 Bacteria 6633
147 Ga0466727_181776 3300042655 Bacteria 23987
148 Ga0123355_10927553 3300009826 Bacteria 940
149 Ga0123353_10019105 3300010167 Bacteria 10167
150 Ga0123353_10262660 3300010167 Bacteria 2665
151 JGI24699J35502_11112100 3300002509 Bacteria 2746
152 JGI24699J35502_11122120 3300002509 Bacteria 3403
153 Ga0072941_1114836 3300005201 Unclassified 1828
154 Ga0466733_176317 3300042659 Bacteria 141134
155 Ga0562379_0288 3300056790 Bacteria 128595
156 Ga0562375_2150 3300056856 Bacteria 23196
157 Ga0466713_099446 3300042602 Bacteria 12797
158 Ga0466714_019258 3300042603 Bacteria 1905
159 Ga0466722_157850 3300042609 Bacteria 1407
160 Ga0466705_493220 3300042612 Bacteria 4031
161 Ga0466711_221876 3300042615 Bacteria 3578
162 Ga0466715_197587 3300042616 Bacteria 3920
163 Ga0466715_231890 3300042616 Bacteria 35645
164 Ga0160452_100003 3300012834 Bacteria 748778
165 Ga0160436_1000712 3300012861 Bacteria 11248
166 Ga0264413_142802 3300024493 Bacteria 2071
167 Ga0466730_011132 3300042625 Bacteria 16585
168 Ga0466730_016618 3300042625 Bacteria 1429
169 Ga0466708_343721 3300042652 Bacteria 1911
170 Ga0123355_11192373 3300009826 Bacteria 778
171 Ga0123356_10185555 3300010049 Bacteria 2106
172 Ga0123353_10158014 3300010167 Bacteria 3612
173 Ga0123354_10000264 3300010882 Bacteria 47234
174 Ga0123354_10176561 3300010882 Unclassified 2459
175 Ga0123354_10208963 3300010882 Bacteria 2117
176 2227546030 2225789004 Bacteria 2918
177 JGI24699J35502_11134097 3300002509 Bacteria 30240
178 Ga0072941_1099290 3300005201 Bacteria 10260
179 Ga0072941_1564743 3300005201 Bacteria 1615
180 Ga0123357_10001031 3300009784 Bacteria 28573

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_142802 Ga0264413_1428022 175
2 3300056857 Ga0562376_2636 Ga0562376_2636_3059_3664 179
3 3300042612 Ga0466705_005862 Ga0466705_005862_3384_3941 180
4 3300002507 JGI24697J35500_11274203 JGI24697J35500_112742036 181
5 3300042592 Ga0466693_177220 Ga0466693_177220_882_1430 182
6 3300042612 Ga0466705_391293 Ga0466705_391293_821_1372 183
7 3300042615 Ga0466711_212599 Ga0466711_212599_140_733 185
8 3300010167 Ga0123353_10397176 Ga0123353_103971763 186
9 3300042610 Ga0466698_060228 Ga0466698_060228_874_1473 186
10 3300042612 Ga0466705_493220 Ga0466705_493220_2091_2651 186
11 3300010167 Ga0123353_10458966 Ga0123353_104589663 187
12 3300042601 Ga0466707_290060 Ga0466707_290060_1118_1717 187
13 3300042618 Ga0466723_318753 Ga0466723_318753_2789_3358 189
14 3300042621 Ga0466729_267774 Ga0466729_267774_690_1289 189
15 3300042636 Ga0466703_140736 Ga0466703_140736_826_1395 189
16 3300010882 Ga0123354_10176561 Ga0123354_101765613 190
17 iso_pr_bacteria 2820401926 2820402588 190
18 3300042643 Ga0466704_417905 Ga0466704_417905_1952_2551 191
19 3300042655 Ga0466727_203488 Ga0466727_203488_40_639 191
20 3300010882 Ga0123354_10000563 Ga0123354_1000056337 193
21 3300042616 Ga0466715_364312 Ga0466715_364312_152_748 193
22 3300042636 Ga0466703_390040 Ga0466703_390040_9901_10497 193
23 3300042609 Ga0466722_080885 Ga0466722_080885_19307_19894 195
24 iso_pr_bacteria 2648501322 2649448008 195
25 iso_pr_bacteria 2820093073 2820093114 195
26 3300042593 Ga0466691_016906 Ga0466691_016906_1281_1874 197
27 3300042598 Ga0466701_039436 Ga0466701_039436_1414_2007 197
28 3300042601 Ga0466707_301351 Ga0466707_301351_692_1285 197
29 3300042602 Ga0466713_098330 Ga0466713_098330_347_940 197
30 3300042602 Ga0466713_099446 Ga0466713_099446_347_940 197
31 3300042602 Ga0466713_137560 Ga0466713_137560_5801_6394 197
32 3300042603 Ga0466714_091053 Ga0466714_091053_27661_28254 197
33 3300042606 Ga0466719_362579 Ga0466719_362579_21379_21972 197
34 3300042612 Ga0466705_480700 Ga0466705_480700_1169_1762 197
35 3300042615 Ga0466711_364129 Ga0466711_364129_886_1479 197
36 3300042616 Ga0466715_231890 Ga0466715_231890_22315_22908 197
37 3300042618 Ga0466723_167969 Ga0466723_167969_21871_22464 197
38 3300042618 Ga0466723_294765 Ga0466723_294765_11578_12171 197
39 3300042618 Ga0466723_367892 Ga0466723_367892_2322_2915 197
40 3300042619 Ga0466726_386853 Ga0466726_386853_143_736 197
41 3300042649 Ga0466724_33525 Ga0466724_33525_6776_7369 197
42 3300042652 Ga0466708_343721 Ga0466708_343721_703_1296 197
43 iso_pr_bacteria 2816332114 2816396950 197
44 iso_pr_bacteria 2820142992 2820143229 197
45 iso_pr_bacteria 2820528380 2820529637 197
46 iso_pr_bacteria 2847305884 2847306195 197
47 iso_pr_bacteria 2861945162 2861947115 197
48 iso_pr_bacteria 2918394494 2918397271 197
49 3300009826 Ga0123355_10927553 Ga0123355_109275531 198
50 3300012805 Ga0160464_101258 Ga0160464_10125810 198
51 3300012806 Ga0160442_102621 Ga0160442_1026212 198
52 3300012815 Ga0160440_104226 Ga0160440_1042262 198
53 3300012824 Ga0160469_100404 Ga0160469_1004049 198
54 3300012828 Ga0160431_100918 Ga0160431_1009184 198
55 3300012835 Ga0160446_104471 Ga0160446_1044712 198
56 3300012850 Ga0160434_105361 Ga0160434_1053613 198
57 3300012852 Ga0160430_100027 Ga0160430_10002742 198
58 3300012852 Ga0160430_100107 Ga0160430_10010744 198
59 3300012852 Ga0160430_100999 Ga0160430_1009992 198
60 3300012854 Ga0160448_130832 Ga0160448_1308321 198
61 3300012857 Ga0160435_1000767 Ga0160435_10007673 198
62 3300042591 Ga0466692_071366 Ga0466692_071366_1017_1613 198
63 3300042592 Ga0466693_270909 Ga0466693_270909_409_1005 198
64 3300042596 Ga0466696_114571 Ga0466696_114571_2178_2774 198
65 3300042596 Ga0466696_357997 Ga0466696_357997_648_1244 198
66 3300042601 Ga0466707_084824 Ga0466707_084824_6819_7415 198
67 3300042601 Ga0466707_352466 Ga0466707_352466_14359_14955 198
68 3300042602 Ga0466713_106670 Ga0466713_106670_3443_4039 198
69 3300042602 Ga0466713_121738 Ga0466713_121738_512_1108 198
70 3300042609 Ga0466722_157850 Ga0466722_157850_634_1230 198
71 3300042612 Ga0466705_351490 Ga0466705_351490_2080_2676 198
72 3300042612 Ga0466705_491639 Ga0466705_491639_839_1435 198
73 3300042625 Ga0466730_016618 Ga0466730_016618_18_614 198
74 3300042643 Ga0466704_151212 Ga0466704_151212_1230_1841 198
75 iso_pr_bacteria 2524023214 2524488704 198
76 iso_pr_bacteria 2818991320 2819438217 198
77 iso_pr_bacteria 2820398208 2820398390 198
78 iso_pr_bacteria 2820903739 2820904271 198
79 iso_pr_bacteria 2820911766 2820911972 198
80 iso_pr_bacteria 2821312900 2821313718 198
81 iso_pr_bacteria 2837204985 2837206635 198
82 iso_pr_bacteria 2841168549 2841172060 198
83 iso_pr_bacteria 2873614151 2873616772 198
84 iso_pr_bacteria 2873620646 2873621475 198
85 iso_pr_bacteria 2883683260 2883683455 198
86 iso_pr_bacteria 2884613238 2884614059 198
87 iso_pr_bacteria 2894897082 2894898327 198
88 iso_pr_bacteria 2894900265 2894902532 198
89 iso_pr_bacteria 2894926108 2894926610 198
90 iso_pr_bacteria 2894929448 2894932093 198
91 iso_pr_bacteria 2894932631 2894934982 198
92 iso_pr_bacteria 2894935787 2894936528 198
93 iso_pr_bacteria 2894944011 2894946888 198
94 iso_pr_bacteria 2894966443 2894969368 198
95 iso_pr_bacteria 2894974975 2894976781 198
96 iso_pr_bacteria 2894981435 2894984003 198
97 iso_pr_bacteria 2915166107 2915168617 198
98 iso_pr_bacteria 2915168811 2915169080 198
99 iso_pr_bacteria 3002678670 3002680967 198
100 iso_pr_bacteria 8067987626 8067987695 198
101 3300002504 JGI24705J35276_12199079 JGI24705J35276_121990792 199
102 3300009784 Ga0123357_10002911 Ga0123357_100029118 199
103 3300009784 Ga0123357_10131948 Ga0123357_101319482 199
104 3300009784 Ga0123357_10135533 Ga0123357_101355332 199
105 3300010049 Ga0123356_10821902 Ga0123356_108219022 199
106 3300010167 Ga0123353_10158014 Ga0123353_101580143 199
107 3300010882 Ga0123354_10000264 Ga0123354_1000026445 199
108 3300010882 Ga0123354_10400579 Ga0123354_104005791 199
109 3300012845 Ga0160460_114051 Ga0160460_1140511 199
110 3300012852 Ga0160430_101330 Ga0160430_1013306 199
111 3300012858 Ga0160457_1008491 Ga0160457_10084912 199
112 3300012861 Ga0160436_1000712 Ga0160436_10007124 199
113 3300042582 Ga0466657_044751 Ga0466657_044751_46_645 199
114 3300042582 Ga0466657_388091 Ga0466657_388091_54_653 199
115 3300042592 Ga0466693_320853 Ga0466693_320853_87_686 199
116 3300042596 Ga0466696_057259 Ga0466696_057259_75_674 199
117 3300042596 Ga0466696_386489 Ga0466696_386489_811_1410 199
118 3300042596 Ga0466696_443284 Ga0466696_443284_981_1580 199
119 3300042599 Ga0466706_061522 Ga0466706_061522_44220_44819 199
120 3300042599 Ga0466706_157849 Ga0466706_157849_507_1106 199
121 3300042599 Ga0466706_232817 Ga0466706_232817_1531_2130 199
122 3300042601 Ga0466707_253655 Ga0466707_253655_7819_8418 199
123 3300042602 Ga0466713_046305 Ga0466713_046305_95_694 199
124 3300042604 Ga0466717_233423 Ga0466717_233423_253_852 199
125 3300042609 Ga0466722_225517 Ga0466722_225517_1911_2510 199
126 3300042612 Ga0466705_027162 Ga0466705_027162_6811_7410 199
127 3300042613 Ga0466710_264543 Ga0466710_264543_1175_1774 199
128 3300042623 Ga0466734_145307 Ga0466734_145307_799_1398 199
129 3300042625 Ga0466730_011132 Ga0466730_011132_6019_6618 199
130 3300042625 Ga0466730_021593 Ga0466730_021593_143_742 199
131 3300042625 Ga0466730_026005 Ga0466730_026005_5573_6172 199
132 3300042625 Ga0466730_068437 Ga0466730_068437_588_1187 199
133 3300042625 Ga0466730_096986 Ga0466730_096986_199_798 199
134 3300042625 Ga0466730_098120 Ga0466730_098120_128_727 199
135 3300042636 Ga0466703_200137 Ga0466703_200137_87265_87864 199
136 3300042636 Ga0466703_271211 Ga0466703_271211_1387_1986 199
137 3300042636 Ga0466703_310091 Ga0466703_310091_16752_17351 199
138 3300042643 Ga0466704_073364 Ga0466704_073364_141452_142051 199
139 3300042643 Ga0466704_451521 Ga0466704_451521_214_813 199
140 3300042643 Ga0466704_483633 Ga0466704_483633_3152_3751 199
141 3300042654 Ga0466725_126666 Ga0466725_126666_632_1231 199
142 3300042655 Ga0466727_181776 Ga0466727_181776_14071_14670 199
143 3300056856 Ga0562375_2150 Ga0562375_2150_5069_5668 199
144 iso_pr_bacteria 2515154100 2515555669 199
145 iso_pr_bacteria 2515154106 2515604734 199
146 iso_pr_bacteria 2518645556 2518831268 199
147 iso_pr_bacteria 2523533511 2523590884 199
148 iso_pr_bacteria 2529293168 2531453623 199
149 iso_pr_bacteria 2630969010 2634122678 199
150 iso_pr_bacteria 2731957681 2732700533 199
151 iso_pr_bacteria 2820223845 2820224791 199
152 iso_pr_bacteria 2820432912 2820433108 199
153 iso_pr_bacteria 2820488713 2820489836 199
154 iso_pr_bacteria 2820530790 2820531205 199
155 iso_pr_bacteria 2820816657 2820818066 199
156 iso_pr_bacteria 2820834831 2820836255 199
157 iso_pr_bacteria 2820840446 2820841769 199
158 iso_pr_bacteria 2820857933 2820860354 199
159 iso_pr_bacteria 2820897376 2820897798 199
160 iso_pr_bacteria 2820901319 2820903578 199
161 iso_pr_bacteria 2820914081 2820914973 199
162 iso_pr_bacteria 2836973655 2836976077 199
163 iso_pr_bacteria 2848356102 2848359166 199
164 iso_pr_bacteria 2856652821 2856653639 199
165 iso_pr_bacteria 2873196663 2873200817 199
166 iso_pr_bacteria 2883361506 2883361933 199
167 iso_pr_bacteria 2898589227 2898592766 199
168 iso_pr_bacteria 2908241010 2908244924 199
169 iso_pr_bacteria 2912749649 2912757529 199
170 iso_pr_bacteria 3006468911 3006474916 199
171 iso_pr_bacteria 651324002 651580667 199
172 iso_pr_bacteria 8030343600 8030344331 199
173 iso_pr_bacteria 8046957834 8046960182 199
174 iso_pr_bacteria 8053361298 8053361643 199
175 iso_pr_bacteria 8067071256 8067071877 199
176 iso_pr_bacteria 8073544309 8073550727 199
177 iso_pr_bacteria 8077775691 8077780364 199
178 2225789004 2227546030 2228071622 200
179 3300002462 JGI24702J35022_10000412 JGI24702J35022_1000041222 200
180 3300002504 JGI24705J35276_12226572 JGI24705J35276_122265721 200
181 3300002504 JGI24705J35276_12238733 JGI24705J35276_122387336 200
182 3300002509 JGI24699J35502_11039096 JGI24699J35502_110390962 200
183 3300002509 JGI24699J35502_11112100 JGI24699J35502_111121003 200
184 3300002509 JGI24699J35502_11122120 JGI24699J35502_111221202 200
185 3300002509 JGI24699J35502_11132731 JGI24699J35502_111327315 200
186 3300002509 JGI24699J35502_11134097 JGI24699J35502_111340975 200
187 3300005201 Ga0072941_1099290 Ga0072941_10992904 200
188 3300005201 Ga0072941_1564743 Ga0072941_15647432 200
189 3300009784 Ga0123357_10001031 Ga0123357_100010319 200
190 3300009784 Ga0123357_10083143 Ga0123357_100831433 200
191 3300009826 Ga0123355_11192373 Ga0123355_111923731 200
192 3300010049 Ga0123356_10008941 Ga0123356_100089417 200
193 3300010167 Ga0123353_10000006 Ga0123353_10000006200 200
194 3300010167 Ga0123353_10019105 Ga0123353_100191056 200
195 3300010167 Ga0123353_10262660 Ga0123353_102626602 200
196 3300010167 Ga0123353_10380910 Ga0123353_103809102 200
197 3300010167 Ga0123353_10420127 Ga0123353_104201272 200
198 3300010167 Ga0123353_11094636 Ga0123353_110946362 200
199 3300010882 Ga0123354_10023730 Ga0123354_100237303 200
200 3300010882 Ga0123354_10032039 Ga0123354_100320393 200
201 3300010882 Ga0123354_10032163 Ga0123354_100321637 200
202 3300010882 Ga0123354_10208963 Ga0123354_102089632 200
203 3300010882 Ga0123354_10285603 Ga0123354_102856032 200
204 3300010882 Ga0123354_10323729 Ga0123354_103237291 200
205 3300010882 Ga0123354_10454380 Ga0123354_104543801 200
206 3300012818 Ga0160432_100170 Ga0160432_10017016 200
207 3300012820 Ga0160456_115023 Ga0160456_1150231 200
208 3300012824 Ga0160469_105707 Ga0160469_1057072 200
209 3300012834 Ga0160452_100003 Ga0160452_100003623 200
210 3300012858 Ga0160457_1005458 Ga0160457_10054582 200
211 3300042582 Ga0466657_147054 Ga0466657_147054_423_1025 200
212 3300042603 Ga0466714_019258 Ga0466714_019258_1223_1825 200
213 3300042605 Ga0466716_541513 Ga0466716_541513_254_856 200
214 iso_pr_bacteria 2513237174 2514074228 200
215 iso_pr_bacteria 2519899775 2520953542 200
216 iso_pr_bacteria 2568526170 2569119567 200
217 iso_pr_bacteria 2671180601 2673427158 200
218 iso_pr_bacteria 2684622916 2686083419 200
219 iso_pr_bacteria 2684622918 2686086631 200
220 iso_pr_bacteria 2684622919 2686088379 200
221 iso_pr_bacteria 2788500098 2789514747 200
222 iso_pr_bacteria 2820483401 2820485387 200
223 iso_pr_bacteria 2865982043 2865982531 200
224 iso_pr_bacteria 2873589062 2873593161 200
225 iso_pr_bacteria 2915160415 2915162473 200
226 iso_pr_bacteria 8024981139 8024982778 200
227 iso_pr_bacteria 8024984606 8024986203 200
228 iso_pr_bacteria 8110340172 8110340761 200
229 iso_pr_bacteria 8110341875 8110342854 200
230 3300000062 IMNBL1DRAFT_c0127315 IMNBL1DRAFT_01273151 201
231 3300009826 Ga0123355_10251489 Ga0123355_102514894 201
232 3300010049 Ga0123356_10185555 Ga0123356_101855552 201
233 3300010049 Ga0123356_11786317 Ga0123356_117863171 201
234 3300010167 Ga0123353_10950488 Ga0123353_109504882 201
235 3300012824 Ga0160469_108107 Ga0160469_1081071 201
236 3300042582 Ga0466657_216528 Ga0466657_216528_10851_11456 201
237 3300042612 Ga0466705_021968 Ga0466705_021968_217_822 201
238 3300042615 Ga0466711_007779 Ga0466711_007779_11369_11974 201
239 3300042615 Ga0466711_221876 Ga0466711_221876_2196_2801 201
240 3300042643 Ga0466704_508228 Ga0466704_508228_25374_25979 201
241 3300042659 Ga0466733_176317 Ga0466733_176317_57388_57993 201
242 3300056564 Ga0530661_000086 Ga0530661_000086_64638_65243 201
243 3300056790 Ga0562379_0288 Ga0562379_0288_85808_86413 201
244 3300056814 Ga0562378_0478 Ga0562378_0478_44918_45523 201
245 3300056814 Ga0562378_4135 Ga0562378_4135_5542_6147 201
246 3300056842 Ga0562377_1273 Ga0562377_1273_9024_9629 201
247 3300056842 Ga0562377_3056 Ga0562377_3056_4345_4950 201
248 3300056856 Ga0562375_0215 Ga0562375_0215_92692_93297 201
249 3300056856 Ga0562375_1695 Ga0562375_1695_14634_15239 201
250 3300056857 Ga0562376_3815 Ga0562376_3815_6599_7204 201
251 iso_pr_bacteria 2879643867 2879644992 201
252 iso_pr_bacteria 8012935351 8012938962 201
253 iso_pr_bacteria 8024986378 8024988038 201
254 3300009784 Ga0123357_10000064 Ga0123357_1000006440 202
255 3300042659 Ga0466733_042532 Ga0466733_042532_13708_14316 202
256 iso_pr_bacteria 2864899338 2864903257 202
257 iso_pr_bacteria 2931430189 2931432661 202
258 3300042602 Ga0466713_008347 Ga0466713_008347_102337_102948 203
259 3300005201 Ga0072941_1114836 Ga0072941_11148362 204
260 3300042614 Ga0466712_319172 Ga0466712_319172_251_865 204
261 3300042617 Ga0466718_019237 Ga0466718_019237_555_1169 204
262 3300042654 Ga0466725_169626 Ga0466725_169626_727_1341 204
263 iso_pr_bacteria 2820371985 2820372552 204
264 3300010049 Ga0123356_11309743 Ga0123356_113097431 205
265 3300042594 Ga0466694_266518 Ga0466694_266518_1484_2101 205
266 3300042616 Ga0466715_197587 Ga0466715_197587_3014_3631 205
267 iso_pr_bacteria 2820347164 2820347362 205
268 iso_pr_bacteria 2820820509 2820821798 205
269 3300010049 Ga0123356_10084121 Ga0123356_100841212 206
270 3300042618 Ga0466723_352448 Ga0466723_352448_3050_3676 208
271 3300042600 Ga0466700_234943 Ga0466700_234943_329_958 209
272 3300010167 Ga0123353_10447341 Ga0123353_104473411 215
273 iso_pr_bacteria 646564587 646806814 215
274 iso_pr_bacteria 2864773010 2864774509 217
275 iso_pr_bacteria 2864918810 2864919542 217
276 iso_pr_bacteria 2864964650 2864967234 217
277 3300042659 Ga0466733_054280 Ga0466733_054280_2952_3611 219

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21175 RecR_C RecR, C-terminal 173 196 0.99
PF02132 RecR_ZnF RecR, Cys4-zinc finger motif 54 74 0.98
PF13662 Toprim_4 Toprim domain 81 171 0.97
PF21176 RecR_HhH RecR, helix-hairpin-helix 7 50 0.97
PF01751 Toprim Toprim domain 81 169 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.