Protein Family IF10282
Metagenome
Isolate
475
Members
381
Samples
193
Scaffolds
204.77
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_034038|Ga0466733_034038_2137_2853
- Length
- 238 aa
- Sequence
- VHASPIFVFRYKKTTFEALIFRKNAAKDALKVCLNPYIKKMDLDFNKAGGLIPAVIQDAATGKVLMVGFMNEEAYNRTVSEKLVTFYSRTRQRLWTKGEESGNCLDVVDMLVDCDNDTLLVKVHPRGPVCHTGNDTCFCESNKPDGMSFLEYLQGYISRRRKEMPQGSYTTRLFEAGINKIAQKVGEEAVELVIEAKDQNDDLFLNEAADLMYHFIVLLTARGYSLADVAGVLSARHR
Sample Types
Isolate
59.4%
Metagenome
40.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
29.8%
Unclassified
9.1%
Drosophilidae
6.2%
Termitidae
5.6%
Elmidae
3.8%
Kalotermitidae
3.8%
Cryptocercidae
3.2%
Muscidae
3.2%
Formicidae
2.9%
Tenebrionidae
2.7%
Culicidae
2.7%
Blaberidae
2.4%
Calliphoridae
2.1%
Curculionidae
2.1%
Anthocoridae
1.9%
Blattellidae
1.9%
Armadillidiidae
1.6%
Pseudophyllodromiidae
1.3%
Cerambycidae
1.1%
Rhinotermitidae
0.8%
Blattidae
0.8%
Passalidae
0.8%
Corydiidae
0.8%
Anaplectidae
0.5%
Aphididae
0.5%
Tephritidae
0.5%
Pentatomidae
0.5%
Ectobiidae
0.5%
Nyctiboridae
0.5%
Termopsidae
0.5%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Pteromalidae
0.3%
Tryonicidae
0.3%
Plutellidae
0.3%
Crambidae
0.3%
Rhopalidae
0.3%
Carabidae
0.3%
Daphniidae
0.3%
Hydrophilidae
0.3%
Hodotermitidae
0.3%
Diaspididae
0.3%
Cixiidae
0.3%
Nephropidae
0.3%
Sarcophagidae
0.3%
Lamproblattidae
0.3%
Stratiomyidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Monophlebidae
0.3%
Cicadellidae
0.3%
Taxonomy
Archaea
0
Bacteria
455
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 2 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 3 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 4 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 5 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 6 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 7 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 8 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 9 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 10 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 11 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 12 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 13 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 14 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 15 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 16 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 17 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 18 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 19 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 20 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 21 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 22 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 23 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 24 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 25 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 26 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 27 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 28 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 29 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 30 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 31 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 32 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 42 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 43 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 44 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 45 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 46 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 47 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 48 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 49 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 50 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 51 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 52 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 53 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 54 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 55 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 56 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 57 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 58 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 59 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 60 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 61 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 62 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 63 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 64 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 65 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 66 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 67 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 68 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 69 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 70 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 71 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 72 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 73 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 74 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 75 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 76 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 77 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 78 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 79 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 80 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 81 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 82 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 83 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 84 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 85 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 86 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 87 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 88 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 89 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 90 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 91 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 92 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 93 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 94 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 95 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 96 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 97 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 98 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 99 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 100 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 101 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 102 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 103 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 104 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 105 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 106 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 107 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 108 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 109 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 110 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 111 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 112 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 113 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 114 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 115 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 116 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 117 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 118 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 119 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 120 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 121 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 122 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 123 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 124 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 125 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 126 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 127 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 128 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 129 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 130 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 131 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 132 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 133 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 134 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 135 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 136 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 137 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 138 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 139 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 140 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 141 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 142 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 143 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 144 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 145 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 146 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 147 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 148 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 149 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 150 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 151 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 152 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 153 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 154 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 155 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 156 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 157 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 158 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 159 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 160 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 161 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 162 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 163 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 164 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 165 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 166 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 167 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 168 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 169 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 170 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 171 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 172 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 173 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 174 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 175 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 176 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 177 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 178 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 179 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 180 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 181 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 182 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 183 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 184 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 185 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 186 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 187 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 188 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 189 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 190 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 191 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 192 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 193 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 194 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 195 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 196 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 197 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 198 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 199 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 200 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 201 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 202 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 203 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 204 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 205 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 206 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 207 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 208 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 209 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 210 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 211 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 212 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 213 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 214 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 215 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 216 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 217 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 218 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 219 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 220 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 221 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 222 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 223 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 224 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 225 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 226 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 227 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 228 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 229 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 230 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 231 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 232 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 233 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 234 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 235 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 236 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 237 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 238 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 239 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 240 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 241 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 242 | 2540341063 | Candidatus Uzinura diaspidicola ASNER | Isolate | Diaspididae |
| 243 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 244 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 245 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 246 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 247 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 248 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 249 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 250 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 251 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 252 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 253 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 254 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 255 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 256 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 257 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 258 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 259 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 260 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 261 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 262 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 263 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 264 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 265 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 266 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 267 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 268 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 269 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 270 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 271 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 272 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 273 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 274 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 275 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 276 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 277 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 278 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 279 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 280 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 281 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 282 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 283 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 284 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 285 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 286 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 287 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 288 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 289 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 290 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 291 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 292 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 293 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 294 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 295 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 296 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 297 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 298 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 299 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 300 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 301 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 302 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 303 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 304 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 305 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 306 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 307 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 308 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 309 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 310 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 311 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 312 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 313 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 314 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 315 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 316 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 317 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 318 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 319 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 320 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 321 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 322 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 323 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 324 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 325 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 326 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 327 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 328 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 329 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 330 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 331 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 332 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 333 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 334 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 335 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 336 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 337 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 338 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 339 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 340 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 341 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 342 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 343 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 344 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 345 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 346 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 347 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 348 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 349 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 350 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 351 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 352 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 353 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 354 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 355 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 356 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 357 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 358 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 359 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 360 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 361 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 362 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 363 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 364 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 365 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 366 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 367 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 368 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 369 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 370 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 371 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 372 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 373 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 374 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 375 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 376 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 377 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 378 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 379 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 380 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 381 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24705J35276_12231904 | 3300002504 | Bacteria | 4107 |
| 2 | Ga0074188_1039469 | 3300005318 | Bacteria | 24939 |
| 3 | Ga0074278_107917 | 3300005721 | Unclassified | 5497 |
| 4 | Ga0102738_1000791 | 3300007141 | Bacteria | 5031 |
| 5 | Ga0104048_1027590 | 3300007143 | Unclassified | 4209 |
| 6 | Ga0123354_10018861 | 3300010882 | Bacteria | 10830 |
| 7 | Ga0466730_019645 | 3300042625 | Bacteria | 30027 |
| 8 | Ga0466708_232266 | 3300042652 | Bacteria | 65416 |
| 9 | Ga0466716_362136 | 3300042605 | Bacteria | 18292 |
| 10 | Ga0466710_258134 | 3300042613 | Bacteria | 1535 |
| 11 | Ga0466728_404258 | 3300042620 | Bacteria | 22281 |
| 12 | Ga0160433_100145 | 3300012846 | Bacteria | 61189 |
| 13 | Ga0160447_107499 | 3300012849 | Bacteria | 2721 |
| 14 | Ga0265387_1000944 | 3300024582 | Bacteria | 4364 |
| 15 | Ga0466690_423095 | 3300042590 | Bacteria | 7332 |
| 16 | Ga0466692_123848 | 3300042591 | Bacteria | 2015 |
| 17 | Ga0466705_214965 | 3300042612 | Bacteria | 2717 |
| 18 | FGTW_contig10009 | 2065487013 | Bacteria | 601 |
| 19 | 2227080783 | 2225789004 | Bacteria | 156181 |
| 20 | HBC_ctgsDRAFT_1002741 | 3300000333 | Bacteria | 4001 |
| 21 | HBC_ctgsDRAFT_1022940 | 3300000333 | Unclassified | 1527 |
| 22 | SCG598I20_12281 | 3300000473 | Bacteria | 7098 |
| 23 | JGI24696J40584_12888102 | 3300002834 | Bacteria | 1116 |
| 24 | CVPL010W_10006743 | 3300002931 | Bacteria | 11617 |
| 25 | Ga0074302_1145575 | 3300005316 | Bacteria | 911 |
| 26 | Ga0074278_110334 | 3300005721 | Bacteria | 8168 |
| 27 | Ga0104041_1000095 | 3300007106 | Bacteria | 6936 |
| 28 | Ga0102737_1000077 | 3300007142 | Bacteria | 29542 |
| 29 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 30 | Ga0123356_12062662 | 3300010049 | Bacteria | 712 |
| 31 | Ga0123353_10357828 | 3300010167 | Bacteria | 2195 |
| 32 | Ga0123353_10390520 | 3300010167 | Bacteria | 2076 |
| 33 | Ga0123354_10239513 | 3300010882 | Bacteria | 1871 |
| 34 | Ga0160464_110376 | 3300012805 | Bacteria | 813 |
| 35 | Ga0466734_005175 | 3300042623 | Bacteria | 5673 |
| 36 | Ga0466730_003892 | 3300042625 | Bacteria | 17313 |
| 37 | Ga0466730_056834 | 3300042625 | Bacteria | 3292 |
| 38 | Ga0466704_184245 | 3300042643 | Bacteria | 23739 |
| 39 | Ga0466727_281359 | 3300042655 | Bacteria | 6306 |
| 40 | Ga0466701_101720 | 3300042598 | Bacteria | 12600 |
| 41 | Ga0466710_432255 | 3300042613 | Bacteria | 1081 |
| 42 | Ga0160433_102290 | 3300012846 | Unclassified | 4235 |
| 43 | Ga0160434_101318 | 3300012850 | Bacteria | 4744 |
| 44 | Ga0160435_1000148 | 3300012857 | Bacteria | 39041 |
| 45 | Ga0265387_1022710 | 3300024582 | Bacteria | 955 |
| 46 | Ga0466705_064830 | 3300042612 | Bacteria | 19081 |
| 47 | Ga0063521_1001040 | 3300003973 | Bacteria | 8688 |
| 48 | Ga0072940_1015189 | 3300005200 | Bacteria | 1381 |
| 49 | Ga0074278_126442 | 3300005721 | Unclassified | 2198 |
| 50 | Ga0074278_136412 | 3300005721 | Bacteria | 29960 |
| 51 | Ga0104147_1062926 | 3300007224 | Bacteria | 3217 |
| 52 | Ga0123354_10002448 | 3300010882 | Bacteria | 24525 |
| 53 | Ga0123354_10243478 | 3300010882 | Bacteria | 1843 |
| 54 | Ga0466730_054740 | 3300042625 | Bacteria | 4734 |
| 55 | Ga0466703_391454 | 3300042636 | Bacteria | 1024 |
| 56 | Ga0466704_219675 | 3300042643 | Bacteria | 2378 |
| 57 | Ga0466724_01361 | 3300042649 | Bacteria | 1457 |
| 58 | Ga0466725_292025 | 3300042654 | Bacteria | 1047 |
| 59 | Ga0466706_028701 | 3300042599 | Bacteria | 11480 |
| 60 | Ga0466707_351670 | 3300042601 | Bacteria | 5950 |
| 61 | Ga0466713_042000 | 3300042602 | Bacteria | 23357 |
| 62 | Ga0466714_093645 | 3300042603 | Bacteria | 1873 |
| 63 | Ga0466715_342506 | 3300042616 | Bacteria | 110263 |
| 64 | Ga0466715_447718 | 3300042616 | Bacteria | 22881 |
| 65 | Ga0160468_100011 | 3300012819 | Bacteria | 463900 |
| 66 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 67 | Ga0160436_1003917 | 3300012861 | Bacteria | 3600 |
| 68 | Ga0247290_00036 | 3300035364 | Bacteria | 50973 |
| 69 | Ga0466657_076293 | 3300042582 | Unclassified | 7648 |
| 70 | Ga0466692_046888 | 3300042591 | Bacteria | 170448 |
| 71 | Ga0466691_014342 | 3300042593 | Bacteria | 12884 |
| 72 | IMNBL1DRAFT_c0032338 | 3300000062 | Bacteria | 1888 |
| 73 | HBC_ctgsDRAFT_1000007 | 3300000333 | Bacteria | 60444 |
| 74 | HBC_ctgsDRAFT_1022088 | 3300000333 | Bacteria | 1557 |
| 75 | SCG598B02_11602 | 3300000472 | Bacteria | 63387 |
| 76 | Meta3P_1000055 | 3300002464 | Bacteria | 91103 |
| 77 | JGI24705J35276_12154117 | 3300002504 | Bacteria | 1198 |
| 78 | Ga0068305_10012318 | 3300005083 | Bacteria | 25377 |
| 79 | Ga0103265_1000025 | 3300007068 | Bacteria | 22786 |
| 80 | Ga0102739_1000009 | 3300007095 | Bacteria | 70252 |
| 81 | Ga0102740_1000009 | 3300007140 | Bacteria | 106515 |
| 82 | Ga0104019_1034106 | 3300007150 | Bacteria | 2253 |
| 83 | Ga0105553_1099705 | 3300007767 | Bacteria | 4707 |
| 84 | Ga0127649_100174 | 3300009460 | Bacteria | 78472 |
| 85 | Ga0123357_10006387 | 3300009784 | Bacteria | 14365 |
| 86 | Ga0123354_10334186 | 3300010882 | Bacteria | 1376 |
| 87 | Ga0466724_68702 | 3300042649 | Bacteria | 40617 |
| 88 | Ga0466722_031905 | 3300042609 | Bacteria | 36244 |
| 89 | Ga0466697_015099 | 3300042611 | Bacteria | 1614 |
| 90 | Ga0160436_1000290 | 3300012861 | Bacteria | 22624 |
| 91 | Ga0160436_1032950 | 3300012861 | Bacteria | 870 |
| 92 | Ga0247290_00061 | 3300035364 | Bacteria | 37802 |
| 93 | Ga0466696_345134 | 3300042596 | Bacteria | 6245 |
| 94 | DPO_contig06681 | 2032320009 | Unclassified | 1185 |
| 95 | DPOL_contig07314 | 2035918003 | Bacteria | 15303 |
| 96 | gam1t_NODE_50498_length=29940_GC=34_1_Contigs=3 | 2189573031 | Unclassified | 29960 |
| 97 | IMNBGM34_c011461 | 3300000036 | Bacteria | 1113 |
| 98 | SCG598L16_135224 | 3300000490 | Unclassified | 7308 |
| 99 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 100 | Ga0063521_1001219 | 3300003973 | Bacteria | 7548 |
| 101 | Ga0105005_1275488 | 3300007505 | Bacteria | 3975 |
| 102 | Ga0105553_1035383 | 3300007767 | Bacteria | 16607 |
| 103 | Ga0466733_001969 | 3300042659 | Bacteria | 2015 |
| 104 | Ga0562378_0627 | 3300056814 | Unclassified | 53926 |
| 105 | Ga0123356_10102670 | 3300010049 | Bacteria | 2745 |
| 106 | Ga0123354_10006484 | 3300010882 | Bacteria | 17397 |
| 107 | Ga0466729_227432 | 3300042621 | Bacteria | 1834 |
| 108 | Ga0466734_009507 | 3300042623 | Bacteria | 6739 |
| 109 | Ga0466703_319363 | 3300042636 | Bacteria | 11975 |
| 110 | Ga0466724_44946 | 3300042649 | Unclassified | 3873 |
| 111 | Ga0466708_287520 | 3300042652 | Bacteria | 10221 |
| 112 | Ga0466701_082345 | 3300042598 | Bacteria | 2604 |
| 113 | Ga0466707_161333 | 3300042601 | Bacteria | 18619 |
| 114 | Ga0466717_172699 | 3300042604 | Bacteria | 1529 |
| 115 | Ga0466698_094308 | 3300042610 | Bacteria | 1015 |
| 116 | Ga0466710_303226 | 3300042613 | Bacteria | 3539 |
| 117 | Ga0466711_385178 | 3300042615 | Bacteria | 1858 |
| 118 | Ga0160456_100002 | 3300012820 | Bacteria | 798475 |
| 119 | Ga0160467_100096 | 3300012829 | Bacteria | 128198 |
| 120 | Ga0160435_1000158 | 3300012857 | Bacteria | 36168 |
| 121 | Ga0265387_1000026 | 3300024582 | Bacteria | 60790 |
| 122 | Ga0466657_317337 | 3300042582 | Bacteria | 2948 |
| 123 | SCG598L16_135897 | 3300000490 | Unclassified | 24327 |
| 124 | Ga0102736_1000072 | 3300007052 | Bacteria | 25803 |
| 125 | Ga0103260_1000876 | 3300007139 | Bacteria | 5621 |
| 126 | Ga0102738_1000012 | 3300007141 | Bacteria | 104606 |
| 127 | Ga0530661_001025 | 3300056564 | Bacteria | 16273 |
| 128 | Ga0123353_10490651 | 3300010167 | Bacteria | 1793 |
| 129 | Ga0123353_10749056 | 3300010167 | Unclassified | 1360 |
| 130 | Ga0466729_250006 | 3300042621 | Unclassified | 1431 |
| 131 | Ga0466731_401299 | 3300042622 | Bacteria | 1602 |
| 132 | Ga0466703_064825 | 3300042636 | Bacteria | 42026 |
| 133 | Ga0466713_139066 | 3300042602 | Bacteria | 109882 |
| 134 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 135 | Ga0466719_563471 | 3300042606 | Bacteria | 4069 |
| 136 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 137 | Ga0466715_164917 | 3300042616 | Bacteria | 3965 |
| 138 | Ga0466726_115048 | 3300042619 | Bacteria | 2953 |
| 139 | Ga0466726_130309 | 3300042619 | Bacteria | 3987 |
| 140 | Ga0160456_105805 | 3300012820 | Bacteria | 1473 |
| 141 | Ga0160434_100075 | 3300012850 | Bacteria | 69288 |
| 142 | Ga0466696_157605 | 3300042596 | Bacteria | 5532 |
| 143 | Ga0466697_242923 | 3300042611 | Bacteria | 6322 |
| 144 | Ga0466705_183613 | 3300042612 | Bacteria | 88189 |
| 145 | DPOL_contig05640 | 2035918003 | Bacteria | 29209 |
| 146 | gam1t_NODE_566721_length=9032_GC=38_7_Contigs=3 | 2189573031 | Unclassified | 9052 |
| 147 | gam1t_NODE_673954_length=5497_GC=37_5_Contigs=1 | 2189573031 | Bacteria | 5497 |
| 148 | JGI24702J35022_10399142 | 3300002462 | Bacteria | 830 |
| 149 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 150 | Ga0074278_112127 | 3300005721 | Unclassified | 1420 |
| 151 | Ga0103261_1000052 | 3300007083 | Bacteria | 33831 |
| 152 | Ga0466733_034038 | 3300042659 | Bacteria | 9678 |
| 153 | Ga0562374_0373 | 3300057007 | Bacteria | 82846 |
| 154 | Ga0123356_11444629 | 3300010049 | Bacteria | 847 |
| 155 | Ga0123353_10201503 | 3300010167 | Bacteria | 3130 |
| 156 | Ga0123354_10614112 | 3300010882 | Bacteria | 791 |
| 157 | Ga0466724_32728 | 3300042649 | Unclassified | 12194 |
| 158 | Ga0466724_67353 | 3300042649 | Bacteria | 40151 |
| 159 | Ga0466708_406465 | 3300042652 | Bacteria | 25330 |
| 160 | Ga0466727_004029 | 3300042655 | Bacteria | 1076 |
| 161 | Ga0466713_098270 | 3300042602 | Bacteria | 331235 |
| 162 | Ga0466713_151116 | 3300042602 | Bacteria | 31590 |
| 163 | Ga0466716_506121 | 3300042605 | Bacteria | 9655 |
| 164 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 165 | Ga0466726_373213 | 3300042619 | Bacteria | 4716 |
| 166 | Ga0160448_100789 | 3300012854 | Bacteria | 10685 |
| 167 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 168 | Ga0466692_146472 | 3300042591 | Bacteria | 2843 |
| 169 | Ga0466705_040378 | 3300042612 | Bacteria | 10928 |
| 170 | Ga0466705_178756 | 3300042612 | Bacteria | 34494 |
| 171 | gam1t_NODE_639127_length=8118_GC=37_9_Contigs=6 | 2189573031 | Unclassified | 8168 |
| 172 | Ga0102734_1000060 | 3300007129 | Bacteria | 35008 |
| 173 | Ga0103268_1001587 | 3300007192 | Bacteria | 5534 |
| 174 | Ga0466733_038690 | 3300042659 | Bacteria | 100300 |
| 175 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 176 | Ga0123357_10280881 | 3300009784 | Bacteria | 1720 |
| 177 | Ga0123356_10207278 | 3300010049 | Bacteria | 2005 |
| 178 | Ga0123353_10283500 | 3300010167 | Bacteria | 2542 |
| 179 | Ga0466730_028851 | 3300042625 | Bacteria | 1520 |
| 180 | Ga0466730_053240 | 3300042625 | Bacteria | 6323 |
| 181 | Ga0466704_544430 | 3300042643 | Bacteria | 4950 |
| 182 | Ga0466709_292613 | 3300042648 | Bacteria | 22017 |
| 183 | Ga0466724_16064 | 3300042649 | Bacteria | 12192 |
| 184 | Ga0466724_57373 | 3300042649 | Unclassified | 1333 |
| 185 | Ga0466708_335661 | 3300042652 | Bacteria | 2654 |
| 186 | Ga0466701_100213 | 3300042598 | Bacteria | 245657 |
| 187 | Ga0466707_167017 | 3300042601 | Unclassified | 2986 |
| 188 | Ga0466715_275501 | 3300042616 | Bacteria | 10441 |
| 189 | Ga0466723_097479 | 3300042618 | Bacteria | 24080 |
| 190 | Ga0160459_100002 | 3300012831 | Bacteria | 753687 |
| 191 | Ga0160455_102062 | 3300012837 | Bacteria | 4675 |
| 192 | Ga0160460_100302 | 3300012845 | Bacteria | 36626 |
| 193 | Ga0160433_106084 | 3300012846 | Bacteria | 1735 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.