Protein Family IF10277

Metagenome Isolate
131 Members
69 Samples
115 Scaffolds
280.32 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_025888|Ga0466733_025888_15782_16705
Length
307 aa
Sequence
MPEVCRNHVELKGLTRIISVKTALSVMEKENWTTVIKPKTGLLEVGFKELIDYKDLCVMFVKRDIVTLYKQTILGPLWFIINPILTTAMYMVVFGGIAGISTDGLPQPLFYLAGICLWNYFSTCLTKTSTTFVTNQAIFGKVYFPRLVMPLSISISSLVTLGIQFLLFVAVYAYYIMQGVSIAPNIYILLVPVLIAMLAGLSLGFGIITSSLTTKYRDLSILFTFAVQLWMYATPIIYPLGTMPPKTQWVMALNPVTSIIETFKYATLGQGVFSWAQLGYSFAFTCAVLGIGIVIFNRVQRSFMDTV

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.4%
Kalotermitidae 19.4%
Unclassified 11.9%
Blattidae 7.5%
Formicidae 6.0%
Elmidae 4.5%
Passalidae 4.5%
Termopsidae 4.5%
Drosophilidae 3.0%
Culicidae 3.0%
Rhinotermitidae 3.0%
Armadillidiidae 1.5%
Hydrophilidae 1.5%
Daphniidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
2 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
3 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
4 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
7 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
8 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 2920168565 Paludibacter sp. 221 Isolate Blattidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
17 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
21 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
22 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
26 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
27 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
28 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
49 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
53 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
54 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
57 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
58 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
59 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
60 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
61 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
62 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
63 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
64 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
65 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
68 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
69 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_286969 3300042636 Bacteria 2153
2 Ga0466703_298915 3300042636 Bacteria 1885
3 Ga0466704_417045 3300042643 Bacteria 12166
4 Ga0466708_115899 3300042652 Bacteria 5291
5 Ga0466707_039903 3300042601 Bacteria 24387
6 Ga0466707_348521 3300042601 Bacteria 1328
7 Ga0466714_068450 3300042603 Bacteria 45601
8 Ga0466690_255712 3300042590 Bacteria 5068
9 Ga0466692_034223 3300042591 Bacteria 54843
10 Ga0466711_039051 3300042615 Bacteria 2205
11 Ga0466715_135674 3300042616 Bacteria 34654
12 Ga0466723_203856 3300042618 Bacteria 2111
13 Ga0466726_354312 3300042619 Bacteria 12493
14 2227491886 2225789004 Bacteria 4058
15 IMNBGM34_c004555 3300000036 Bacteria 1872
16 JGI24695J34938_10000900 3300002450 Bacteria 27462
17 Ga0466729_311623 3300042621 Bacteria 3457
18 Ga0466735_091533 3300042624 Bacteria 22096
19 Ga0466701_017684 3300042598 Bacteria 2820
20 Ga0466707_359800 3300042601 Bacteria 1790
21 Ga0123354_10013939 3300010882 Bacteria 12502
22 Ga0123354_10163887 3300010882 Bacteria 2623
23 Ga0160446_100122 3300012835 Bacteria 69003
24 Ga0466690_259901 3300042590 Bacteria 5140
25 Ga0466711_250155 3300042615 Bacteria 8285
26 IMNBL1DRAFT_c0000261 3300000062 Bacteria 46561
27 Ga0103264_1000104 3300007188 Bacteria 49090
28 Ga0466733_025888 3300042659 Bacteria 28930
29 Ga0466733_040584 3300042659 Bacteria 5524
30 Ga0466733_221827 3300042659 Bacteria 7647
31 Ga0466731_056111 3300042622 Bacteria 1129
32 Ga0466735_119871 3300042624 Unclassified 1774
33 Ga0466730_071786 3300042625 Bacteria 741189
34 Ga0466703_192467 3300042636 Bacteria 4197
35 Ga0466704_081521 3300042643 Bacteria 7559
36 Ga0466707_032562 3300042601 Bacteria 2512
37 Ga0466707_159375 3300042601 Bacteria 13999
38 Ga0466713_043123 3300042602 Bacteria 81226
39 Ga0466716_127599 3300042605 Bacteria 5815
40 Ga0466719_193024 3300042606 Bacteria 1108
41 Ga0160444_100090 3300012841 Bacteria 116868
42 Ga0466694_256167 3300042594 Unclassified 25111
43 Ga0466705_433289 3300042612 Bacteria 1566
44 AustNasuHG_c1001857 3300000089 Bacteria 7638
45 JGI24705J35276_12238610 3300002504 Bacteria 29496
46 Ga0068305_10729399 3300005083 Bacteria 2331
47 Ga0102736_1000151 3300007052 Bacteria 41405
48 Ga0466733_044535 3300042659 Bacteria 127501
49 Ga0466735_088782 3300042624 Bacteria 1456
50 Ga0466724_37932 3300042649 Bacteria 325221
51 Ga0466708_184325 3300042652 Bacteria 14364
52 Ga0466727_188985 3300042655 Unclassified 3338
53 Ga0466701_022354 3300042598 Bacteria 90611
54 Ga0466707_089123 3300042601 Bacteria 18294
55 Ga0123353_10701629 3300010167 Bacteria 1420
56 Ga0160472_100233 3300012839 Bacteria 66227
57 Ga0160472_100566 3300012839 Bacteria 21941
58 Ga0466690_193388 3300042590 Bacteria 1086
59 Ga0466696_284154 3300042596 Bacteria 2334
60 Ga0466728_380615 3300042620 Bacteria 1268
61 Ga0104050_1001326 3300007153 Bacteria 4248
62 Ga0103267_1000818 3300007190 Bacteria 8110
63 Ga0466731_414863 3300042622 Bacteria 1367
64 Ga0466704_041737 3300042643 Bacteria 9602
65 Ga0466709_417477 3300042648 Bacteria 4199
66 Ga0466707_296253 3300042601 Bacteria 25031
67 Ga0466716_159224 3300042605 Bacteria 6131
68 Ga0466719_253408 3300042606 Bacteria 2643
69 Ga0123356_10004830 3300010049 Bacteria 13868
70 Ga0123354_10006259 3300010882 Bacteria 17634
71 Ga0123354_10085257 3300010882 Bacteria 4427
72 Ga0466694_170886 3300042594 Bacteria 2171
73 Ga0466726_294202 3300042619 Bacteria 1932
74 2227419997 2225789004 Bacteria 1049
75 2227638502 2225789004 Bacteria 11121
76 IMNBL1DRAFT_c0000469 3300000062 Bacteria 33711
77 Ga0123357_10000423 3300009784 Bacteria 40429
78 Ga0466705_169650 3300042612 Unclassified 10255
79 Ga0466709_130933 3300042648 Bacteria 4326
80 Ga0466701_086124 3300042598 Bacteria 60334
81 Ga0123353_10111010 3300010167 Bacteria 4417
82 Ga0123353_10551567 3300010167 Bacteria 1662
83 Ga0123353_11074420 3300010167 Bacteria 1072
84 Ga0123354_10112882 3300010882 Unclassified 3574
85 Ga0466692_074053 3300042591 Bacteria 15653
86 Ga0466712_053332 3300042614 Unclassified 3848
87 2227358575 2225789004 Bacteria 27923
88 Ga0466735_059303 3300042624 Bacteria 1726
89 Ga0466704_063898 3300042643 Bacteria 1424
90 Ga0466727_323834 3300042655 Unclassified 1491
91 Ga0466707_174317 3300042601 Bacteria 5323
92 Ga0123357_10133021 3300009784 Bacteria 3087
93 Ga0123357_10184619 3300009784 Unclassified 2424
94 Ga0123353_10001066 3300010167 Unclassified 33504
95 Ga0466711_299966 3300042615 Bacteria 14644
96 IMNBGM34_c000232 3300000036 Bacteria 16190
97 JGI24699J35502_11134167 3300002509 Bacteria 43250
98 Ga0123357_10001166 3300009784 Bacteria 27443
99 Ga0466734_071349 3300042623 Bacteria 3716
100 Ga0466700_131815 3300042600 Bacteria 50718
101 Ga0123353_10443040 3300010167 Bacteria 1915
102 Ga0123353_10448870 3300010167 Bacteria 1899
103 Ga0123354_10004397 3300010882 Bacteria 19955
104 Ga0466657_234309 3300042582 Bacteria 2261
105 Ga0466690_300520 3300042590 Bacteria 6112
106 Ga0466696_425887 3300042596 Unclassified 1650
107 Ga0466715_030834 3300042616 Bacteria 5286
108 Ga0466715_139815 3300042616 Bacteria 3274
109 Ga0466715_249034 3300042616 Bacteria 10571
110 Ga0466728_355816 3300042620 Unclassified 1552
111 2227523538 2225789004 Bacteria 3289
112 JGI24705J35276_12222202 3300002504 Bacteria 2401
113 Ga0072941_1733763 3300005201 Bacteria 1490
114 Ga0103265_1000005 3300007068 Bacteria 101135
115 Ga0104045_1000716 3300007085 Unclassified 3439

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_355816 Ga0466728_355816_721_1470 249
2 3300007052 Ga0102736_1000151 Ga0102736_100015120 250
3 3300042615 Ga0466711_039051 Ga0466711_039051_1423_2175 250
4 3300042619 Ga0466726_354312 Ga0466726_354312_20_772 250
5 3300000036 IMNBGM34_c004555 IMNBGM34_0045552 254
6 3300042601 Ga0466707_348521 Ga0466707_348521_52_900 254
7 3300042600 Ga0466700_131815 Ga0466700_131815_40294_41172 258
8 3300042648 Ga0466709_130933 Ga0466709_130933_2537_3385 258
9 3300042605 Ga0466716_159224 Ga0466716_159224_2526_3377 260
10 3300042606 Ga0466719_193024 Ga0466719_193024_62_910 260
11 3300042614 Ga0466712_053332 Ga0466712_053332_2238_3098 262
12 3300002509 JGI24699J35502_11134167 JGI24699J35502_1113416738 263
13 3300012835 Ga0160446_100122 Ga0160446_1001229 264
14 3300009784 Ga0123357_10184619 Ga0123357_101846192 267
15 3300012839 Ga0160472_100233 Ga0160472_10023318 269
16 3300042601 Ga0466707_039903 Ga0466707_039903_22361_23266 270
17 3300042624 Ga0466735_119871 Ga0466735_119871_144_992 270
18 3300042598 Ga0466701_022354 Ga0466701_022354_74386_75234 274
19 3300042615 Ga0466711_299966 Ga0466711_299966_11691_12542 274
20 3300042601 Ga0466707_296253 Ga0466707_296253_12168_13019 276
21 3300042659 Ga0466733_040584 Ga0466733_040584_4282_5142 276
22 2225789004 2227638502 2228226714 277
23 3300000062 IMNBL1DRAFT_c0000261 IMNBL1DRAFT_000026138 277
24 3300009784 Ga0123357_10000423 Ga0123357_1000042336 277
25 3300042590 Ga0466690_259901 Ga0466690_259901_568_1401 277
26 3300042616 Ga0466715_030834 Ga0466715_030834_1981_2850 277
27 3300042616 Ga0466715_135674 Ga0466715_135674_389_1222 277
28 3300042618 Ga0466723_203856 Ga0466723_203856_484_1317 277
29 3300009784 Ga0123357_10001166 Ga0123357_1000116620 278
30 3300042582 Ga0466657_234309 Ga0466657_234309_485_1345 278
31 3300042591 Ga0466692_034223 Ga0466692_034223_31524_32360 278
32 3300042616 Ga0466715_249034 Ga0466715_249034_3570_4406 278
33 3300042624 Ga0466735_059303 Ga0466735_059303_639_1475 278
34 2225789004 2227523538 2228029171 279
35 3300005083 Ga0068305_10729399 Ga0068305_107293992 279
36 iso_pr_bacteria 2820418027 2820419105 279
37 3300010167 Ga0123353_10001066 Ga0123353_100010665 280
38 3300042602 Ga0466713_043123 Ga0466713_043123_847_1689 280
39 3300042619 Ga0466726_294202 Ga0466726_294202_989_1831 280
40 3300042636 Ga0466703_192467 Ga0466703_192467_1269_2111 280
41 3300042636 Ga0466703_298915 Ga0466703_298915_124_966 280
42 3300042655 Ga0466727_323834 Ga0466727_323834_327_1169 280
43 iso_pr_bacteria 2820741847 2820742138 280
44 3300010882 Ga0123354_10085257 Ga0123354_100852573 281
45 3300042594 Ga0466694_170886 Ga0466694_170886_470_1315 281
46 3300042594 Ga0466694_256167 Ga0466694_256167_456_1301 281
47 3300042596 Ga0466696_425887 Ga0466696_425887_687_1532 281
48 3300042601 Ga0466707_159375 Ga0466707_159375_3308_4153 281
49 3300042601 Ga0466707_174317 Ga0466707_174317_2383_3228 281
50 iso_pr_bacteria 2920168565 2920168621 281
51 2225789004 2227419997 2227861358 282
52 2225789004 2227491886 2227964919 282
53 3300042590 Ga0466690_255712 Ga0466690_255712_2444_3292 282
54 3300042590 Ga0466690_300520 Ga0466690_300520_3745_4593 282
55 3300042591 Ga0466692_074053 Ga0466692_074053_7186_8034 282
56 3300042598 Ga0466701_086124 Ga0466701_086124_56686_57534 282
57 3300042601 Ga0466707_032562 Ga0466707_032562_504_1352 282
58 3300042601 Ga0466707_359800 Ga0466707_359800_392_1240 282
59 3300042605 Ga0466716_127599 Ga0466716_127599_4226_5074 282
60 3300042606 Ga0466719_253408 Ga0466719_253408_868_1716 282
61 3300042612 Ga0466705_169650 Ga0466705_169650_1667_2515 282
62 3300042612 Ga0466705_433289 Ga0466705_433289_397_1245 282
63 3300042615 Ga0466711_250155 Ga0466711_250155_889_1737 282
64 3300042620 Ga0466728_380615 Ga0466728_380615_226_1074 282
65 3300042621 Ga0466729_311623 Ga0466729_311623_2193_3041 282
66 3300042622 Ga0466731_056111 Ga0466731_056111_188_1036 282
67 3300042624 Ga0466735_088782 Ga0466735_088782_281_1129 282
68 3300042624 Ga0466735_091533 Ga0466735_091533_20102_20950 282
69 3300042625 Ga0466730_071786 Ga0466730_071786_551504_552352 282
70 3300042636 Ga0466703_286969 Ga0466703_286969_379_1227 282
71 3300042643 Ga0466704_041737 Ga0466704_041737_4173_5021 282
72 3300042643 Ga0466704_063898 Ga0466704_063898_254_1102 282
73 3300042643 Ga0466704_417045 Ga0466704_417045_3110_3958 282
74 3300042648 Ga0466709_417477 Ga0466709_417477_414_1262 282
75 3300042652 Ga0466708_115899 Ga0466708_115899_4299_5147 282
76 3300042652 Ga0466708_184325 Ga0466708_184325_4269_5117 282
77 3300042655 Ga0466727_188985 Ga0466727_188985_1660_2508 282
78 iso_pr_bacteria 2687453786 2690172572 282
79 iso_pr_bacteria 2864822740 2864825502 282
80 iso_pr_bacteria 2864831662 2864834916 282
81 iso_pr_bacteria 2864882932 2864885694 282
82 iso_pr_bacteria 2967483437 2967483633 282
83 2225789004 2227358575 2227806363 283
84 3300010049 Ga0123356_10004830 Ga0123356_100048308 283
85 3300042596 Ga0466696_284154 Ga0466696_284154_1062_1913 283
86 3300042643 Ga0466704_081521 Ga0466704_081521_5059_5910 283
87 3300000062 IMNBL1DRAFT_c0000469 IMNBL1DRAFT_000046923 284
88 3300002504 JGI24705J35276_12238610 JGI24705J35276_122386105 284
89 3300042601 Ga0466707_089123 Ga0466707_089123_1498_2352 284
90 3300042616 Ga0466715_139815 Ga0466715_139815_415_1269 284
91 iso_pr_bacteria 2509276035 2509458815 284
92 iso_pr_bacteria 2873776654 2873780122 284
93 3300000036 IMNBGM34_c000232 IMNBGM34_0002326 285
94 3300002504 JGI24705J35276_12222202 JGI24705J35276_122222022 285
95 3300009784 Ga0123357_10133021 Ga0123357_101330213 285
96 3300010167 Ga0123353_10443040 Ga0123353_104430402 285
97 3300010882 Ga0123354_10006259 Ga0123354_100062593 285
98 3300010882 Ga0123354_10013939 Ga0123354_100139398 285
99 3300010882 Ga0123354_10163887 Ga0123354_101638873 285
100 3300012839 Ga0160472_100566 Ga0160472_1005662 285
101 3300007085 Ga0104045_1000716 Ga0104045_10007163 286
102 3300007153 Ga0104050_1001326 Ga0104050_10013262 286
103 3300012841 Ga0160444_100090 Ga0160444_10009080 286
104 3300042623 Ga0466734_071349 Ga0466734_071349_2286_3146 286
105 3300042649 Ga0466724_37932 Ga0466724_37932_87114_87974 286
106 3300042659 Ga0466733_044535 Ga0466733_044535_1890_2750 286
107 iso_pr_bacteria 2590828803 2592929191 286
108 iso_pr_bacteria 2695420314 2695472019 286
109 iso_pr_bacteria 2940244548 2940247255 286
110 iso_pr_bacteria 2940248789 2940251051 286
111 iso_pr_bacteria 2940253009 2940255299 286
112 iso_pr_bacteria 2940257232 2940259296 286
113 3300010167 Ga0123353_10551567 Ga0123353_105515672 287
114 3300042603 Ga0466714_068450 Ga0466714_068450_23673_24536 287
115 3300042622 Ga0466731_414863 Ga0466731_414863_31_894 287
116 3300042659 Ga0466733_221827 Ga0466733_221827_508_1371 287
117 3300010167 Ga0123353_10448870 Ga0123353_104488702 288
118 3300010882 Ga0123354_10112882 Ga0123354_101128821 288
119 3300010167 Ga0123353_10111010 Ga0123353_101110103 290
120 3300010167 Ga0123353_10701629 Ga0123353_107016292 290
121 3300010167 Ga0123353_11074420 Ga0123353_110744202 290
122 3300000089 AustNasuHG_c1001857 AustNasuHG_10018572 291
123 3300007188 Ga0103264_1000104 Ga0103264_100010441 291
124 3300042598 Ga0466701_017684 Ga0466701_017684_1358_2239 293
125 3300010882 Ga0123354_10004397 Ga0123354_1000439719 294
126 3300005201 Ga0072941_1733763 Ga0072941_17337632 295
127 3300007068 Ga0103265_1000005 Ga0103265_100000584 295
128 3300007190 Ga0103267_1000818 Ga0103267_10008186 295
129 3300002450 JGI24695J34938_10000900 JGI24695J34938_1000090015 296
130 3300042590 Ga0466690_193388 Ga0466690_193388_50_946 298
131 3300042659 Ga0466733_025888 Ga0466733_025888_15782_16705 307

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01061 ABC2_membrane ABC-2 type transporter 58 265 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.