Protein Family IF10274
Metagenome
Isolate
348
Members
106
Samples
298
Scaffolds
439.9
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_020701|Ga0466733_020701_615_2141
- Length
- 501 aa
- Sequence
- METILIKALQLILSLSILVIIHEFGHFLFARLFKIRVEKFYLFFNPWFSLFKYKPKNSDTEYGIGWLPLGGYVKISEMIDESMDKEQMALPPQPWEFRSKPAWQRLLVMVGGVLFNFILAIIIFSMMLFVWGDEYLPLKNVKDGMVFSETVKRNGGFQDKDILVSADGKDLVLGRGVLDMNTFMHFIDAKTVTIVRNGKQMELTLPESFADSVIASKQVAYNYWESPVIDSVTKNSEAERIGLIRGDSITALDSQPITSLLGIQKYVTRISNKLEDSLKNTIPPLLNRKTLKVWLQRNDSITKSDSDSIPAFKGLNYAMAKILEELESRETRSVAITFYRNGEVQTVSAAIDTSGVIGFKSPTKMADIFSKKNMQTDHYGFFESFPAGINNGVATLKGYVAQIRFVFSKEGVKNLSGFAGIGNMFPAQWNWYAFWSMTAFLSIVLAFMNILPIPALDGGHIMFLLYEAITKRQPNEKFMEYAQVGGMLFANGNDIMRIFFK
Sample Types
Isolate
14.4%
Metagenome
85.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
31.1%
Termitidae
22.3%
Kalotermitidae
13.6%
Unclassified
11.7%
Rhinotermitidae
5.8%
Termopsidae
3.9%
Passalidae
2.9%
Formicidae
1.9%
Hydrophilidae
1.9%
Hodotermitidae
1.0%
Drosophilidae
1.0%
Nephropidae
1.0%
Cambaridae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
346
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 3 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 4 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 5 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 6 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 7 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 8 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 9 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 10 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 24 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 25 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 26 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 27 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 28 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 33 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 34 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 35 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 36 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 37 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 38 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 39 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 40 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 41 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 45 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 51 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 52 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 53 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 54 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 55 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 56 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 57 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 58 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 63 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 64 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 65 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 66 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 67 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 68 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 69 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 70 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 73 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 74 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 77 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 79 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 80 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 81 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 82 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 85 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 86 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 87 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 88 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 89 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 90 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 91 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 92 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 93 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 94 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 95 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 96 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 97 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 98 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 99 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 100 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 101 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 102 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 103 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 104 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 105 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 106 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_015572 | 3300042612 | Bacteria | 13659 |
| 2 | Ga0466705_291178 | 3300042612 | Bacteria | 54630 |
| 3 | Ga0466733_040601 | 3300042659 | Bacteria | 18985 |
| 4 | Ga0123357_10001409 | 3300009784 | Bacteria | 25443 |
| 5 | Ga0123354_10004244 | 3300010882 | Bacteria | 20226 |
| 6 | Ga0466715_281415 | 3300042616 | Bacteria | 11269 |
| 7 | Ga0466715_329619 | 3300042616 | Bacteria | 25382 |
| 8 | Ga0466735_031194 | 3300042624 | Bacteria | 4386 |
| 9 | Ga0466735_085660 | 3300042624 | Bacteria | 3155 |
| 10 | Ga0466735_207195 | 3300042624 | Bacteria | 4271 |
| 11 | Ga0466730_014629 | 3300042625 | Bacteria | 4711 |
| 12 | Ga0466703_116882 | 3300042636 | Bacteria | 19357 |
| 13 | Ga0466703_193894 | 3300042636 | Bacteria | 12654 |
| 14 | Ga0466703_284542 | 3300042636 | Bacteria | 24599 |
| 15 | Ga0466704_180222 | 3300042643 | Bacteria | 4912 |
| 16 | Ga0466704_205014 | 3300042643 | Bacteria | 47651 |
| 17 | Ga0466704_448873 | 3300042643 | Bacteria | 12081 |
| 18 | Ga0466709_218465 | 3300042648 | Bacteria | 6427 |
| 19 | Ga0466709_219231 | 3300042648 | Bacteria | 38332 |
| 20 | Ga0466708_033796 | 3300042652 | Bacteria | 26786 |
| 21 | Ga0415639_191163 | 3300038395 | Bacteria | 3842 |
| 22 | Ga0466690_388556 | 3300042590 | Bacteria | 11669 |
| 23 | Ga0466696_194714 | 3300042596 | Bacteria | 10029 |
| 24 | Ga0466696_379036 | 3300042596 | Bacteria | 3323 |
| 25 | Ga0466706_065618 | 3300042599 | Bacteria | 55553 |
| 26 | Ga0466706_138738 | 3300042599 | Bacteria | 21469 |
| 27 | Ga0466700_468790 | 3300042600 | Bacteria | 11143 |
| 28 | Ga0466707_211073 | 3300042601 | Bacteria | 2523 |
| 29 | Ga0466707_282317 | 3300042601 | Bacteria | 10877 |
| 30 | Ga0466714_131104 | 3300042603 | Bacteria | 32049 |
| 31 | Ga0466716_236675 | 3300042605 | Bacteria | 16629 |
| 32 | Ga0466716_345073 | 3300042605 | Bacteria | 2221 |
| 33 | Ga0466719_021529 | 3300042606 | Bacteria | 2603 |
| 34 | Ga0466722_075746 | 3300042609 | Bacteria | 16085 |
| 35 | Ga0466722_225727 | 3300042609 | Bacteria | 1609 |
| 36 | Ga0466733_015305 | 3300042659 | Bacteria | 13906 |
| 37 | Ga0466733_046116 | 3300042659 | Bacteria | 8568 |
| 38 | 2227147481 | 2225789004 | Bacteria | 8582 |
| 39 | IMNBL1DRAFT_c0016600 | 3300000062 | Bacteria | 3143 |
| 40 | JGI24702J35022_10010078 | 3300002462 | Bacteria | 5293 |
| 41 | JGI24702J35022_10016262 | 3300002462 | Bacteria | 4080 |
| 42 | Ga0068305_10003466 | 3300005083 | Bacteria | 11723 |
| 43 | Ga0068305_10136565 | 3300005083 | Unclassified | 2403 |
| 44 | Ga0123357_10053603 | 3300009784 | Bacteria | 5441 |
| 45 | Ga0123353_10349823 | 3300010167 | Bacteria | 2227 |
| 46 | Ga0466711_218004 | 3300042615 | Bacteria | 3995 |
| 47 | Ga0466711_269463 | 3300042615 | Bacteria | 35185 |
| 48 | Ga0466711_299592 | 3300042615 | Bacteria | 3610 |
| 49 | Ga0466715_138750 | 3300042616 | Bacteria | 8615 |
| 50 | Ga0466723_062038 | 3300042618 | Bacteria | 10740 |
| 51 | Ga0466728_432513 | 3300042620 | Bacteria | 11770 |
| 52 | Ga0466731_107242 | 3300042622 | Bacteria | 1431 |
| 53 | Ga0466735_083432 | 3300042624 | Bacteria | 5771 |
| 54 | Ga0466735_235709 | 3300042624 | Bacteria | 2718 |
| 55 | Ga0466704_191027 | 3300042643 | Bacteria | 94994 |
| 56 | Ga0466709_253297 | 3300042648 | Bacteria | 5366 |
| 57 | Ga0466708_235979 | 3300042652 | Bacteria | 7059 |
| 58 | Ga0466727_099897 | 3300042655 | Bacteria | 8067 |
| 59 | Ga0466727_150038 | 3300042655 | Bacteria | 31765 |
| 60 | Ga0265387_1005738 | 3300024582 | Bacteria | 1674 |
| 61 | Ga0466690_009672 | 3300042590 | Bacteria | 10681 |
| 62 | Ga0466692_008016 | 3300042591 | Bacteria | 17376 |
| 63 | Ga0466693_365879 | 3300042592 | Bacteria | 3621 |
| 64 | Ga0466701_021588 | 3300042598 | Bacteria | 47878 |
| 65 | Ga0466701_094770 | 3300042598 | Bacteria | 17462 |
| 66 | Ga0466700_056183 | 3300042600 | Bacteria | 19305 |
| 67 | Ga0466719_099656 | 3300042606 | Bacteria | 8244 |
| 68 | Ga0466719_311466 | 3300042606 | Bacteria | 8824 |
| 69 | Ga0466705_115028 | 3300042612 | Bacteria | 8893 |
| 70 | Ga0466705_353563 | 3300042612 | Bacteria | 9505 |
| 71 | Ga0466733_093605 | 3300042659 | Bacteria | 59912 |
| 72 | 2227108603 | 2225789004 | Bacteria | 9462 |
| 73 | 2227510741 | 2225789004 | Bacteria | 18495 |
| 74 | JGI24702J35022_10001027 | 3300002462 | Bacteria | 17456 |
| 75 | Ga0103267_1000024 | 3300007190 | Bacteria | 70169 |
| 76 | Ga0123356_10008036 | 3300010049 | Bacteria | 10500 |
| 77 | Ga0466711_034882 | 3300042615 | Bacteria | 28602 |
| 78 | Ga0466711_235523 | 3300042615 | Bacteria | 11905 |
| 79 | Ga0466711_272630 | 3300042615 | Bacteria | 10448 |
| 80 | Ga0466711_302136 | 3300042615 | Bacteria | 1918 |
| 81 | Ga0466715_193888 | 3300042616 | Bacteria | 87863 |
| 82 | Ga0466715_446687 | 3300042616 | Bacteria | 7227 |
| 83 | Ga0466715_509507 | 3300042616 | Bacteria | 15716 |
| 84 | Ga0466715_553513 | 3300042616 | Bacteria | 13120 |
| 85 | Ga0466726_041545 | 3300042619 | Bacteria | 8369 |
| 86 | Ga0466728_227548 | 3300042620 | Bacteria | 5294 |
| 87 | Ga0466735_019751 | 3300042624 | Bacteria | 13741 |
| 88 | Ga0466735_106759 | 3300042624 | Bacteria | 2040 |
| 89 | Ga0466704_030571 | 3300042643 | Bacteria | 29418 |
| 90 | Ga0466704_127178 | 3300042643 | Bacteria | 11225 |
| 91 | Ga0466709_115025 | 3300042648 | Bacteria | 26433 |
| 92 | Ga0466727_206331 | 3300042655 | Bacteria | 3900 |
| 93 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 94 | Ga0466692_021368 | 3300042591 | Bacteria | 5308 |
| 95 | Ga0466696_238781 | 3300042596 | Bacteria | 2624 |
| 96 | Ga0466696_319850 | 3300042596 | Bacteria | 9801 |
| 97 | Ga0466701_033084 | 3300042598 | Bacteria | 19683 |
| 98 | Ga0466706_015316 | 3300042599 | Bacteria | 50470 |
| 99 | Ga0466706_219858 | 3300042599 | Bacteria | 7935 |
| 100 | Ga0466707_016104 | 3300042601 | Bacteria | 15234 |
| 101 | Ga0466707_060703 | 3300042601 | Bacteria | 27082 |
| 102 | Ga0466713_015314 | 3300042602 | Bacteria | 17205 |
| 103 | Ga0466713_037753 | 3300042602 | Bacteria | 20566 |
| 104 | Ga0466713_130456 | 3300042602 | Bacteria | 105855 |
| 105 | Ga0466719_087802 | 3300042606 | Bacteria | 4100 |
| 106 | Ga0466719_513073 | 3300042606 | Bacteria | 13858 |
| 107 | Ga0466705_040899 | 3300042612 | Bacteria | 2269 |
| 108 | Ga0466733_024036 | 3300042659 | Bacteria | 2506 |
| 109 | Ga0466733_192794 | 3300042659 | Bacteria | 19678 |
| 110 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 111 | 2227641264 | 2225789004 | Bacteria | 11094 |
| 112 | 2227646849 | 2225789004 | Bacteria | 10910 |
| 113 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 114 | IMNBL1DRAFT_c0002389 | 3300000062 | Bacteria | 13078 |
| 115 | IMNBL1DRAFT_c0005324 | 3300000062 | Bacteria | 7393 |
| 116 | JGI24702J35022_10000175 | 3300002462 | Bacteria | 33803 |
| 117 | JGI24705J35276_12226325 | 3300002504 | Bacteria | 2844 |
| 118 | JGI24699J35502_11133691 | 3300002509 | Bacteria | 13646 |
| 119 | JGI24699J35502_11134195 | 3300002509 | Bacteria | 51638 |
| 120 | JGI24699J35502_11134228 | 3300002509 | Bacteria | 91082 |
| 121 | Ga0123354_10000306 | 3300010882 | Bacteria | 45162 |
| 122 | Ga0466705_394301 | 3300042612 | Bacteria | 2225 |
| 123 | Ga0466705_444326 | 3300042612 | Bacteria | 5393 |
| 124 | Ga0466715_284898 | 3300042616 | Bacteria | 18837 |
| 125 | Ga0466723_091519 | 3300042618 | Bacteria | 9163 |
| 126 | Ga0466723_175132 | 3300042618 | Bacteria | 10162 |
| 127 | Ga0466728_016849 | 3300042620 | Bacteria | 12533 |
| 128 | Ga0466735_012231 | 3300042624 | Bacteria | 2706 |
| 129 | Ga0466735_159074 | 3300042624 | Bacteria | 1469 |
| 130 | Ga0466730_008949 | 3300042625 | Bacteria | 4566 |
| 131 | Ga0466703_015736 | 3300042636 | Bacteria | 3709 |
| 132 | Ga0466703_145713 | 3300042636 | Bacteria | 18666 |
| 133 | Ga0466703_258895 | 3300042636 | Bacteria | 11508 |
| 134 | Ga0466704_205890 | 3300042643 | Bacteria | 4144 |
| 135 | Ga0466704_253673 | 3300042643 | Bacteria | 27128 |
| 136 | Ga0466704_335426 | 3300042643 | Bacteria | 21031 |
| 137 | Ga0466704_444960 | 3300042643 | Bacteria | 5808 |
| 138 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 139 | Ga0466708_041079 | 3300042652 | Bacteria | 19149 |
| 140 | Ga0466708_135441 | 3300042652 | Bacteria | 21711 |
| 141 | Ga0466727_157389 | 3300042655 | Bacteria | 2164 |
| 142 | Ga0466727_166305 | 3300042655 | Bacteria | 5426 |
| 143 | Ga0466657_377619 | 3300042582 | Bacteria | 2684 |
| 144 | Ga0466692_162937 | 3300042591 | Bacteria | 7543 |
| 145 | Ga0466696_016153 | 3300042596 | Bacteria | 4724 |
| 146 | Ga0466707_240264 | 3300042601 | Bacteria | 18653 |
| 147 | Ga0466713_104641 | 3300042602 | Bacteria | 82319 |
| 148 | Ga0466719_535324 | 3300042606 | Bacteria | 2048 |
| 149 | Ga0466705_071253 | 3300042612 | Bacteria | 10568 |
| 150 | Ga0466733_173685 | 3300042659 | Bacteria | 2695 |
| 151 | IMNBL1DRAFT_c0007053 | 3300000062 | Bacteria | 5986 |
| 152 | IMNBL1DRAFT_c0012803 | 3300000062 | Bacteria | 3810 |
| 153 | JGI24702J35022_10019378 | 3300002462 | Bacteria | 3700 |
| 154 | Ga0068302_10014878 | 3300005071 | Bacteria | 3210 |
| 155 | Ga0068305_10208409 | 3300005083 | Bacteria | 2239 |
| 156 | Ga0103267_1000192 | 3300007190 | Bacteria | 56966 |
| 157 | Ga0123357_10001102 | 3300009784 | Bacteria | 27997 |
| 158 | Ga0123357_10030017 | 3300009784 | Bacteria | 7372 |
| 159 | Ga0123357_10153585 | 3300009784 | Bacteria | 2784 |
| 160 | Ga0466710_254845 | 3300042613 | Bacteria | 11499 |
| 161 | Ga0466711_165298 | 3300042615 | Bacteria | 6598 |
| 162 | Ga0466715_111811 | 3300042616 | Bacteria | 33974 |
| 163 | Ga0466715_218888 | 3300042616 | Bacteria | 7911 |
| 164 | Ga0466715_266646 | 3300042616 | Bacteria | 10536 |
| 165 | Ga0466731_221597 | 3300042622 | Bacteria | 2114 |
| 166 | Ga0466735_113694 | 3300042624 | Bacteria | 6762 |
| 167 | Ga0466704_013664 | 3300042643 | Bacteria | 7799 |
| 168 | Ga0466704_037730 | 3300042643 | Bacteria | 5769 |
| 169 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 170 | Ga0466709_172421 | 3300042648 | Bacteria | 28599 |
| 171 | Ga0466692_116148 | 3300042591 | Bacteria | 18357 |
| 172 | Ga0466692_197103 | 3300042591 | Bacteria | 3583 |
| 173 | Ga0466695_174655 | 3300042595 | Bacteria | 3411 |
| 174 | Ga0466706_090709 | 3300042599 | Unclassified | 2614 |
| 175 | Ga0466706_123826 | 3300042599 | Bacteria | 29161 |
| 176 | Ga0466706_139141 | 3300042599 | Bacteria | 4620 |
| 177 | Ga0466706_243492 | 3300042599 | Bacteria | 2678 |
| 178 | Ga0466707_180185 | 3300042601 | Bacteria | 6823 |
| 179 | Ga0466713_050187 | 3300042602 | Bacteria | 75929 |
| 180 | Ga0466713_115337 | 3300042602 | Bacteria | 64305 |
| 181 | Ga0466713_138666 | 3300042602 | Bacteria | 6130 |
| 182 | Ga0466719_277402 | 3300042606 | Bacteria | 1724 |
| 183 | Ga0466719_358095 | 3300042606 | Bacteria | 26180 |
| 184 | Ga0466722_126170 | 3300042609 | Bacteria | 47921 |
| 185 | Ga0466733_204380 | 3300042659 | Bacteria | 28684 |
| 186 | 2227444713 | 2225789004 | Bacteria | 5449 |
| 187 | IMNBL1DRAFT_c0000941 | 3300000062 | Bacteria | 22460 |
| 188 | IMNBL1DRAFT_c0004825 | 3300000062 | Bacteria | 7952 |
| 189 | JGI24702J35022_10006322 | 3300002462 | Bacteria | 6853 |
| 190 | Ga0104048_1169652 | 3300007143 | Bacteria | 1946 |
| 191 | Ga0103267_1000204 | 3300007190 | Bacteria | 23169 |
| 192 | Ga0103268_1000022 | 3300007192 | Bacteria | 48958 |
| 193 | Ga0466711_034823 | 3300042615 | Bacteria | 24346 |
| 194 | Ga0466726_055796 | 3300042619 | Bacteria | 3521 |
| 195 | Ga0466726_206046 | 3300042619 | Bacteria | 3606 |
| 196 | Ga0466729_234125 | 3300042621 | Bacteria | 4608 |
| 197 | Ga0466735_157155 | 3300042624 | Bacteria | 8792 |
| 198 | Ga0466704_067672 | 3300042643 | Bacteria | 8450 |
| 199 | Ga0466704_195596 | 3300042643 | Bacteria | 17910 |
| 200 | Ga0466704_470276 | 3300042643 | Bacteria | 10510 |
| 201 | Ga0466708_152802 | 3300042652 | Bacteria | 15293 |
| 202 | Ga0466727_207362 | 3300042655 | Bacteria | 6971 |
| 203 | Ga0466727_315410 | 3300042655 | Bacteria | 16952 |
| 204 | Ga0466690_003083 | 3300042590 | Bacteria | 2647 |
| 205 | Ga0466690_021160 | 3300042590 | Bacteria | 34990 |
| 206 | Ga0466690_244169 | 3300042590 | Bacteria | 44294 |
| 207 | Ga0466694_110878 | 3300042594 | Bacteria | 1453 |
| 208 | Ga0466694_232656 | 3300042594 | Bacteria | 4739 |
| 209 | Ga0466696_052860 | 3300042596 | Bacteria | 12674 |
| 210 | Ga0466696_073794 | 3300042596 | Bacteria | 6663 |
| 211 | Ga0466707_166996 | 3300042601 | Bacteria | 4799 |
| 212 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 213 | Ga0466713_068845 | 3300042602 | Bacteria | 14438 |
| 214 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 215 | Ga0466716_028761 | 3300042605 | Bacteria | 9318 |
| 216 | Ga0466716_252142 | 3300042605 | Bacteria | 13515 |
| 217 | Ga0466716_472276 | 3300042605 | Bacteria | 6199 |
| 218 | Ga0466719_004777 | 3300042606 | Bacteria | 29050 |
| 219 | Ga0466722_200915 | 3300042609 | Bacteria | 5718 |
| 220 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 221 | Ga0466705_111152 | 3300042612 | Bacteria | 15328 |
| 222 | IMNBL1DRAFT_c0004434 | 3300000062 | Bacteria | 8452 |
| 223 | Ga0068305_10035554 | 3300005083 | Bacteria | 3243 |
| 224 | Ga0123357_10101763 | 3300009784 | Bacteria | 3701 |
| 225 | Ga0123353_10110308 | 3300010167 | Bacteria | 4433 |
| 226 | Ga0123354_10089802 | 3300010882 | Bacteria | 4261 |
| 227 | Ga0123354_10209114 | 3300010882 | Bacteria | 2115 |
| 228 | Ga0466711_010847 | 3300042615 | Bacteria | 41256 |
| 229 | Ga0466711_061153 | 3300042615 | Bacteria | 45788 |
| 230 | Ga0466711_459032 | 3300042615 | Bacteria | 1564 |
| 231 | Ga0466715_035091 | 3300042616 | Bacteria | 33246 |
| 232 | Ga0466715_065066 | 3300042616 | Bacteria | 20440 |
| 233 | Ga0466723_053657 | 3300042618 | Bacteria | 28642 |
| 234 | Ga0466723_285590 | 3300042618 | Bacteria | 4883 |
| 235 | Ga0466723_289487 | 3300042618 | Bacteria | 10914 |
| 236 | Ga0466723_350173 | 3300042618 | Bacteria | 2974 |
| 237 | Ga0466726_024585 | 3300042619 | Bacteria | 7155 |
| 238 | Ga0466729_027000 | 3300042621 | Bacteria | 1520 |
| 239 | Ga0466735_014689 | 3300042624 | Bacteria | 10199 |
| 240 | Ga0466703_141092 | 3300042636 | Bacteria | 9930 |
| 241 | Ga0466703_203107 | 3300042636 | Bacteria | 3525 |
| 242 | Ga0466704_175619 | 3300042643 | Bacteria | 30013 |
| 243 | Ga0466704_445369 | 3300042643 | Bacteria | 1830 |
| 244 | Ga0466725_014039 | 3300042654 | Bacteria | 16464 |
| 245 | Ga0466725_181371 | 3300042654 | Bacteria | 3577 |
| 246 | Ga0466656_246818 | 3300042550 | Bacteria | 17240 |
| 247 | Ga0466692_046888 | 3300042591 | Bacteria | 170448 |
| 248 | Ga0466691_217480 | 3300042593 | Bacteria | 22134 |
| 249 | Ga0466694_224535 | 3300042594 | Bacteria | 1656 |
| 250 | Ga0466706_049354 | 3300042599 | Bacteria | 18139 |
| 251 | Ga0466706_095663 | 3300042599 | Bacteria | 79833 |
| 252 | Ga0466706_102166 | 3300042599 | Bacteria | 8692 |
| 253 | Ga0466707_003680 | 3300042601 | Bacteria | 29693 |
| 254 | Ga0466707_017877 | 3300042601 | Bacteria | 16904 |
| 255 | Ga0466713_083606 | 3300042602 | Bacteria | 82045 |
| 256 | Ga0466713_104275 | 3300042602 | Bacteria | 5095 |
| 257 | Ga0466713_137960 | 3300042602 | Bacteria | 6491 |
| 258 | Ga0466716_227203 | 3300042605 | Bacteria | 21613 |
| 259 | Ga0466716_430332 | 3300042605 | Bacteria | 14125 |
| 260 | Ga0466719_104662 | 3300042606 | Bacteria | 2852 |
| 261 | Ga0466719_380215 | 3300042606 | Bacteria | 6483 |
| 262 | Ga0466722_177698 | 3300042609 | Bacteria | 2801 |
| 263 | Ga0466733_020701 | 3300042659 | Bacteria | 89487 |
| 264 | Ga0466733_030062 | 3300042659 | Bacteria | 1857 |
| 265 | 2226980397 | 2225789003 | Bacteria | 9139 |
| 266 | IMNBL1DRAFT_c0000876 | 3300000062 | Bacteria | 23480 |
| 267 | JGI24705J35276_12237430 | 3300002504 | Bacteria | 11104 |
| 268 | Ga0068305_10183435 | 3300005083 | Bacteria | 15053 |
| 269 | Ga0123356_10068239 | 3300010049 | Bacteria | 3330 |
| 270 | Ga0123354_10003206 | 3300010882 | Bacteria | 22421 |
| 271 | Ga0123354_10181105 | 3300010882 | Bacteria | 2405 |
| 272 | Ga0466705_421129 | 3300042612 | Bacteria | 8060 |
| 273 | Ga0466705_424374 | 3300042612 | Bacteria | 12669 |
| 274 | Ga0466715_128212 | 3300042616 | Bacteria | 57577 |
| 275 | Ga0466723_075931 | 3300042618 | Bacteria | 72847 |
| 276 | Ga0466726_093642 | 3300042619 | Bacteria | 1602 |
| 277 | Ga0466726_288887 | 3300042619 | Bacteria | 17570 |
| 278 | Ga0466703_135582 | 3300042636 | Bacteria | 15359 |
| 279 | Ga0466703_334948 | 3300042636 | Bacteria | 17622 |
| 280 | Ga0466704_109214 | 3300042643 | Bacteria | 4285 |
| 281 | Ga0466704_403785 | 3300042643 | Bacteria | 8123 |
| 282 | Ga0466704_530160 | 3300042643 | Bacteria | 4341 |
| 283 | Ga0466727_064353 | 3300042655 | Bacteria | 10913 |
| 284 | Ga0466727_223655 | 3300042655 | Bacteria | 2148 |
| 285 | Ga0415639_056529 | 3300038395 | Bacteria | 4008 |
| 286 | Ga0466657_387007 | 3300042582 | Bacteria | 76676 |
| 287 | Ga0466691_194640 | 3300042593 | Bacteria | 9191 |
| 288 | Ga0466696_141833 | 3300042596 | Bacteria | 18307 |
| 289 | Ga0466696_289196 | 3300042596 | Bacteria | 24856 |
| 290 | Ga0466701_057824 | 3300042598 | Bacteria | 22348 |
| 291 | Ga0466706_185693 | 3300042599 | Bacteria | 22583 |
| 292 | Ga0466707_340526 | 3300042601 | Bacteria | 2500 |
| 293 | Ga0466707_423135 | 3300042601 | Bacteria | 15793 |
| 294 | Ga0466713_076466 | 3300042602 | Bacteria | 1867 |
| 295 | Ga0466713_088387 | 3300042602 | Bacteria | 51632 |
| 296 | Ga0466713_103481 | 3300042602 | Bacteria | 5046 |
| 297 | Ga0466714_129041 | 3300042603 | Bacteria | 7925 |
| 298 | Ga0466722_009206 | 3300042609 | Bacteria | 29346 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02163 | GO:0006508 | proteolysis | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.