Protein Family IF10268

Metagenome Isolate
133 Members
56 Samples
117 Scaffolds
373.8 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_004128|Ga0466733_004128_700_1836
Length
378 aa
Sequence
MGVTITGVATKADRLKFVKFPINLYKNNPYYVPAFVLDELATLDPKKNPAFEFCEAKLFLAYSGKQVVGRIAAIINHRSNEIWNQKQARFGFVDFIDDNEVVDALFGAAEDWVQSMGMEAVHGPLGFTDLDREGLLIEGFDKLGTMVTLYCHPYYQTQIERIGYRKDTDWNEFLIQVPDNIPERHQRIAKIVADKYGLKVLKFNSKKEIEPYIDQIFELLNKAYKPLYGYVELSKKQIDYYVKTFISLLRWEIVPVIVKEDTNQVIAFGIAAPSLSKALQASRGKLFPFGWIGLLKALKSKNNPIIDLMIIGIDPEYQGKGINAMVFADMISSAYKCGFRYAESNPELETNNKMSSLWDGFVAENHKKRRAYIKKLKN

πŸ“Š Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.5%
Kalotermitidae 25.5%
Blattidae 21.8%
Unclassified 12.7%
Termopsidae 5.5%
Rhinotermitidae 5.5%
Passalidae 3.6%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
2 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
3 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
12 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
13 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
14 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
36 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
37 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
38 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
47 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
48 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
49 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
50 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
53 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
54 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_084192 3300042616 Bacteria 39268
2 Ga0466715_212319 3300042616 Bacteria 50715
3 Ga0466690_118484 3300042590 Bacteria 2640
4 Ga0123354_10005674 3300010882 Bacteria 18247
5 Ga0123354_10019958 3300010882 Bacteria 10532
6 Ga0466735_074110 3300042624 Bacteria 2589
7 Ga0466735_100892 3300042624 Bacteria 12211
8 Ga0466735_165799 3300042624 Bacteria 4589
9 Ga0466730_058138 3300042625 Bacteria 2126
10 Ga0466704_140354 3300042643 Bacteria 3176
11 Ga0466727_314523 3300042655 Bacteria 8017
12 Ga0466701_038531 3300042598 Bacteria 8654
13 Ga0466700_465756 3300042600 Bacteria 3352
14 Ga0466707_398517 3300042601 Bacteria 7240
15 Ga0466713_095879 3300042602 Bacteria 2771
16 Ga0466719_372844 3300042606 Bacteria 7253
17 Ga0466733_013509 3300042659 Bacteria 8665
18 Ga0466715_084050 3300042616 Bacteria 7152
19 Ga0466715_320776 3300042616 Bacteria 30358
20 Ga0466692_011810 3300042591 Bacteria 3809
21 Ga0466696_062776 3300042596 Bacteria 9759
22 Ga0123353_10544036 3300010167 Bacteria 1677
23 Ga0466735_044827 3300042624 Bacteria 4545
24 IMNBL1DRAFT_c0001181 3300000062 Bacteria 19912
25 JGI24699J35502_11134024 3300002509 Bacteria 24835
26 JGI24699J35502_11134105 3300002509 Bacteria 31307
27 JGI24696J40584_12935923 3300002834 Bacteria 1570
28 Ga0068305_10047015 3300005083 Bacteria 10541
29 Ga0466713_058914 3300042602 Bacteria 10168
30 Ga0466713_093032 3300042602 Bacteria 12374
31 Ga0466719_061695 3300042606 Bacteria 12823
32 Ga0466719_082759 3300042606 Bacteria 6619
33 Ga0466719_335142 3300042606 Bacteria 2270
34 Ga0466697_064536 3300042611 Bacteria 2693
35 Ga0466715_180732 3300042616 Bacteria 9421
36 Ga0466726_003419 3300042619 Bacteria 66294
37 Ga0466726_289602 3300042619 Bacteria 3781
38 Ga0466728_453051 3300042620 Bacteria 4299
39 Ga0466657_332437 3300042582 Bacteria 1507
40 Ga0466690_002563 3300042590 Bacteria 35514
41 Ga0466690_103040 3300042590 Bacteria 7271
42 Ga0466692_119633 3300042591 Bacteria 108688
43 IMNBL1DRAFT_c0002641 3300000062 Bacteria 12271
44 Ga0123357_10000953 3300009784 Bacteria 29426
45 Ga0466713_035811 3300042602 Bacteria 2857
46 Ga0466722_135732 3300042609 Bacteria 9416
47 Ga0466703_025159 3300042636 Bacteria 24490
48 Ga0466703_317173 3300042636 Unclassified 7389
49 Ga0466704_236373 3300042643 Bacteria 11089
50 Ga0466709_076850 3300042648 Bacteria 50213
51 IMNBL1DRAFT_c0010049 3300000062 Bacteria 4586
52 JGI24699J35502_11134139 3300002509 Bacteria 36268
53 Ga0123357_10001881 3300009784 Bacteria 22798
54 Ga0466707_242090 3300042601 Bacteria 13004
55 Ga0466713_017110 3300042602 Unclassified 1969
56 Ga0466713_095333 3300042602 Bacteria 7204
57 Ga0466722_169662 3300042609 Bacteria 9082
58 Ga0466692_129839 3300042591 Bacteria 6251
59 Ga0466691_078604 3300042593 Bacteria 17200
60 Ga0123353_10232070 3300010167 Bacteria 2876
61 Ga0123354_10015660 3300010882 Bacteria 11858
62 Ga0123354_10132834 3300010882 Bacteria 3133
63 Ga0466735_106251 3300042624 Bacteria 7054
64 Ga0466735_115300 3300042624 Bacteria 3947
65 Ga0466703_019192 3300042636 Bacteria 3031
66 Ga0466703_030789 3300042636 Bacteria 16264
67 Ga0466703_131622 3300042636 Bacteria 3569
68 Ga0466704_080743 3300042643 Bacteria 31033
69 Ga0466704_145968 3300042643 Bacteria 20472
70 Ga0072941_1049923 3300005201 Bacteria 2115
71 Ga0466707_416976 3300042601 Bacteria 13390
72 Ga0466713_012777 3300042602 Unclassified 21574
73 Ga0466713_077113 3300042602 Bacteria 10235
74 Ga0466719_139427 3300042606 Bacteria 18554
75 Ga0466705_386231 3300042612 Bacteria 4421
76 Ga0466733_037360 3300042659 Bacteria 17049
77 Ga0466715_024383 3300042616 Bacteria 26866
78 Ga0466723_090046 3300042618 Bacteria 10526
79 Ga0123353_10350504 3300010167 Bacteria 2225
80 Ga0123354_10099086 3300010882 Unclassified 3958
81 Ga0466735_150621 3300042624 Bacteria 1746
82 Ga0466703_220516 3300042636 Bacteria 13924
83 Ga0466727_269194 3300042655 Bacteria 5070
84 Ga0466700_080920 3300042600 Bacteria 34770
85 Ga0466707_383222 3300042601 Bacteria 43346
86 Ga0466716_016748 3300042605 Bacteria 11880
87 Ga0466716_215607 3300042605 Bacteria 12242
88 Ga0466733_004128 3300042659 Bacteria 2640
89 Ga0123357_10082708 3300009784 Bacteria 4215
90 Ga0123356_10006051 3300010049 Bacteria 12274
91 Ga0123354_10161258 3300010882 Bacteria 2661
92 Ga0466735_156239 3300042624 Bacteria 11962
93 Ga0466704_135835 3300042643 Bacteria 5881
94 Ga0466704_210281 3300042643 Bacteria 12955
95 Ga0466704_378393 3300042643 Bacteria 6759
96 Ga0466709_368924 3300042648 Bacteria 2972
97 Ga0466708_251448 3300042652 Bacteria 5773
98 Ga0466713_107438 3300042602 Bacteria 2913
99 Ga0466714_163409 3300042603 Bacteria 1550
100 Ga0466719_378878 3300042606 Bacteria 3929
101 Ga0466722_019633 3300042609 Bacteria 1369
102 Ga0466722_030300 3300042609 Bacteria 1369
103 Ga0466722_175484 3300042609 Bacteria 16031
104 Ga0466705_108394 3300042612 Bacteria 3845
105 Ga0466711_042192 3300042615 Bacteria 7319
106 Ga0466728_297447 3300042620 Unclassified 2559
107 Ga0466692_107418 3300042591 Bacteria 14127
108 Ga0466729_232386 3300042621 Bacteria 1165
109 Ga0466703_033655 3300042636 Bacteria 4013
110 Ga0466727_037894 3300042655 Bacteria 109077
111 2227524630 2225789004 Bacteria 16931
112 JGI24702J35022_10023546 3300002462 Bacteria 3329
113 Ga0123357_10000449 3300009784 Bacteria 39751
114 Ga0466700_020224 3300042600 Bacteria 23800
115 Ga0466707_094727 3300042601 Bacteria 1569
116 Ga0466707_389970 3300042601 Bacteria 7998
117 Ga0466713_124022 3300042602 Bacteria 3332

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_139427 Ga0466719_139427_17491_18495 334
2 3300042582 Ga0466657_332437 Ga0466657_332437_390_1400 336
3 3300042636 Ga0466703_131622 Ga0466703_131622_390_1400 336
4 3300042602 Ga0466713_035811 Ga0466713_035811_1829_2842 337
5 3300042606 Ga0466719_372844 Ga0466719_372844_2146_3171 341
6 3300042648 Ga0466709_368924 Ga0466709_368924_1930_2955 341
7 3300042602 Ga0466713_107438 Ga0466713_107438_1020_2081 353
8 3300042655 Ga0466727_314523 Ga0466727_314523_2604_3668 354
9 3300042602 Ga0466713_058914 Ga0466713_058914_5173_6300 358
10 3300042643 Ga0466704_135835 Ga0466704_135835_2611_3738 358
11 3300005083 Ga0068305_10047015 Ga0068305_100470154 359
12 2225789004 2227524630 2228031289 361
13 3300042624 Ga0466735_074110 Ga0466735_074110_994_2121 362
14 3300042601 Ga0466707_389970 Ga0466707_389970_4685_5821 363
15 3300042659 Ga0466733_037360 Ga0466733_037360_5029_6156 363
16 3300042620 Ga0466728_297447 Ga0466728_297447_1438_2532 364
17 3300042643 Ga0466704_145968 Ga0466704_145968_15845_16939 364
18 3300042590 Ga0466690_118484 Ga0466690_118484_464_1588 374
19 3300042591 Ga0466692_011810 Ga0466692_011810_2341_3465 374
20 3300042593 Ga0466691_078604 Ga0466691_078604_1019_2143 374
21 3300042606 Ga0466719_061695 Ga0466719_061695_7638_8762 374
22 3300042609 Ga0466722_135732 Ga0466722_135732_225_1349 374
23 3300042609 Ga0466722_169662 Ga0466722_169662_5381_6505 374
24 3300042611 Ga0466697_064536 Ga0466697_064536_441_1565 374
25 3300042616 Ga0466715_084192 Ga0466715_084192_18807_19931 374
26 3300042616 Ga0466715_180732 Ga0466715_180732_53_1177 374
27 3300042620 Ga0466728_453051 Ga0466728_453051_59_1183 374
28 3300042625 Ga0466730_058138 Ga0466730_058138_607_1731 374
29 3300042636 Ga0466703_030789 Ga0466703_030789_12752_13876 374
30 3300042590 Ga0466690_002563 Ga0466690_002563_2446_3573 375
31 3300042591 Ga0466692_119633 Ga0466692_119633_65034_66161 375
32 3300042591 Ga0466692_129839 Ga0466692_129839_367_1494 375
33 3300042596 Ga0466696_062776 Ga0466696_062776_2732_3859 375
34 3300042601 Ga0466707_094727 Ga0466707_094727_267_1394 375
35 3300042601 Ga0466707_242090 Ga0466707_242090_7273_8400 375
36 3300042601 Ga0466707_398517 Ga0466707_398517_1010_2137 375
37 3300042602 Ga0466713_077113 Ga0466713_077113_8731_9858 375
38 3300042602 Ga0466713_093032 Ga0466713_093032_5611_6738 375
39 3300042602 Ga0466713_124022 Ga0466713_124022_918_2045 375
40 3300042605 Ga0466716_016748 Ga0466716_016748_3772_4899 375
41 3300042606 Ga0466719_082759 Ga0466719_082759_190_1317 375
42 3300042609 Ga0466722_019633 Ga0466722_019633_40_1167 375
43 3300042609 Ga0466722_030300 Ga0466722_030300_40_1167 375
44 3300042612 Ga0466705_108394 Ga0466705_108394_2272_3399 375
45 3300042616 Ga0466715_320776 Ga0466715_320776_24902_26029 375
46 3300042618 Ga0466723_090046 Ga0466723_090046_3127_4254 375
47 3300042619 Ga0466726_289602 Ga0466726_289602_129_1256 375
48 3300042624 Ga0466735_044827 Ga0466735_044827_564_1691 375
49 3300042624 Ga0466735_106251 Ga0466735_106251_5902_7029 375
50 3300042624 Ga0466735_115300 Ga0466735_115300_274_1401 375
51 3300042624 Ga0466735_150621 Ga0466735_150621_334_1461 375
52 3300042624 Ga0466735_165799 Ga0466735_165799_3083_4210 375
53 3300042643 Ga0466704_210281 Ga0466704_210281_10543_11670 375
54 3300042643 Ga0466704_236373 Ga0466704_236373_8812_9939 375
55 3300042659 Ga0466733_013509 Ga0466733_013509_2027_3154 375
56 iso_pr_bacteria 2940205530 2940208266 375
57 iso_pr_bacteria 2940212447 2940215180 375
58 iso_pr_bacteria 2940298504 2940301234 375
59 iso_pr_bacteria 2940302308 2940304922 375
60 iso_pr_bacteria 2940306115 2940309174 375
61 iso_pr_bacteria 2940309933 2940313011 375
62 iso_pr_bacteria 2940313741 2940316742 375
63 iso_pr_bacteria 2940317558 2940320556 375
64 iso_pr_bacteria 2940321370 2940324313 375
65 iso_pr_bacteria 2940325180 2940327906 375
66 iso_pr_bacteria 2940328985 2940331713 375
67 iso_pr_bacteria 2940332795 2940335877 375
68 iso_pr_bacteria 2967483437 2967483441 375
69 3300000062 IMNBL1DRAFT_c0010049 IMNBL1DRAFT_00100492 376
70 3300010167 Ga0123353_10232070 Ga0123353_102320701 376
71 3300042590 Ga0466690_103040 Ga0466690_103040_2596_3726 376
72 3300042591 Ga0466692_107418 Ga0466692_107418_7142_8272 376
73 3300042598 Ga0466701_038531 Ga0466701_038531_4016_5146 376
74 3300042600 Ga0466700_020224 Ga0466700_020224_1903_3033 376
75 3300042600 Ga0466700_465756 Ga0466700_465756_1224_2354 376
76 3300042601 Ga0466707_416976 Ga0466707_416976_12198_13328 376
77 3300042602 Ga0466713_012777 Ga0466713_012777_14311_15441 376
78 3300042602 Ga0466713_095333 Ga0466713_095333_5845_6975 376
79 3300042606 Ga0466719_335142 Ga0466719_335142_564_1694 376
80 3300042606 Ga0466719_378878 Ga0466719_378878_2619_3749 376
81 3300042616 Ga0466715_024383 Ga0466715_024383_17010_18140 376
82 3300042616 Ga0466715_212319 Ga0466715_212319_38287_39417 376
83 3300042621 Ga0466729_232386 Ga0466729_232386_10_1140 376
84 3300042624 Ga0466735_100892 Ga0466735_100892_4609_5739 376
85 3300042624 Ga0466735_156239 Ga0466735_156239_3318_4448 376
86 3300042636 Ga0466703_019192 Ga0466703_019192_218_1348 376
87 3300042636 Ga0466703_025159 Ga0466703_025159_10595_11725 376
88 3300042636 Ga0466703_317173 Ga0466703_317173_5526_6656 376
89 3300042648 Ga0466709_076850 Ga0466709_076850_9457_10587 376
90 3300042655 Ga0466727_269194 Ga0466727_269194_3657_4787 376
91 iso_pr_bacteria 2820759988 2820761513 376
92 iso_pr_bacteria 2820762746 2820764234 376
93 iso_pr_bacteria 2820778767 2820779386 376
94 3300000062 IMNBL1DRAFT_c0001181 IMNBL1DRAFT_000118113 377
95 3300000062 IMNBL1DRAFT_c0002641 IMNBL1DRAFT_00026416 377
96 3300002462 JGI24702J35022_10023546 JGI24702J35022_100235462 377
97 3300002509 JGI24699J35502_11134024 JGI24699J35502_1113402432 377
98 3300002509 JGI24699J35502_11134105 JGI24699J35502_1113410524 377
99 3300002834 JGI24696J40584_12935923 JGI24696J40584_129359232 377
100 3300005201 Ga0072941_1049923 Ga0072941_10499232 377
101 3300009784 Ga0123357_10000449 Ga0123357_1000044926 377
102 3300009784 Ga0123357_10000953 Ga0123357_1000095321 377
103 3300009784 Ga0123357_10001881 Ga0123357_1000188111 377
104 3300009784 Ga0123357_10082708 Ga0123357_100827084 377
105 3300010049 Ga0123356_10006051 Ga0123356_100060515 377
106 3300010167 Ga0123353_10350504 Ga0123353_103505042 377
107 3300010167 Ga0123353_10544036 Ga0123353_105440362 377
108 3300010882 Ga0123354_10005674 Ga0123354_100056745 377
109 3300010882 Ga0123354_10015660 Ga0123354_100156604 377
110 3300010882 Ga0123354_10019958 Ga0123354_100199585 377
111 3300010882 Ga0123354_10099086 Ga0123354_100990864 377
112 3300010882 Ga0123354_10132834 Ga0123354_101328342 377
113 3300010882 Ga0123354_10161258 Ga0123354_101612582 377
114 3300042602 Ga0466713_017110 Ga0466713_017110_243_1376 377
115 3300042605 Ga0466716_215607 Ga0466716_215607_10781_11914 377
116 3300042643 Ga0466704_140354 Ga0466704_140354_1891_3024 377
117 3300042659 Ga0466733_004128 Ga0466733_004128_700_1836 378
118 3300042602 Ga0466713_095879 Ga0466713_095879_1344_2483 379
119 3300042619 Ga0466726_003419 Ga0466726_003419_38439_39578 379
120 3300042636 Ga0466703_033655 Ga0466703_033655_964_2103 379
121 3300042636 Ga0466703_220516 Ga0466703_220516_478_1617 379
122 3300042643 Ga0466704_080743 Ga0466704_080743_3564_4703 379
123 3300042655 Ga0466727_037894 Ga0466727_037894_59256_60395 379
124 3300042612 Ga0466705_386231 Ga0466705_386231_2044_3186 380
125 3300042652 Ga0466708_251448 Ga0466708_251448_66_1211 381
126 3300042615 Ga0466711_042192 Ga0466711_042192_3473_4621 382
127 3300042643 Ga0466704_378393 Ga0466704_378393_1548_2699 383
128 3300042601 Ga0466707_383222 Ga0466707_383222_27245_28399 384
129 3300042609 Ga0466722_175484 Ga0466722_175484_3449_4609 386
130 3300042600 Ga0466700_080920 Ga0466700_080920_8510_9673 387
131 3300042603 Ga0466714_163409 Ga0466714_163409_250_1443 397
132 3300002509 JGI24699J35502_11134139 JGI24699J35502_1113413934 398
133 3300042616 Ga0466715_084050 Ga0466715_084050_2282_3535 417

🧩 MSA Aligner

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.