Protein Family IF10266

Metagenome Isolate
141 Members
88 Samples
108 Scaffolds
183.72 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_003157|Ga0466733_003157_5735_6382
Length
215 aa
Sequence
MMPISSTSPKLVILDRDGTINEDSDHFVKSPEEWIPLPGALQAIARLSQMGWQVVVATNQSGLGRGLFDIVALNAMHEKMKQLLAVEGGRIEAVFFCPHVASDMCHCRKPLPGLFEQIGERFRADLRDVPAVGDSLRDLQAAAAAGAQPHLVRTGKGQQTALRDDLPAGTVIHEDLSHFVDYWLQQQAQLNDGTDLLEEKLRQDALVASRDQRGV

📊 Sample Types

Isolate 23.4%
Metagenome 76.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.0%
Termitidae 17.9%
Formicidae 16.7%
Coreidae 15.5%
Kalotermitidae 9.5%
Culicidae 8.3%
Elmidae 3.6%
Rhinotermitidae 3.6%
Armadillidiidae 2.4%
Hodotermitidae 1.2%
Termopsidae 1.2%
Berytidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
2 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
3 8023757577 Caballeronia peredens LP006 Isolate Coreidae
4 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
5 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
6 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
7 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
10 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
11 8102145433 Caballeronia sp. LP006 Isolate Coreidae
12 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
13 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
14 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
15 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
16 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
23 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
24 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
25 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
28 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2603880165 Burkholderiales A1 Isolate Unclassified
37 2603880170 Burkholderiales A2 Isolate Unclassified
38 2603880172 Burkholderiales C Isolate Unclassified
39 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
40 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
44 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
45 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
46 2864937364 Acidovorax soli S00198 Isolate Elmidae
47 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
48 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
49 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
50 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
51 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
56 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
57 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
58 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
59 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
60 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
61 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
62 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
63 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
64 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
65 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
66 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
67 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
68 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
69 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
70 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
71 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
72 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
73 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
74 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
75 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
76 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
77 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
78 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
79 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
80 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
81 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
82 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
83 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
84 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
85 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
86 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
87 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
88 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_054965 3300042623 Bacteria 58378
2 Ga0466702_398182 3300042635 Bacteria 1565
3 Ga0466725_155815 3300042654 Bacteria 22403
4 Ga0466729_015681 3300042621 Bacteria 43972
5 Ga0466729_147660 3300042621 Bacteria 14768
6 CVPL005L_10000182 3300002938 Bacteria 52318
7 Ga0102740_1000258 3300007140 Unclassified 15056
8 Ga0103264_1005183 3300007188 Bacteria 6178
9 Ga0103268_1100790 3300007192 Bacteria 718
10 Ga0466704_481878 3300042643 Bacteria 4214
11 Ga0466725_061251 3300042654 Bacteria 41948
12 Ga0466701_089860 3300042598 Bacteria 2119
13 Ga0466707_122282 3300042601 Bacteria 11801
14 Ga0466722_069269 3300042609 Bacteria 7749
15 Ga0466718_158112 3300042617 Bacteria 6268
16 Ga0123353_10465472 3300010167 Bacteria 1856
17 Ga0123354_10000011 3300010882 Bacteria 166906
18 Ga0160454_100286 3300012798 Unclassified 43568
19 Ga0160442_100345 3300012806 Bacteria 20896
20 Ga0160442_102535 3300012806 Unclassified 2000
21 Ga0160447_101987 3300012849 Bacteria 7510
22 Ga0466657_106875 3300042582 Bacteria 3354
23 CVPL005W_1000290 3300002934 Bacteria 23148
24 Ga0102737_1000500 3300007142 Bacteria 12775
25 Ga0103264_1022309 3300007188 Bacteria 3057
26 Ga0466734_061146 3300042623 Bacteria 4152
27 Ga0466709_087959 3300042648 Bacteria 13518
28 Ga0466726_170278 3300042619 Bacteria 26200
29 Ga0466729_061556 3300042621 Bacteria 1897
30 Ga0123353_10172660 3300010167 Bacteria 3430
31 CVPL010W_10002342 3300002931 Bacteria 23217
32 CVPL010W_10010421 3300002931 Bacteria 8279
33 Ga0103261_1003184 3300007083 Bacteria 2564
34 Ga0103260_1001578 3300007139 Bacteria 4030
35 Ga0102737_1009309 3300007142 Unclassified 1696
36 Ga0466723_179140 3300042618 Bacteria 23043
37 Ga0123356_10026887 3300010049 Unclassified 5396
38 Ga0123356_10198688 3300010049 Unclassified 2043
39 Ga0160456_100062 3300012820 Bacteria 160272
40 Ga0160472_106238 3300012839 Bacteria 1797
41 Ga0160436_1008249 3300012861 Bacteria 2349
42 CVPL005W_1000164 3300002934 Bacteria 28912
43 Ga0102738_1000175 3300007141 Bacteria 15128
44 Ga0103264_1001861 3300007188 Bacteria 9374
45 Ga0103264_1002224 3300007188 Bacteria 14098
46 Ga0466733_003157 3300042659 Bacteria 6825
47 Ga0466708_431611 3300042652 Bacteria 17147
48 Ga0466725_073293 3300042654 Bacteria 17506
49 Ga0466725_224469 3300042654 Bacteria 3705
50 Ga0466725_279702 3300042654 Bacteria 9622
51 Ga0466706_255684 3300042599 Bacteria 11021
52 Ga0466711_359037 3300042615 Bacteria 49677
53 Ga0466726_206224 3300042619 Bacteria 2253
54 Ga0160447_102087 3300012849 Unclassified 7277
55 Ga0160434_102198 3300012850 Unclassified 3409
56 Ga0466657_108328 3300042582 Bacteria 20292
57 Ga0466657_288832 3300042582 Bacteria 2613
58 CVPL010W_10000642 3300002931 Bacteria 63793
59 CVPL010W_10002361 3300002931 Bacteria 22172
60 Ga0103264_1000167 3300007188 Bacteria 38299
61 Ga0103264_1001163 3300007188 Bacteria 11640
62 Ga0103264_1002826 3300007188 Bacteria 7895
63 Ga0466697_187703 3300042611 Bacteria 2648
64 Ga0466705_236309 3300042612 Bacteria 1399
65 Ga0466704_477248 3300042643 Bacteria 2467
66 Ga0466707_298762 3300042601 Bacteria 1066
67 Ga0466710_131881 3300042613 Bacteria 4045
68 Ga0466715_574611 3300042616 Bacteria 1831
69 Ga0466657_133978 3300042582 Bacteria 2904
70 Ga0466692_135261 3300042591 Bacteria 88396
71 CVPL010W_10009054 3300002931 Bacteria 10119
72 CVPL005L_10000196 3300002938 Unclassified 51126
73 Ga0102739_1006043 3300007095 Bacteria 1639
74 Ga0102737_1003418 3300007142 Unclassified 3631
75 Ga0103264_1000200 3300007188 Bacteria 34676
76 Ga0103268_1000550 3300007192 Bacteria 11219
77 Ga0123357_10000808 3300009784 Bacteria 31648
78 Ga0466704_349948 3300042643 Bacteria 1559
79 Ga0466724_10719 3300042649 Bacteria 2339
80 Ga0466708_251180 3300042652 Bacteria 15531
81 Ga0466725_321110 3300042654 Bacteria 5740
82 Ga0466707_062325 3300042601 Bacteria 2963
83 Ga0466715_143205 3300042616 Bacteria 113538
84 Ga0123353_10011890 3300010167 Bacteria 12309
85 Ga0160470_100139 3300012813 Bacteria 72449
86 Ga0160446_110234 3300012835 Bacteria 1199
87 Ga0160447_111116 3300012849 Bacteria 1925
88 Ga0160448_111828 3300012854 Unclassified 1755
89 Ga0103266_1000826 3300007067 Bacteria 5693
90 Ga0103261_1005167 3300007083 Bacteria 1938
91 Ga0102737_1009389 3300007142 Bacteria 1684
92 Ga0103264_1000121 3300007188 Bacteria 51991
93 Ga0466734_137166 3300042623 Bacteria 5207
94 Ga0466725_293813 3300042654 Bacteria 93076
95 Ga0466706_135596 3300042599 Bacteria 1530
96 Ga0466710_309923 3300042613 Bacteria 3058
97 Ga0123353_10372288 3300010167 Bacteria 2141
98 Ga0160455_100078 3300012837 Bacteria 160114
99 Ga0160472_104506 3300012839 Unclassified 2431
100 Ga0160430_103344 3300012852 Bacteria 4496
101 Ga0466657_011395 3300042582 Bacteria 32120
102 Ga0466691_084271 3300042593 Bacteria 8904
103 Ga0466695_223236 3300042595 Bacteria 5080
104 CVPL010W_10014803 3300002931 Bacteria 5618
105 Ga0072941_1262882 3300005201 Bacteria 1823
106 Ga0102736_1000492 3300007052 Bacteria 7977
107 Ga0103261_1000946 3300007083 Bacteria 4502
108 Ga0103264_1000392 3300007188 Bacteria 23019

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_062325 Ga0466707_062325_2153_2695 174
2 3300042621 Ga0466729_015681 Ga0466729_015681_14224_14766 174
3 3300042652 Ga0466708_251180 Ga0466708_251180_2729_3271 174
4 3300042591 Ga0466692_135261 Ga0466692_135261_6887_7432 175
5 3300042593 Ga0466691_084271 Ga0466691_084271_7211_7756 175
6 3300042615 Ga0466711_359037 Ga0466711_359037_20340_20885 175
7 3300042652 Ga0466708_431611 Ga0466708_431611_8084_8629 175
8 3300042601 Ga0466707_298762 Ga0466707_298762_279_809 176
9 3300042613 Ga0466710_131881 Ga0466710_131881_2133_2663 176
10 3300042621 Ga0466729_061556 Ga0466729_061556_851_1381 176
11 3300042621 Ga0466729_147660 Ga0466729_147660_5024_5554 176
12 3300042654 Ga0466725_279702 Ga0466725_279702_8696_9226 176
13 3300042582 Ga0466657_108328 Ga0466657_108328_18528_19061 177
14 3300042601 Ga0466707_122282 Ga0466707_122282_3709_4242 177
15 3300042611 Ga0466697_187703 Ga0466697_187703_989_1522 177
16 3300042617 Ga0466718_158112 Ga0466718_158112_3729_4262 177
17 3300042623 Ga0466734_137166 Ga0466734_137166_2619_3152 177
18 3300042648 Ga0466709_087959 Ga0466709_087959_12602_13135 177
19 3300042654 Ga0466725_073293 Ga0466725_073293_15641_16174 177
20 3300042654 Ga0466725_293813 Ga0466725_293813_66043_66576 177
21 iso_pr_bacteria 2603880170 2606029791 177
22 iso_pr_bacteria 2687453742 2689987942 177
23 iso_pr_bacteria 2687453753 2690037975 177
24 iso_pr_bacteria 2820089333 2820090753 177
25 iso_pr_bacteria 2820121232 2820122210 177
26 3300002931 CVPL010W_10000642 CVPL010W_100006423 178
27 3300007141 Ga0102738_1000175 Ga0102738_10001753 178
28 3300007142 Ga0102737_1000500 Ga0102737_100050011 178
29 3300007188 Ga0103264_1000167 Ga0103264_10001678 178
30 3300007188 Ga0103264_1001163 Ga0103264_10011636 178
31 3300009784 Ga0123357_10000808 Ga0123357_1000080822 178
32 3300010049 Ga0123356_10026887 Ga0123356_100268873 178
33 3300010167 Ga0123353_10011890 Ga0123353_100118908 178
34 3300010167 Ga0123353_10172660 Ga0123353_101726602 178
35 3300010167 Ga0123353_10465472 Ga0123353_104654722 178
36 3300042595 Ga0466695_223236 Ga0466695_223236_1565_2101 178
37 3300042619 Ga0466726_170278 Ga0466726_170278_9657_10193 178
38 3300042619 Ga0466726_206224 Ga0466726_206224_790_1326 178
39 3300042643 Ga0466704_349948 Ga0466704_349948_265_801 178
40 3300042643 Ga0466704_477248 Ga0466704_477248_1626_2162 178
41 iso_pr_bacteria 2603880165 2606015700 178
42 3300002931 CVPL010W_10002361 CVPL010W_1000236115 179
43 3300007067 Ga0103266_1000826 Ga0103266_10008262 179
44 3300007095 Ga0102739_1006043 Ga0102739_10060432 179
45 3300007188 Ga0103264_1001861 Ga0103264_10018612 179
46 3300007188 Ga0103264_1005183 Ga0103264_10051837 179
47 3300007192 Ga0103268_1100790 Ga0103268_11007902 179
48 3300042598 Ga0466701_089860 Ga0466701_089860_759_1298 179
49 3300042609 Ga0466722_069269 Ga0466722_069269_4232_4771 179
50 iso_pr_bacteria 2603880172 2606034044 179
51 iso_pr_bacteria 2963630348 2963631736 179
52 3300002931 CVPL010W_10009054 CVPL010W_100090546 180
53 3300002931 CVPL010W_10010421 CVPL010W_100104215 180
54 3300002931 CVPL010W_10014803 CVPL010W_100148033 180
55 3300002934 CVPL005W_1000164 CVPL005W_10001649 180
56 3300002938 CVPL005L_10000196 CVPL005L_1000019629 180
57 3300007083 Ga0103261_1003184 Ga0103261_10031842 180
58 3300007083 Ga0103261_1005167 Ga0103261_10051672 180
59 3300007140 Ga0102740_1000258 Ga0102740_10002589 180
60 3300007142 Ga0102737_1003418 Ga0102737_10034182 180
61 3300007142 Ga0102737_1009309 Ga0102737_10093092 180
62 3300007142 Ga0102737_1009389 Ga0102737_10093892 180
63 3300007188 Ga0103264_1000200 Ga0103264_100020018 180
64 3300007188 Ga0103264_1000392 Ga0103264_10003924 180
65 3300007188 Ga0103264_1002826 Ga0103264_10028265 180
66 3300007188 Ga0103264_1022309 Ga0103264_10223093 180
67 3300007192 Ga0103268_1000550 Ga0103268_10005503 180
68 3300012798 Ga0160454_100286 Ga0160454_10028610 180
69 3300012820 Ga0160456_100062 Ga0160456_10006241 180
70 3300012837 Ga0160455_100078 Ga0160455_10007841 180
71 3300007052 Ga0102736_1000492 Ga0102736_10004927 181
72 3300042635 Ga0466702_398182 Ga0466702_398182_653_1198 181
73 iso_pr_bacteria 2820047982 2820048570 181
74 iso_pr_bacteria 2820050117 2820050717 181
75 iso_pr_bacteria 2864808494 2864810974 181
76 iso_pr_bacteria 2864812326 2864815063 181
77 3300002938 CVPL005L_10000182 CVPL005L_1000018234 182
78 3300005201 Ga0072941_1262882 Ga0072941_12628822 182
79 3300007083 Ga0103261_1000946 Ga0103261_10009462 182
80 3300007188 Ga0103264_1000121 Ga0103264_100012148 182
81 3300002931 CVPL010W_10002342 CVPL010W_100023423 183
82 3300007139 Ga0103260_1001578 Ga0103260_10015784 183
83 3300042616 Ga0466715_574611 Ga0466715_574611_143_694 183
84 3300042618 Ga0466723_179140 Ga0466723_179140_9039_9590 183
85 iso_pr_bacteria 8024019580 8024022121 183
86 3300042582 Ga0466657_106875 Ga0466657_106875_1152_1706 184
87 3300042582 Ga0466657_133978 Ga0466657_133978_1848_2402 184
88 3300042613 Ga0466710_309923 Ga0466710_309923_991_1545 184
89 3300042623 Ga0466734_061146 Ga0466734_061146_1563_2117 184
90 iso_pr_bacteria 2820084079 2820085437 184
91 iso_pr_bacteria 2820086750 2820086981 184
92 3300007188 Ga0103264_1002224 Ga0103264_10022243 185
93 3300010167 Ga0123353_10372288 Ga0123353_103722882 185
94 3300042623 Ga0466734_054965 Ga0466734_054965_56536_57093 185
95 3300042654 Ga0466725_155815 Ga0466725_155815_2443_3000 185
96 iso_pr_bacteria 8023724303 8023728519 186
97 iso_pr_bacteria 8023757577 8023761793 186
98 iso_pr_bacteria 8023764196 8023769135 186
99 iso_pr_bacteria 8024001094 8024001477 186
100 iso_pr_bacteria 8025747911 8025748313 186
101 iso_pr_bacteria 8025756023 8025756425 186
102 iso_pr_bacteria 8102041249 8102041622 186
103 iso_pr_bacteria 8102060671 8102061140 186
104 iso_pr_bacteria 8102074813 8102075249 186
105 iso_pr_bacteria 8102087471 8102087913 186
106 iso_pr_bacteria 8102145433 8102149649 186
107 iso_pr_bacteria 8102152052 8102156991 186
108 iso_pr_bacteria 8102161003 8102165215 186
109 3300042654 Ga0466725_224469 Ga0466725_224469_982_1545 187
110 3300042599 Ga0466706_135596 Ga0466706_135596_494_1060 188
111 iso_pr_bacteria 2864937364 2864940631 188
112 3300042599 Ga0466706_255684 Ga0466706_255684_2210_2782 190
113 iso_pr_bacteria 2820071837 2820072534 190
114 3300012839 Ga0160472_104506 Ga0160472_1045062 192
115 3300042582 Ga0466657_288832 Ga0466657_288832_120_698 192
116 3300042654 Ga0466725_321110 Ga0466725_321110_4482_5060 192
117 3300012806 Ga0160442_100345 Ga0160442_10034518 193
118 3300012849 Ga0160447_111116 Ga0160447_1111162 193
119 3300002934 CVPL005W_1000290 CVPL005W_100029016 194
120 3300012839 Ga0160472_106238 Ga0160472_1062382 194
121 3300012852 Ga0160430_103344 Ga0160430_1033443 194
122 iso_pr_bacteria 2820077244 2820077895 194
123 3300010049 Ga0123356_10198688 Ga0123356_101986883 195
124 3300010882 Ga0123354_10000011 Ga0123354_1000001163 195
125 3300042643 Ga0466704_481878 Ga0466704_481878_290_1000 195
126 3300012813 Ga0160470_100139 Ga0160470_10013920 196
127 3300012835 Ga0160446_110234 Ga0160446_1102341 196
128 3300012849 Ga0160447_102087 Ga0160447_1020875 196
129 3300012854 Ga0160448_111828 Ga0160448_1118283 196
130 3300012861 Ga0160436_1008249 Ga0160436_10082492 196
131 3300042616 Ga0466715_143205 Ga0466715_143205_75830_76423 197
132 3300012806 Ga0160442_102535 Ga0160442_1025352 198
133 3300012850 Ga0160434_102198 Ga0160434_1021982 198
134 3300042582 Ga0466657_011395 Ga0466657_011395_27069_27665 198
135 3300012849 Ga0160447_101987 Ga0160447_1019872 199
136 iso_pr_bacteria 2820157249 2820158385 199
137 3300042649 Ga0466724_10719 Ga0466724_10719_1300_1902 200
138 3300042654 Ga0466725_061251 Ga0466725_061251_21101_21703 200
139 iso_pr_bacteria 2820164216 2820166034 200
140 3300042612 Ga0466705_236309 Ga0466705_236309_377_1096 203
141 3300042659 Ga0466733_003157 Ga0466733_003157_5735_6382 215

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13242 Hydrolase_like HAD-hyrolase-like 107 177 0.94
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 31 146 0.87
PF08645 PNK3P Polynucleotide kinase 3 phosphatase 11 124 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.