Protein Family IF10255
Metagenome
Isolate
121
Members
57
Samples
115
Scaffolds
134.86
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_303857|Ga0466732_303857_2474_2956
- Length
- 160 aa
- Sequence
- MIILNKSAKSKQSDTIKGSDMIKEQYKYSELTGKIIGCAMEVHKILGNGFQEVIYQRALEKEMALQGIDFSREHEMPIFYKEEQIGTRRVDFLVENVISVELKALVKIEDVHLAQAINYLEAYNLEIGLLINFGAKSLEFKRLINPKFNQNNQLNQRFRR
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.3%
Kalotermitidae
16.7%
Unclassified
13.0%
Rhinotermitidae
7.4%
Termopsidae
5.6%
Passalidae
3.7%
Formicidae
1.9%
Hodotermitidae
1.9%
Harpacticidae
1.9%
Blattidae
1.9%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 12 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 30 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_314253 | 3300042656 | Bacteria | 2241 |
| 2 | Ga0466733_171304 | 3300042659 | Bacteria | 2748 |
| 3 | Ga0466710_118085 | 3300042613 | Bacteria | 2289 |
| 4 | Ga0466710_159946 | 3300042613 | Unclassified | 2848 |
| 5 | Ga0466726_202493 | 3300042619 | Bacteria | 1321 |
| 6 | Ga0466726_261598 | 3300042619 | Bacteria | 1715 |
| 7 | Ga0466701_028915 | 3300042598 | Bacteria | 1235 |
| 8 | Ga0466722_113249 | 3300042609 | Bacteria | 1330 |
| 9 | Ga0068305_10009647 | 3300005083 | Bacteria | 542 |
| 10 | Ga0123354_10337697 | 3300010882 | Bacteria | 1363 |
| 11 | Ga0466734_145035 | 3300042623 | Bacteria | 1571 |
| 12 | Ga0466735_097115 | 3300042624 | Bacteria | 1316 |
| 13 | Ga0466709_297877 | 3300042648 | Unclassified | 3700 |
| 14 | Ga0466697_137911 | 3300042611 | Bacteria | 2067 |
| 15 | Ga0466733_034905 | 3300042659 | Bacteria | 3384 |
| 16 | Ga0466705_528184 | 3300042612 | Bacteria | 4419 |
| 17 | Ga0466710_216413 | 3300042613 | Bacteria | 1738 |
| 18 | Ga0466712_223638 | 3300042614 | Bacteria | 2338 |
| 19 | Ga0466711_084577 | 3300042615 | Bacteria | 4041 |
| 20 | Ga0466707_320560 | 3300042601 | Bacteria | 3103 |
| 21 | Ga0466713_074871 | 3300042602 | Bacteria | 2569 |
| 22 | Ga0466719_225171 | 3300042606 | Bacteria | 1156 |
| 23 | Ga0466719_525752 | 3300042606 | Bacteria | 1909 |
| 24 | Ga0466721_042526 | 3300042608 | Bacteria | 1471 |
| 25 | Ga0123356_11500773 | 3300010049 | Bacteria | 832 |
| 26 | Ga0123356_13155563 | 3300010049 | Bacteria | 574 |
| 27 | Ga0466696_012749 | 3300042596 | Bacteria | 1372 |
| 28 | Ga0466727_100689 | 3300042655 | Bacteria | 1107 |
| 29 | Ga0466726_101688 | 3300042619 | Bacteria | 5304 |
| 30 | Ga0466701_080416 | 3300042598 | Bacteria | 3383 |
| 31 | Ga0466707_194485 | 3300042601 | Bacteria | 1543 |
| 32 | Ga0466707_275288 | 3300042601 | Bacteria | 11862 |
| 33 | Ga0466714_124068 | 3300042603 | Bacteria | 3662 |
| 34 | JGI24702J35022_10244981 | 3300002462 | Bacteria | 1041 |
| 35 | CVPL010W_10031644 | 3300002931 | Bacteria | 2414 |
| 36 | Ga0123355_10042276 | 3300009826 | Bacteria | 7418 |
| 37 | Ga0123356_13512199 | 3300010049 | Bacteria | 543 |
| 38 | Ga0123353_11824503 | 3300010167 | Unclassified | 754 |
| 39 | Ga0123354_10292068 | 3300010882 | Bacteria | 1560 |
| 40 | Ga0466727_019300 | 3300042655 | Bacteria | 1272 |
| 41 | Ga0466710_278332 | 3300042613 | Bacteria | 3853 |
| 42 | Ga0466728_097535 | 3300042620 | Bacteria | 6820 |
| 43 | Ga0466729_143579 | 3300042621 | Bacteria | 1412 |
| 44 | Ga0466700_309588 | 3300042600 | Bacteria | 264576 |
| 45 | Ga0466707_031862 | 3300042601 | Bacteria | 2668 |
| 46 | Ga0466707_127369 | 3300042601 | Bacteria | 23245 |
| 47 | Ga0466707_171918 | 3300042601 | Bacteria | 1997 |
| 48 | Ga0466717_063232 | 3300042604 | Bacteria | 5116 |
| 49 | Ga0466717_085737 | 3300042604 | Bacteria | 1419 |
| 50 | Ga0466719_493770 | 3300042606 | Bacteria | 16257 |
| 51 | IMNBL1DRAFT_c0105065 | 3300000062 | Bacteria | 755 |
| 52 | JGI24702J35022_10026990 | 3300002462 | Bacteria | 3089 |
| 53 | JGI24702J35022_10791894 | 3300002462 | Unclassified | 590 |
| 54 | Ga0123353_10999904 | 3300010167 | Bacteria | 1124 |
| 55 | Ga0415639_014232 | 3300038395 | Bacteria | 2462 |
| 56 | Ga0466656_360968 | 3300042550 | Bacteria | 2976 |
| 57 | Ga0466691_094010 | 3300042593 | Bacteria | 10845 |
| 58 | Ga0466695_354832 | 3300042595 | Bacteria | 12679 |
| 59 | Ga0466727_172370 | 3300042655 | Bacteria | 4360 |
| 60 | Ga0466726_064894 | 3300042619 | Bacteria | 2911 |
| 61 | Ga0466713_055354 | 3300042602 | Bacteria | 1325 |
| 62 | Ga0466713_127378 | 3300042602 | Bacteria | 2145 |
| 63 | JGI24702J35022_10001815 | 3300002462 | Bacteria | 13143 |
| 64 | JGI24702J35022_10346477 | 3300002462 | Unclassified | 887 |
| 65 | JGI24696J40584_12959554 | 3300002834 | Bacteria | 5286 |
| 66 | Ga0123353_10062084 | 3300010167 | Bacteria | 5993 |
| 67 | Ga0264413_112478 | 3300024493 | Bacteria | 7744 |
| 68 | Ga0466731_193635 | 3300042622 | Bacteria | 1481 |
| 69 | Ga0466703_345566 | 3300042636 | Bacteria | 1748 |
| 70 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 71 | Ga0466732_303857 | 3300042656 | Bacteria | 3676 |
| 72 | Ga0466732_372506 | 3300042656 | Bacteria | 121204 |
| 73 | Ga0466733_042431 | 3300042659 | Bacteria | 2353 |
| 74 | Ga0466715_036039 | 3300042616 | Unclassified | 2880 |
| 75 | Ga0466715_130004 | 3300042616 | Bacteria | 7361 |
| 76 | Ga0466706_010278 | 3300042599 | Bacteria | 8238 |
| 77 | Ga0466714_030140 | 3300042603 | Bacteria | 39149 |
| 78 | Ga0466721_100732 | 3300042608 | Bacteria | 1712 |
| 79 | Ga0466698_202491 | 3300042610 | Bacteria | 1710 |
| 80 | Ga0466697_010612 | 3300042611 | Bacteria | 1402 |
| 81 | Ga0466697_033449 | 3300042611 | Bacteria | 1286 |
| 82 | IMNBGM34_c002047 | 3300000036 | Bacteria | 3083 |
| 83 | Ga0123356_12377772 | 3300010049 | Bacteria | 663 |
| 84 | Ga0123353_10003486 | 3300010167 | Bacteria | 19883 |
| 85 | Ga0466725_201997 | 3300042654 | Bacteria | 1769 |
| 86 | Ga0466697_167196 | 3300042611 | Bacteria | 1294 |
| 87 | Ga0466726_265486 | 3300042619 | Unclassified | 2778 |
| 88 | Ga0466722_095711 | 3300042609 | Bacteria | 9734 |
| 89 | TM1208_contig107835 | 2021593000 | Bacteria | 848 |
| 90 | JGI24702J35022_10000657 | 3300002462 | Bacteria | 20976 |
| 91 | JGI24696J40584_12801124 | 3300002834 | Unclassified | 870 |
| 92 | Ga0123356_10328300 | 3300010049 | Bacteria | 1645 |
| 93 | Ga0123353_10088474 | 3300010167 | Bacteria | 4988 |
| 94 | Ga0160465_100328 | 3300012803 | Bacteria | 28159 |
| 95 | Ga0456237_0054729 | 3300041968 | Bacteria | 518 |
| 96 | Ga0466692_174528 | 3300042591 | Bacteria | 2859 |
| 97 | Ga0466734_063377 | 3300042623 | Bacteria | 1587 |
| 98 | Ga0466697_087784 | 3300042611 | Bacteria | 15141 |
| 99 | Ga0466733_165287 | 3300042659 | Bacteria | 2725 |
| 100 | Ga0466710_370303 | 3300042613 | Bacteria | 2628 |
| 101 | Ga0466712_277466 | 3300042614 | Unclassified | 2773 |
| 102 | Ga0466701_021604 | 3300042598 | Bacteria | 3200 |
| 103 | Ga0466707_095236 | 3300042601 | Bacteria | 11193 |
| 104 | Ga0466713_031913 | 3300042602 | Bacteria | 2799 |
| 105 | Ga0466722_187022 | 3300042609 | Bacteria | 1847 |
| 106 | Ga0072941_1266368 | 3300005201 | Bacteria | 5005 |
| 107 | Ga0123355_10031153 | 3300009826 | Bacteria | 8652 |
| 108 | Ga0123356_10022822 | 3300010049 | Bacteria | 5903 |
| 109 | Ga0123356_10147916 | 3300010049 | Bacteria | 2327 |
| 110 | Ga0123356_11127645 | 3300010049 | Unclassified | 952 |
| 111 | Ga0466657_019158 | 3300042582 | Bacteria | 1709 |
| 112 | Ga0466657_033000 | 3300042582 | Bacteria | 1634 |
| 113 | Ga0466702_269729 | 3300042635 | Bacteria | 1456 |
| 114 | Ga0466703_304490 | 3300042636 | Bacteria | 1001 |
| 115 | Ga0466709_122380 | 3300042648 | Bacteria | 1747 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_014232 | Ga0415639_014232_186_572 | 128 |
| 2 | 3300042604 | Ga0466717_063232 | Ga0466717_063232_287_673 | 128 |
| 3 | 3300042611 | Ga0466697_087784 | Ga0466697_087784_1986_2372 | 128 |
| 4 | 3300042613 | Ga0466710_216413 | Ga0466710_216413_348_734 | 128 |
| 5 | 3300042614 | Ga0466712_223638 | Ga0466712_223638_1807_2193 | 128 |
| 6 | 3300042614 | Ga0466712_277466 | Ga0466712_277466_821_1207 | 128 |
| 7 | 3300042622 | Ga0466731_193635 | Ga0466731_193635_245_631 | 128 |
| 8 | 3300002834 | JGI24696J40584_12801124 | JGI24696J40584_128011242 | 129 |
| 9 | 3300002834 | JGI24696J40584_12959554 | JGI24696J40584_129595542 | 129 |
| 10 | 3300009826 | Ga0123355_10031153 | Ga0123355_100311537 | 129 |
| 11 | 3300010167 | Ga0123353_10999904 | Ga0123353_109999042 | 129 |
| 12 | 3300010882 | Ga0123354_10292068 | Ga0123354_102920683 | 129 |
| 13 | 3300042615 | Ga0466711_084577 | Ga0466711_084577_2030_2419 | 129 |
| 14 | 3300042648 | Ga0466709_122380 | Ga0466709_122380_946_1335 | 129 |
| 15 | 3300042648 | Ga0466709_297877 | Ga0466709_297877_223_612 | 129 |
| 16 | 3300002462 | JGI24702J35022_10791894 | JGI24702J35022_107918941 | 130 |
| 17 | 3300042550 | Ga0466656_360968 | Ga0466656_360968_956_1348 | 130 |
| 18 | 3300042598 | Ga0466701_028915 | Ga0466701_028915_738_1130 | 130 |
| 19 | 3300042601 | Ga0466707_275288 | Ga0466707_275288_7763_8155 | 130 |
| 20 | 3300042601 | Ga0466707_320560 | Ga0466707_320560_2391_2783 | 130 |
| 21 | 3300042602 | Ga0466713_074871 | Ga0466713_074871_1700_2092 | 130 |
| 22 | 3300042611 | Ga0466697_010612 | Ga0466697_010612_207_599 | 130 |
| 23 | 3300042611 | Ga0466697_096879 | Ga0466697_096879_271958_272350 | 130 |
| 24 | 3300042611 | Ga0466697_167196 | Ga0466697_167196_463_900 | 130 |
| 25 | 3300042613 | Ga0466710_118085 | Ga0466710_118085_131_523 | 130 |
| 26 | 3300042613 | Ga0466710_159946 | Ga0466710_159946_753_1145 | 130 |
| 27 | 3300042619 | Ga0466726_101688 | Ga0466726_101688_13_405 | 130 |
| 28 | 3300042623 | Ga0466734_145035 | Ga0466734_145035_411_803 | 130 |
| 29 | 3300042655 | Ga0466727_019300 | Ga0466727_019300_208_600 | 130 |
| 30 | iso_pr_bacteria | 2820737921 | 2820737993 | 130 |
| 31 | iso_pr_bacteria | 2820770630 | 2820772306 | 130 |
| 32 | iso_pr_bacteria | 2820792843 | 2820793433 | 130 |
| 33 | iso_pr_bacteria | 2820792843 | 2820793515 | 130 |
| 34 | iso_pr_bacteria | 2820795054 | 2820797451 | 130 |
| 35 | 3300002462 | JGI24702J35022_10000657 | JGI24702J35022_100006575 | 131 |
| 36 | 3300002462 | JGI24702J35022_10244981 | JGI24702J35022_102449812 | 131 |
| 37 | 3300009826 | Ga0123355_10042276 | Ga0123355_100422767 | 131 |
| 38 | 3300010049 | Ga0123356_10022822 | Ga0123356_100228223 | 131 |
| 39 | 3300010167 | Ga0123353_10003486 | Ga0123353_100034867 | 131 |
| 40 | 3300012803 | Ga0160465_100328 | Ga0160465_1003281 | 131 |
| 41 | 3300041968 | Ga0456237_0054729 | Ga0456237_0054729_74_469 | 131 |
| 42 | 3300042595 | Ga0466695_354832 | Ga0466695_354832_6716_7111 | 131 |
| 43 | 3300042598 | Ga0466701_080416 | Ga0466701_080416_892_1287 | 131 |
| 44 | 3300042602 | Ga0466713_055354 | Ga0466713_055354_257_652 | 131 |
| 45 | 3300042609 | Ga0466722_113249 | Ga0466722_113249_466_861 | 131 |
| 46 | 3300042609 | Ga0466722_187022 | Ga0466722_187022_1394_1789 | 131 |
| 47 | 3300042610 | Ga0466698_202491 | Ga0466698_202491_99_494 | 131 |
| 48 | 3300042611 | Ga0466697_033449 | Ga0466697_033449_357_752 | 131 |
| 49 | 3300042619 | Ga0466726_064894 | Ga0466726_064894_411_806 | 131 |
| 50 | 3300042619 | Ga0466726_202493 | Ga0466726_202493_608_1003 | 131 |
| 51 | 3300042635 | Ga0466702_269729 | Ga0466702_269729_888_1283 | 131 |
| 52 | 3300042656 | Ga0466732_372506 | Ga0466732_372506_50184_50579 | 131 |
| 53 | iso_pr_bacteria | 2940195863 | 2940197666 | 131 |
| 54 | 3300000036 | IMNBGM34_c002047 | IMNBGM34_0020471 | 132 |
| 55 | 3300002931 | CVPL010W_10031644 | CVPL010W_100316442 | 132 |
| 56 | 3300005201 | Ga0072941_1266368 | Ga0072941_12663681 | 132 |
| 57 | 3300010049 | Ga0123356_11127645 | Ga0123356_111276452 | 132 |
| 58 | 3300010049 | Ga0123356_11500773 | Ga0123356_115007732 | 132 |
| 59 | 3300010167 | Ga0123353_10088474 | Ga0123353_100884744 | 132 |
| 60 | 3300010167 | Ga0123353_11824503 | Ga0123353_118245032 | 132 |
| 61 | 3300042596 | Ga0466696_012749 | Ga0466696_012749_937_1335 | 132 |
| 62 | 3300042613 | Ga0466710_278332 | Ga0466710_278332_2651_3049 | 132 |
| 63 | 3300042619 | Ga0466726_261598 | Ga0466726_261598_389_787 | 132 |
| 64 | 3300042623 | Ga0466734_063377 | Ga0466734_063377_129_527 | 132 |
| 65 | 3300042636 | Ga0466703_304490 | Ga0466703_304490_309_707 | 132 |
| 66 | 3300042655 | Ga0466727_172370 | Ga0466727_172370_3805_4203 | 132 |
| 67 | 3300042659 | Ga0466733_034905 | Ga0466733_034905_957_1355 | 132 |
| 68 | 3300042582 | Ga0466657_019158 | Ga0466657_019158_1228_1629 | 133 |
| 69 | 3300042582 | Ga0466657_033000 | Ga0466657_033000_422_823 | 133 |
| 70 | 3300042601 | Ga0466707_095236 | Ga0466707_095236_3945_4346 | 133 |
| 71 | 3300042601 | Ga0466707_127369 | Ga0466707_127369_10248_10649 | 133 |
| 72 | 3300042603 | Ga0466714_124068 | Ga0466714_124068_3061_3462 | 133 |
| 73 | 3300042606 | Ga0466719_493770 | Ga0466719_493770_3343_3744 | 133 |
| 74 | 3300042621 | Ga0466729_143579 | Ga0466729_143579_764_1165 | 133 |
| 75 | 3300042659 | Ga0466733_042431 | Ga0466733_042431_374_775 | 133 |
| 76 | 3300002462 | JGI24702J35022_10001815 | JGI24702J35022_1000181510 | 134 |
| 77 | 3300002462 | JGI24702J35022_10346477 | JGI24702J35022_103464772 | 134 |
| 78 | 3300042601 | Ga0466707_031862 | Ga0466707_031862_989_1393 | 134 |
| 79 | 3300042611 | Ga0466697_137911 | Ga0466697_137911_1238_1642 | 134 |
| 80 | 3300042620 | Ga0466728_097535 | Ga0466728_097535_4303_4707 | 134 |
| 81 | 3300010049 | Ga0123356_10328300 | Ga0123356_103283002 | 135 |
| 82 | 3300042591 | Ga0466692_174528 | Ga0466692_174528_32_439 | 135 |
| 83 | 3300042600 | Ga0466700_309588 | Ga0466700_309588_127886_128293 | 135 |
| 84 | 3300042608 | Ga0466721_100732 | Ga0466721_100732_1262_1669 | 135 |
| 85 | 3300042636 | Ga0466703_345566 | Ga0466703_345566_1130_1537 | 135 |
| 86 | 3300042659 | Ga0466733_165287 | Ga0466733_165287_192_599 | 135 |
| 87 | 3300042604 | Ga0466717_085737 | Ga0466717_085737_589_999 | 136 |
| 88 | 3300042606 | Ga0466719_225171 | Ga0466719_225171_507_917 | 136 |
| 89 | 3300002462 | JGI24702J35022_10026990 | JGI24702J35022_100269902 | 137 |
| 90 | 3300042612 | Ga0466705_528184 | Ga0466705_528184_2787_3200 | 137 |
| 91 | 3300005083 | Ga0068305_10009647 | Ga0068305_100096471 | 138 |
| 92 | 3300010049 | Ga0123356_10147916 | Ga0123356_101479161 | 138 |
| 93 | 3300010049 | Ga0123356_12377772 | Ga0123356_123777721 | 138 |
| 94 | 2021593000 | TM1208_contig107835 | TM1208A_803460 | 139 |
| 95 | 3300010167 | Ga0123353_10062084 | Ga0123353_100620845 | 139 |
| 96 | 3300042598 | Ga0466701_021604 | Ga0466701_021604_1339_1758 | 139 |
| 97 | 3300042656 | Ga0466732_314253 | Ga0466732_314253_250_669 | 139 |
| 98 | 3300010049 | Ga0123356_13155563 | Ga0123356_131555631 | 140 |
| 99 | 3300042599 | Ga0466706_010278 | Ga0466706_010278_2580_3026 | 140 |
| 100 | 3300024493 | Ga0264413_112478 | Ga0264413_1124784 | 142 |
| 101 | 3300010049 | Ga0123356_13512199 | Ga0123356_135121991 | 143 |
| 102 | 3300042602 | Ga0466713_127378 | Ga0466713_127378_1411_1890 | 143 |
| 103 | 3300042613 | Ga0466710_370303 | Ga0466710_370303_786_1217 | 143 |
| 104 | 3300042659 | Ga0466733_171304 | Ga0466733_171304_2040_2471 | 143 |
| 105 | 3300010882 | Ga0123354_10337697 | Ga0123354_103376972 | 144 |
| 106 | 3300042593 | Ga0466691_094010 | Ga0466691_094010_7837_8271 | 144 |
| 107 | 3300042601 | Ga0466707_194485 | Ga0466707_194485_496_930 | 144 |
| 108 | 3300042609 | Ga0466722_095711 | Ga0466722_095711_4767_5201 | 144 |
| 109 | 3300042602 | Ga0466713_031913 | Ga0466713_031913_801_1238 | 145 |
| 110 | 3300042603 | Ga0466714_030140 | Ga0466714_030140_9132_9569 | 145 |
| 111 | 3300042654 | Ga0466725_201997 | Ga0466725_201997_406_843 | 145 |
| 112 | 3300000062 | IMNBL1DRAFT_c0105065 | IMNBL1DRAFT_01050651 | 146 |
| 113 | 3300042606 | Ga0466719_525752 | Ga0466719_525752_602_1048 | 148 |
| 114 | 3300042608 | Ga0466721_042526 | Ga0466721_042526_104_553 | 149 |
| 115 | 3300042616 | Ga0466715_130004 | Ga0466715_130004_6578_7030 | 150 |
| 116 | 3300042616 | Ga0466715_036039 | Ga0466715_036039_2068_2523 | 151 |
| 117 | 3300042624 | Ga0466735_097115 | Ga0466735_097115_562_1020 | 152 |
| 118 | 3300042601 | Ga0466707_171918 | Ga0466707_171918_226_690 | 154 |
| 119 | 3300042619 | Ga0466726_265486 | Ga0466726_265486_573_1037 | 154 |
| 120 | 3300042655 | Ga0466727_100689 | Ga0466727_100689_87_551 | 154 |
| 121 | 3300042656 | Ga0466732_303857 | Ga0466732_303857_2474_2956 | 160 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13366 | PDDEXK_3 | PD-(D/E)XK nuclease superfamily | 30 | 142 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.