Protein Family IF10250
Metagenome
Isolate
144
Members
63
Samples
130
Scaffolds
60.56
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_236153|Ga0466732_236153_1232_1423
- Length
- 63 aa
- Sequence
- MAHPKHRISKQRRDKRRTHYKAVMPTLAKCSNPSCGATVIYHRVCPECGYYRGRLVIDKQVSA
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.4%
Unclassified
24.6%
Kalotermitidae
23.0%
Termopsidae
6.6%
Passalidae
4.9%
Rhinotermitidae
3.3%
Blattidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
2
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 4 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 5 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 12 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 13 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 14 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 24 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 32 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 33 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 39 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 40 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 50 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 51 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 52 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 53 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_104194 | 3300042624 | Bacteria | 22324 |
| 2 | Ga0466704_029588 | 3300042643 | Bacteria | 14720 |
| 3 | Ga0265387_1002132 | 3300024582 | Unclassified | 2808 |
| 4 | Ga0466691_039793 | 3300042593 | Bacteria | 13926 |
| 5 | Ga0466691_133902 | 3300042593 | Bacteria | 22965 |
| 6 | Ga0466723_015244 | 3300042618 | Bacteria | 8372 |
| 7 | Ga0466726_233590 | 3300042619 | Bacteria | 2561 |
| 8 | Ga0466713_026408 | 3300042602 | Bacteria | 14262 |
| 9 | Ga0466713_036279 | 3300042602 | Bacteria | 3948 |
| 10 | Ga0466714_066203 | 3300042603 | Bacteria | 5511 |
| 11 | Ga0466721_106637 | 3300042608 | Unclassified | 4308 |
| 12 | Ga0466722_121463 | 3300042609 | Bacteria | 39019 |
| 13 | Ga0123356_11085752 | 3300010049 | Unclassified | 969 |
| 14 | Ga0123353_10430983 | 3300010167 | Bacteria | 1950 |
| 15 | IMNBL1DRAFT_c0154594 | 3300000062 | Bacteria | 587 |
| 16 | Ga0466705_142903 | 3300042612 | Bacteria | 4259 |
| 17 | Ga0466705_268305 | 3300042612 | Bacteria | 2149 |
| 18 | Ga0466732_236153 | 3300042656 | Bacteria | 5856 |
| 19 | Ga0466727_004530 | 3300042655 | Bacteria | 8756 |
| 20 | Ga0466690_005619 | 3300042590 | Bacteria | 4747 |
| 21 | Ga0466728_191715 | 3300042620 | Bacteria | 3899 |
| 22 | Ga0466714_057600 | 3300042603 | Bacteria | 1841 |
| 23 | Ga0466714_121213 | 3300042603 | Unclassified | 1326 |
| 24 | Ga0466714_140679 | 3300042603 | Bacteria | 2906 |
| 25 | Ga0466721_044220 | 3300042608 | Unclassified | 1245 |
| 26 | Ga0123356_10109936 | 3300010049 | Bacteria | 2661 |
| 27 | Ga0123353_10912208 | 3300010167 | Bacteria | 1194 |
| 28 | Ga0123353_12714102 | 3300010167 | Unclassified | 583 |
| 29 | Ga0072940_1478442 | 3300005200 | Bacteria | 941 |
| 30 | Ga0466705_173938 | 3300042612 | Bacteria | 8520 |
| 31 | Ga0466734_160359 | 3300042623 | Bacteria | 1663 |
| 32 | Ga0466703_063738 | 3300042636 | Bacteria | 4228 |
| 33 | Ga0466692_091255 | 3300042591 | Bacteria | 6922 |
| 34 | Ga0466694_108313 | 3300042594 | Bacteria | 1629 |
| 35 | Ga0466696_052446 | 3300042596 | Unclassified | 1708 |
| 36 | Ga0466696_161539 | 3300042596 | Bacteria | 37941 |
| 37 | Ga0466723_173534 | 3300042618 | Bacteria | 3057 |
| 38 | Ga0466726_309121 | 3300042619 | Bacteria | 8007 |
| 39 | Ga0466707_011046 | 3300042601 | Bacteria | 17469 |
| 40 | Ga0466713_065007 | 3300042602 | Unclassified | 39419 |
| 41 | Ga0466719_352394 | 3300042606 | Bacteria | 20000 |
| 42 | Ga0466722_133379 | 3300042609 | Bacteria | 3111 |
| 43 | Ga0123353_10036193 | 3300010167 | Unclassified | 7731 |
| 44 | Ga0123353_10163177 | 3300010167 | Bacteria | 3545 |
| 45 | Ga0123353_10371900 | 3300010167 | Bacteria | 2142 |
| 46 | 2227474627 | 2225789004 | Bacteria | 22841 |
| 47 | IMNBL1DRAFT_c0006902 | 3300000062 | Bacteria | 6089 |
| 48 | IMNBL1DRAFT_c0013159 | 3300000062 | Bacteria | 3732 |
| 49 | IMNBL1DRAFT_c0021599 | 3300000062 | Unclassified | 2571 |
| 50 | Ga0068302_10121878 | 3300005071 | Bacteria | 4513 |
| 51 | Ga0072941_1406359 | 3300005201 | Bacteria | 620 |
| 52 | Ga0466734_036815 | 3300042623 | Bacteria | 1649 |
| 53 | Ga0466703_107763 | 3300042636 | Bacteria | 4894 |
| 54 | Ga0466703_151392 | 3300042636 | Bacteria | 5426 |
| 55 | Ga0466728_203966 | 3300042620 | Bacteria | 27980 |
| 56 | Ga0466714_038683 | 3300042603 | Bacteria | 9407 |
| 57 | Ga0466714_079106 | 3300042603 | Bacteria | 2513 |
| 58 | Ga0466722_104828 | 3300042609 | Bacteria | 47798 |
| 59 | Ga0123357_10053426 | 3300009784 | Bacteria | 5451 |
| 60 | Ga0123356_10002511 | 3300010049 | Bacteria | 19598 |
| 61 | Ga0123354_10491641 | 3300010882 | Bacteria | 963 |
| 62 | JGI24702J35022_10046783 | 3300002462 | Bacteria | 2303 |
| 63 | JGI24702J35022_10061971 | 3300002462 | Archaea | 2002 |
| 64 | Ga0466732_194253 | 3300042656 | Archaea | 3762 |
| 65 | Ga0466733_005868 | 3300042659 | Bacteria | 5908 |
| 66 | Ga0466733_151490 | 3300042659 | Unclassified | 5487 |
| 67 | Ga0466696_004598 | 3300042596 | Bacteria | 1896 |
| 68 | Ga0466696_267649 | 3300042596 | Bacteria | 36863 |
| 69 | Ga0466715_019987 | 3300042616 | Bacteria | 10256 |
| 70 | Ga0466706_107416 | 3300042599 | Bacteria | 1381 |
| 71 | Ga0466717_145701 | 3300042604 | Unclassified | 1779 |
| 72 | Ga0466716_496909 | 3300042605 | Bacteria | 1676 |
| 73 | Ga0123356_13419545 | 3300010049 | Bacteria | 551 |
| 74 | 2227662392 | 2225789004 | Bacteria | 1942 |
| 75 | JGI24702J35022_10004868 | 3300002462 | Bacteria | 7925 |
| 76 | JGI24696J40584_12913745 | 3300002834 | Unclassified | 1279 |
| 77 | JGI24696J40584_12956144 | 3300002834 | Bacteria | 3019 |
| 78 | Ga0072941_1101907 | 3300005201 | Bacteria | 5937 |
| 79 | Ga0466733_026577 | 3300042659 | Bacteria | 2694 |
| 80 | Ga0466733_059458 | 3300042659 | Bacteria | 3860 |
| 81 | Ga0466703_264349 | 3300042636 | Bacteria | 5399 |
| 82 | Ga0466704_393805 | 3300042643 | Bacteria | 3642 |
| 83 | Ga0466708_023754 | 3300042652 | Bacteria | 11434 |
| 84 | Ga0466690_033942 | 3300042590 | Bacteria | 9521 |
| 85 | Ga0466690_054885 | 3300042590 | Unclassified | 6142 |
| 86 | Ga0466690_161436 | 3300042590 | Bacteria | 18447 |
| 87 | Ga0466692_097174 | 3300042591 | Bacteria | 2768 |
| 88 | Ga0466694_032883 | 3300042594 | Bacteria | 4402 |
| 89 | Ga0466695_042296 | 3300042595 | Unclassified | 1049 |
| 90 | Ga0466699_099319 | 3300042597 | Bacteria | 2449 |
| 91 | Ga0466699_363662 | 3300042597 | Bacteria | 1791 |
| 92 | Ga0466723_331586 | 3300042618 | Bacteria | 1955 |
| 93 | Ga0466714_030193 | 3300042603 | Unclassified | 1489 |
| 94 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 95 | Ga0123353_10000851 | 3300010167 | Bacteria | 37039 |
| 96 | Ga0068302_10015426 | 3300005071 | Bacteria | 2957 |
| 97 | Ga0466731_025411 | 3300042622 | Bacteria | 4825 |
| 98 | Ga0466735_132214 | 3300042624 | Bacteria | 7779 |
| 99 | Ga0466703_285845 | 3300042636 | Bacteria | 8214 |
| 100 | Ga0466708_112247 | 3300042652 | Bacteria | 22986 |
| 101 | Ga0466690_019048 | 3300042590 | Bacteria | 5092 |
| 102 | Ga0466693_164101 | 3300042592 | Bacteria | 2165 |
| 103 | Ga0466691_032860 | 3300042593 | Bacteria | 14161 |
| 104 | Ga0466696_088250 | 3300042596 | Bacteria | 14183 |
| 105 | Ga0466728_409675 | 3300042620 | Bacteria | 5348 |
| 106 | Ga0466713_129716 | 3300042602 | Bacteria | 104954 |
| 107 | Ga0466714_005721 | 3300042603 | Unclassified | 3251 |
| 108 | Ga0466714_059803 | 3300042603 | Bacteria | 1485 |
| 109 | Ga0466722_136953 | 3300042609 | Bacteria | 4021 |
| 110 | Ga0466698_203257 | 3300042610 | Bacteria | 2185 |
| 111 | Ga0123353_10035088 | 3300010167 | Bacteria | 7839 |
| 112 | 2226996482 | 2225789003 | Bacteria | 1421 |
| 113 | IMNBL1DRAFT_c0013871 | 3300000062 | Bacteria | 3589 |
| 114 | JGI24705J35276_12205290 | 3300002504 | Bacteria | 1694 |
| 115 | JGI24705J35276_12235551 | 3300002504 | Bacteria | 6665 |
| 116 | Ga0466697_070114 | 3300042611 | Bacteria | 1025 |
| 117 | Ga0466709_357139 | 3300042648 | Bacteria | 20345 |
| 118 | Ga0466708_127923 | 3300042652 | Bacteria | 5041 |
| 119 | Ga0265387_1005506 | 3300024582 | Bacteria | 1707 |
| 120 | Ga0466691_047346 | 3300042593 | Bacteria | 83606 |
| 121 | Ga0466694_102248 | 3300042594 | Bacteria | 4152 |
| 122 | Ga0466694_172714 | 3300042594 | Bacteria | 1356 |
| 123 | Ga0466696_221256 | 3300042596 | Bacteria | 1134 |
| 124 | Ga0466696_294131 | 3300042596 | Bacteria | 14401 |
| 125 | Ga0466711_174020 | 3300042615 | Bacteria | 3993 |
| 126 | Ga0466714_039970 | 3300042603 | Bacteria | 7086 |
| 127 | Ga0466714_081778 | 3300042603 | Bacteria | 32952 |
| 128 | Ga0123354_10235507 | 3300010882 | Unclassified | 1901 |
| 129 | JGI24702J35022_10002590 | 3300002462 | Bacteria | 10992 |
| 130 | JGI24696J40584_12866950 | 3300002834 | Unclassified | 1031 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820736622 | 2820737597 | 55 |
| 2 | 3300002462 | JGI24702J35022_10004868 | JGI24702J35022_100048686 | 56 |
| 3 | 3300042593 | Ga0466691_039793 | Ga0466691_039793_793_966 | 57 |
| 4 | 2225789003 | 2226996482 | 2227348786 | 59 |
| 5 | 3300042590 | Ga0466690_033942 | Ga0466690_033942_9320_9499 | 59 |
| 6 | 3300042590 | Ga0466690_054885 | Ga0466690_054885_10_189 | 59 |
| 7 | 3300042593 | Ga0466691_032860 | Ga0466691_032860_781_960 | 59 |
| 8 | 3300042594 | Ga0466694_102248 | Ga0466694_102248_2900_3079 | 59 |
| 9 | 3300042594 | Ga0466694_108313 | Ga0466694_108313_1353_1532 | 59 |
| 10 | 3300042594 | Ga0466694_172714 | Ga0466694_172714_753_932 | 59 |
| 11 | 3300042596 | Ga0466696_052446 | Ga0466696_052446_699_878 | 59 |
| 12 | 3300042596 | Ga0466696_088250 | Ga0466696_088250_12384_12563 | 59 |
| 13 | 3300042596 | Ga0466696_221256 | Ga0466696_221256_831_1010 | 59 |
| 14 | 3300042597 | Ga0466699_099319 | Ga0466699_099319_2208_2387 | 59 |
| 15 | 3300042611 | Ga0466697_070114 | Ga0466697_070114_136_315 | 59 |
| 16 | 3300042612 | Ga0466705_142903 | Ga0466705_142903_3146_3325 | 59 |
| 17 | 3300042615 | Ga0466711_174020 | Ga0466711_174020_321_500 | 59 |
| 18 | 3300042618 | Ga0466723_173534 | Ga0466723_173534_717_896 | 59 |
| 19 | 3300042636 | Ga0466703_107763 | Ga0466703_107763_37_216 | 59 |
| 20 | 3300042643 | Ga0466704_393805 | Ga0466704_393805_2214_2393 | 59 |
| 21 | 3300042648 | Ga0466709_357139 | Ga0466709_357139_9462_9641 | 59 |
| 22 | 3300042652 | Ga0466708_112247 | Ga0466708_112247_16136_16315 | 59 |
| 23 | 3300042656 | Ga0466732_194253 | Ga0466732_194253_2224_2403 | 59 |
| 24 | 2225789004 | 2227474627 | 2227925055 | 60 |
| 25 | 3300000062 | IMNBL1DRAFT_c0013871 | IMNBL1DRAFT_00138717 | 60 |
| 26 | 3300000062 | IMNBL1DRAFT_c0021599 | IMNBL1DRAFT_00215993 | 60 |
| 27 | 3300005071 | Ga0068302_10121878 | Ga0068302_101218783 | 60 |
| 28 | 3300005201 | Ga0072941_1406359 | Ga0072941_14063592 | 60 |
| 29 | 3300010049 | Ga0123356_13419545 | Ga0123356_134195451 | 60 |
| 30 | 3300010167 | Ga0123353_10163177 | Ga0123353_101631774 | 60 |
| 31 | 3300010167 | Ga0123353_10430983 | Ga0123353_104309832 | 60 |
| 32 | 3300010167 | Ga0123353_12714102 | Ga0123353_127141021 | 60 |
| 33 | 3300010882 | Ga0123354_10491641 | Ga0123354_104916412 | 60 |
| 34 | 3300024582 | Ga0265387_1002132 | Ga0265387_10021322 | 60 |
| 35 | 3300024582 | Ga0265387_1005506 | Ga0265387_10055062 | 60 |
| 36 | 3300042596 | Ga0466696_294131 | Ga0466696_294131_12142_12324 | 60 |
| 37 | 3300042597 | Ga0466699_363662 | Ga0466699_363662_480_662 | 60 |
| 38 | 3300042599 | Ga0466706_107416 | Ga0466706_107416_669_851 | 60 |
| 39 | 3300042603 | Ga0466714_005721 | Ga0466714_005721_2035_2217 | 60 |
| 40 | 3300042603 | Ga0466714_030193 | Ga0466714_030193_1199_1381 | 60 |
| 41 | 3300042603 | Ga0466714_038683 | Ga0466714_038683_6042_6224 | 60 |
| 42 | 3300042603 | Ga0466714_039970 | Ga0466714_039970_993_1175 | 60 |
| 43 | 3300042603 | Ga0466714_057600 | Ga0466714_057600_1072_1254 | 60 |
| 44 | 3300042603 | Ga0466714_059803 | Ga0466714_059803_657_839 | 60 |
| 45 | 3300042603 | Ga0466714_066203 | Ga0466714_066203_1628_1810 | 60 |
| 46 | 3300042603 | Ga0466714_079106 | Ga0466714_079106_2298_2480 | 60 |
| 47 | 3300042603 | Ga0466714_081778 | Ga0466714_081778_21971_22153 | 60 |
| 48 | 3300042603 | Ga0466714_121213 | Ga0466714_121213_292_474 | 60 |
| 49 | 3300042603 | Ga0466714_140679 | Ga0466714_140679_498_680 | 60 |
| 50 | 3300042619 | Ga0466726_233590 | Ga0466726_233590_1661_1843 | 60 |
| 51 | 3300042619 | Ga0466726_309121 | Ga0466726_309121_849_1031 | 60 |
| 52 | 3300042620 | Ga0466728_409675 | Ga0466728_409675_3797_3979 | 60 |
| 53 | 3300042623 | Ga0466734_160359 | Ga0466734_160359_1137_1319 | 60 |
| 54 | 3300042636 | Ga0466703_063738 | Ga0466703_063738_1299_1481 | 60 |
| 55 | 3300042636 | Ga0466703_264349 | Ga0466703_264349_3496_3678 | 60 |
| 56 | 3300042659 | Ga0466733_005868 | Ga0466733_005868_4475_4657 | 60 |
| 57 | 3300042659 | Ga0466733_026577 | Ga0466733_026577_340_522 | 60 |
| 58 | 3300042659 | Ga0466733_059458 | Ga0466733_059458_1513_1695 | 60 |
| 59 | 3300042659 | Ga0466733_151490 | Ga0466733_151490_1269_1451 | 60 |
| 60 | iso_pr_bacteria | 2820740053 | 2820740611 | 60 |
| 61 | iso_pr_bacteria | 2820748953 | 2820749602 | 60 |
| 62 | iso_pr_bacteria | 2820767225 | 2820767599 | 60 |
| 63 | iso_pr_bacteria | 2820768849 | 2820769264 | 60 |
| 64 | iso_pr_bacteria | 2820772500 | 2820773120 | 60 |
| 65 | iso_pr_bacteria | 2820774381 | 2820774452 | 60 |
| 66 | iso_pr_bacteria | 2820776227 | 2820778419 | 60 |
| 67 | iso_pr_bacteria | 2820781750 | 2820782063 | 60 |
| 68 | 2225789004 | 2227662392 | 2228263578 | 61 |
| 69 | 3300000062 | IMNBL1DRAFT_c0006902 | IMNBL1DRAFT_00069026 | 61 |
| 70 | 3300000062 | IMNBL1DRAFT_c0013159 | IMNBL1DRAFT_00131593 | 61 |
| 71 | 3300000062 | IMNBL1DRAFT_c0154594 | IMNBL1DRAFT_01545942 | 61 |
| 72 | 3300002462 | JGI24702J35022_10046783 | JGI24702J35022_100467832 | 61 |
| 73 | 3300002504 | JGI24705J35276_12235551 | JGI24705J35276_122355513 | 61 |
| 74 | 3300005071 | Ga0068302_10015426 | Ga0068302_100154263 | 61 |
| 75 | 3300005201 | Ga0072941_1101907 | Ga0072941_11019078 | 61 |
| 76 | 3300009784 | Ga0123357_10053426 | Ga0123357_100534264 | 61 |
| 77 | 3300010049 | Ga0123356_10002511 | Ga0123356_100025114 | 61 |
| 78 | 3300010167 | Ga0123353_10000005 | Ga0123353_10000005106 | 61 |
| 79 | 3300010167 | Ga0123353_10000851 | Ga0123353_1000085122 | 61 |
| 80 | 3300010167 | Ga0123353_10035088 | Ga0123353_100350889 | 61 |
| 81 | 3300042590 | Ga0466690_005619 | Ga0466690_005619_1712_1897 | 61 |
| 82 | 3300042590 | Ga0466690_019048 | Ga0466690_019048_3396_3581 | 61 |
| 83 | 3300042590 | Ga0466690_161436 | Ga0466690_161436_15944_16129 | 61 |
| 84 | 3300042591 | Ga0466692_091255 | Ga0466692_091255_2553_2738 | 61 |
| 85 | 3300042591 | Ga0466692_097174 | Ga0466692_097174_1327_1512 | 61 |
| 86 | 3300042593 | Ga0466691_047346 | Ga0466691_047346_5435_5620 | 61 |
| 87 | 3300042593 | Ga0466691_133902 | Ga0466691_133902_12475_12660 | 61 |
| 88 | 3300042594 | Ga0466694_032883 | Ga0466694_032883_3104_3289 | 61 |
| 89 | 3300042595 | Ga0466695_042296 | Ga0466695_042296_195_380 | 61 |
| 90 | 3300042596 | Ga0466696_004598 | Ga0466696_004598_23_208 | 61 |
| 91 | 3300042596 | Ga0466696_267649 | Ga0466696_267649_13694_13879 | 61 |
| 92 | 3300042601 | Ga0466707_011046 | Ga0466707_011046_11969_12154 | 61 |
| 93 | 3300042602 | Ga0466713_065007 | Ga0466713_065007_31273_31458 | 61 |
| 94 | 3300042602 | Ga0466713_129716 | Ga0466713_129716_81816_82001 | 61 |
| 95 | 3300042605 | Ga0466716_496909 | Ga0466716_496909_1015_1200 | 61 |
| 96 | 3300042606 | Ga0466719_352394 | Ga0466719_352394_2536_2721 | 61 |
| 97 | 3300042608 | Ga0466721_044220 | Ga0466721_044220_603_788 | 61 |
| 98 | 3300042608 | Ga0466721_106637 | Ga0466721_106637_1883_2068 | 61 |
| 99 | 3300042609 | Ga0466722_104828 | Ga0466722_104828_29524_29709 | 61 |
| 100 | 3300042609 | Ga0466722_136953 | Ga0466722_136953_2505_2690 | 61 |
| 101 | 3300042610 | Ga0466698_203257 | Ga0466698_203257_801_986 | 61 |
| 102 | 3300042612 | Ga0466705_173938 | Ga0466705_173938_3088_3273 | 61 |
| 103 | 3300042612 | Ga0466705_268305 | Ga0466705_268305_1157_1342 | 61 |
| 104 | 3300042616 | Ga0466715_019987 | Ga0466715_019987_1350_1535 | 61 |
| 105 | 3300042618 | Ga0466723_015244 | Ga0466723_015244_2456_2641 | 61 |
| 106 | 3300042618 | Ga0466723_331586 | Ga0466723_331586_717_902 | 61 |
| 107 | 3300042620 | Ga0466728_191715 | Ga0466728_191715_1043_1228 | 61 |
| 108 | 3300042620 | Ga0466728_203966 | Ga0466728_203966_705_890 | 61 |
| 109 | 3300042622 | Ga0466731_025411 | Ga0466731_025411_4132_4317 | 61 |
| 110 | 3300042623 | Ga0466734_036815 | Ga0466734_036815_1094_1279 | 61 |
| 111 | 3300042624 | Ga0466735_104194 | Ga0466735_104194_17984_18169 | 61 |
| 112 | 3300042624 | Ga0466735_132214 | Ga0466735_132214_3708_3893 | 61 |
| 113 | 3300042636 | Ga0466703_151392 | Ga0466703_151392_1314_1499 | 61 |
| 114 | 3300042636 | Ga0466703_285845 | Ga0466703_285845_3213_3398 | 61 |
| 115 | 3300042643 | Ga0466704_029588 | Ga0466704_029588_7501_7686 | 61 |
| 116 | 3300042652 | Ga0466708_023754 | Ga0466708_023754_5211_5396 | 61 |
| 117 | 3300042652 | Ga0466708_127923 | Ga0466708_127923_3040_3225 | 61 |
| 118 | 3300042655 | Ga0466727_004530 | Ga0466727_004530_5603_5788 | 61 |
| 119 | iso_pr_bacteria | 2695420314 | 2695471845 | 61 |
| 120 | iso_pr_bacteria | 2820737921 | 2820738470 | 61 |
| 121 | iso_pr_bacteria | 2910926975 | 2910930197 | 61 |
| 122 | 3300002462 | JGI24702J35022_10002590 | JGI24702J35022_1000259012 | 62 |
| 123 | 3300002504 | JGI24705J35276_12205290 | JGI24705J35276_122052903 | 62 |
| 124 | 3300002834 | JGI24696J40584_12866950 | JGI24696J40584_128669501 | 62 |
| 125 | 3300002834 | JGI24696J40584_12913745 | JGI24696J40584_129137452 | 62 |
| 126 | 3300002834 | JGI24696J40584_12956144 | JGI24696J40584_129561445 | 62 |
| 127 | 3300005200 | Ga0072940_1478442 | Ga0072940_14784422 | 62 |
| 128 | 3300010049 | Ga0123356_11085752 | Ga0123356_110857522 | 62 |
| 129 | 3300010167 | Ga0123353_10371900 | Ga0123353_103719002 | 62 |
| 130 | 3300010167 | Ga0123353_10912208 | Ga0123353_109122082 | 62 |
| 131 | 3300042592 | Ga0466693_164101 | Ga0466693_164101_495_683 | 62 |
| 132 | 3300042602 | Ga0466713_036279 | Ga0466713_036279_2602_2790 | 62 |
| 133 | 3300042604 | Ga0466717_145701 | Ga0466717_145701_978_1166 | 62 |
| 134 | 3300042609 | Ga0466722_121463 | Ga0466722_121463_19663_19851 | 62 |
| 135 | 3300042609 | Ga0466722_133379 | Ga0466722_133379_663_851 | 62 |
| 136 | iso_pr_bacteria | 2820744581 | 2820745540 | 62 |
| 137 | 3300002462 | JGI24702J35022_10061971 | JGI24702J35022_100619714 | 63 |
| 138 | 3300010049 | Ga0123356_10109936 | Ga0123356_101099363 | 63 |
| 139 | 3300042596 | Ga0466696_161539 | Ga0466696_161539_25078_25269 | 63 |
| 140 | 3300042656 | Ga0466732_236153 | Ga0466732_236153_1232_1423 | 63 |
| 141 | iso_pr_bacteria | 2820765201 | 2820766091 | 63 |
| 142 | 3300010167 | Ga0123353_10036193 | Ga0123353_100361938 | 64 |
| 143 | 3300010882 | Ga0123354_10235507 | Ga0123354_102355073 | 64 |
| 144 | 3300042602 | Ga0466713_026408 | Ga0466713_026408_8728_8925 | 65 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01783 | Ribosomal_L32p | Ribosomal L32p protein family | 2 | 58 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.52 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.