Protein Family IF10246
Metagenome
Isolate
170
Members
43
Samples
161
Scaffolds
113.55
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_201694|Ga0466732_201694_1493_1864
- Length
- 123 aa
- Sequence
- MEIAIFFLIMGTSFKLNLRSELDYLGMTVKELSQKTGIAKGTLNCYLGVRSSMPPADIAVKIASVLGVSVEYLVTGKEQRKDILLDQNIRSIIQILTELNEKDIETILGLSKILKNQSEKKVK
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.1%
Kalotermitidae
22.0%
Unclassified
14.6%
Termopsidae
4.9%
Rhinotermitidae
2.4%
Taxonomy
Archaea
2
Bacteria
147
Eukaryota
0
Viruses
3
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 35 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_016425 | 3300042601 | Bacteria | 10073 |
| 2 | Ga0466698_002059 | 3300042610 | Bacteria | 1559 |
| 3 | Ga0264413_131434 | 3300024493 | Unclassified | 1517 |
| 4 | Ga0466694_084755 | 3300042594 | Bacteria | 1194 |
| 5 | Ga0466694_307399 | 3300042594 | Bacteria | 5933 |
| 6 | Ga0466699_319264 | 3300042597 | Bacteria | 1126 |
| 7 | Ga0466699_420840 | 3300042597 | Bacteria | 1650 |
| 8 | Ga0466699_434374 | 3300042597 | Bacteria | 1742 |
| 9 | Ga0123355_10229397 | 3300009826 | Bacteria | 2654 |
| 10 | Ga0123356_10003429 | 3300010049 | Bacteria | 16603 |
| 11 | Ga0123354_10676535 | 3300010882 | Bacteria | 729 |
| 12 | AustNasuHG_c1025039 | 3300000089 | Bacteria | 1881 |
| 13 | JGI24698J34947_10064935 | 3300002449 | Bacteria | 1781 |
| 14 | JGI24698J34947_10066007 | 3300002449 | Unclassified | 1762 |
| 15 | JGI24698J34947_10121009 | 3300002449 | Bacteria | 1136 |
| 16 | JGI24695J34938_10188246 | 3300002450 | Bacteria | 856 |
| 17 | JGI24695J34938_10370343 | 3300002450 | Bacteria | 633 |
| 18 | JGI24699J35502_11128913 | 3300002509 | Unclassified | 4541 |
| 19 | Ga0072941_1086892 | 3300005201 | Bacteria | 2460 |
| 20 | Ga0072941_1159618 | 3300005201 | Bacteria | 1096 |
| 21 | Ga0466712_021384 | 3300042614 | Bacteria | 3539 |
| 22 | Ga0466712_108850 | 3300042614 | Unclassified | 6393 |
| 23 | Ga0466712_173667 | 3300042614 | Bacteria | 1234 |
| 24 | Ga0466712_229358 | 3300042614 | Bacteria | 24428 |
| 25 | Ga0466707_204779 | 3300042601 | Bacteria | 1785 |
| 26 | Ga0466722_117404 | 3300042609 | Bacteria | 2347 |
| 27 | Ga0466698_298870 | 3300042610 | Bacteria | 1435 |
| 28 | Ga0264413_139205 | 3300024493 | Bacteria | 2898 |
| 29 | Ga0466699_411310 | 3300042597 | Bacteria | 1377 |
| 30 | Ga0123356_10363678 | 3300010049 | Bacteria | 1575 |
| 31 | Ga0123356_11695108 | 3300010049 | Archaea | 784 |
| 32 | Ga0123356_11920201 | 3300010049 | Bacteria | 737 |
| 33 | JGI24698J34947_10017612 | 3300002449 | Bacteria | 3868 |
| 34 | JGI24698J34947_10037149 | 3300002449 | Bacteria | 2532 |
| 35 | JGI24698J34947_10040343 | 3300002449 | Bacteria | 2411 |
| 36 | JGI24698J34947_10285284 | 3300002449 | Bacteria | 601 |
| 37 | JGI24695J34938_10002335 | 3300002450 | Bacteria | 14621 |
| 38 | Ga0466712_029832 | 3300042614 | Unclassified | 1926 |
| 39 | Ga0466712_140733 | 3300042614 | Bacteria | 11118 |
| 40 | Ga0466712_239506 | 3300042614 | Bacteria | 1922 |
| 41 | Ga0466712_303060 | 3300042614 | Unclassified | 1744 |
| 42 | Ga0466704_170656 | 3300042643 | Bacteria | 27574 |
| 43 | Ga0466707_291792 | 3300042601 | Bacteria | 1176 |
| 44 | Ga0466698_191674 | 3300042610 | Bacteria | 8101 |
| 45 | Ga0415639_045357 | 3300038395 | Bacteria | 3132 |
| 46 | Ga0466694_076399 | 3300042594 | Bacteria | 1319 |
| 47 | Ga0466694_115078 | 3300042594 | Bacteria | 1828 |
| 48 | Ga0123355_10121535 | 3300009826 | Bacteria | 4049 |
| 49 | JGI24698J34947_10259657 | 3300002449 | Bacteria | 644 |
| 50 | JGI24695J34938_10005893 | 3300002450 | Bacteria | 7518 |
| 51 | Ga0072941_1012114 | 3300005201 | Bacteria | 3367 |
| 52 | Ga0072941_1194010 | 3300005201 | Viruses | 1733 |
| 53 | Ga0466712_025980 | 3300042614 | Bacteria | 4889 |
| 54 | Ga0466712_040155 | 3300042614 | Bacteria | 1542 |
| 55 | Ga0466712_248065 | 3300042614 | Bacteria | 10133 |
| 56 | Ga0466715_194695 | 3300042616 | Archaea | 1968 |
| 57 | Ga0466718_056864 | 3300042617 | Bacteria | 10940 |
| 58 | Ga0466718_163816 | 3300042617 | Bacteria | 1105 |
| 59 | Ga0466726_153774 | 3300042619 | Bacteria | 1262 |
| 60 | Ga0466732_258412 | 3300042656 | Bacteria | 1160 |
| 61 | Ga0264413_127334 | 3300024493 | Bacteria | 4988 |
| 62 | Ga0264413_133359 | 3300024493 | Bacteria | 1519 |
| 63 | Ga0415639_121329 | 3300038395 | Bacteria | 4313 |
| 64 | Ga0466694_003630 | 3300042594 | Bacteria | 1597 |
| 65 | Ga0466694_079803 | 3300042594 | Bacteria | 3430 |
| 66 | Ga0466694_223327 | 3300042594 | Bacteria | 1384 |
| 67 | Ga0466694_289922 | 3300042594 | Bacteria | 2235 |
| 68 | Ga0466696_007654 | 3300042596 | Unclassified | 2312 |
| 69 | Ga0123355_10235754 | 3300009826 | Bacteria | 2603 |
| 70 | Ga0123356_12382234 | 3300010049 | Viruses | 662 |
| 71 | AustNasuHG_c1069539 | 3300000089 | Bacteria | 640 |
| 72 | JGI24698J34947_10004691 | 3300002449 | Unclassified | 7458 |
| 73 | JGI24698J34947_10014227 | 3300002449 | Bacteria | 4332 |
| 74 | JGI24698J34947_10040665 | 3300002449 | Bacteria | 2399 |
| 75 | JGI24698J34947_10107302 | 3300002449 | Bacteria | 1240 |
| 76 | JGI24698J34947_10153988 | 3300002449 | Bacteria | 950 |
| 77 | JGI24698J34947_10181937 | 3300002449 | Bacteria | 839 |
| 78 | Ga0072940_1051241 | 3300005200 | Bacteria | 5681 |
| 79 | Ga0466705_299178 | 3300042612 | Bacteria | 3561 |
| 80 | Ga0466726_354783 | 3300042619 | Bacteria | 1397 |
| 81 | Ga0466726_409018 | 3300042619 | Unclassified | 1104 |
| 82 | Ga0466707_260975 | 3300042601 | Bacteria | 1216 |
| 83 | Ga0466720_237383 | 3300042607 | Bacteria | 2584 |
| 84 | Ga0466698_452565 | 3300042610 | Bacteria | 3059 |
| 85 | Ga0264413_134658 | 3300024493 | Bacteria | 1960 |
| 86 | Ga0264413_149565 | 3300024493 | Bacteria | 2433 |
| 87 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 88 | Ga0466696_408451 | 3300042596 | Bacteria | 1665 |
| 89 | Ga0123357_10565687 | 3300009784 | Bacteria | 896 |
| 90 | Ga0123355_10000434 | 3300009826 | Bacteria | 54971 |
| 91 | AustNasuHG_c1001122 | 3300000089 | Bacteria | 9652 |
| 92 | JGI24695J34938_10000751 | 3300002450 | Bacteria | 30457 |
| 93 | JGI24695J34938_10441932 | 3300002450 | Bacteria | 586 |
| 94 | Ga0072941_1042864 | 3300005201 | Bacteria | 7867 |
| 95 | Ga0466726_278149 | 3300042619 | Bacteria | 6352 |
| 96 | Ga0466732_201694 | 3300042656 | Bacteria | 2159 |
| 97 | Ga0466732_420036 | 3300042656 | Bacteria | 1438 |
| 98 | Ga0466707_224022 | 3300042601 | Bacteria | 4257 |
| 99 | Ga0466719_351591 | 3300042606 | Bacteria | 1550 |
| 100 | Ga0466720_037399 | 3300042607 | Bacteria | 4743 |
| 101 | Ga0264413_153367 | 3300024493 | Bacteria | 2612 |
| 102 | Ga0415639_053949 | 3300038395 | Bacteria | 3977 |
| 103 | Ga0466691_142735 | 3300042593 | Bacteria | 4743 |
| 104 | Ga0123356_10050704 | 3300010049 | Bacteria | 3861 |
| 105 | Ga0123356_10790036 | 3300010049 | Bacteria | 1120 |
| 106 | AustNasuHG_c1040900 | 3300000089 | Bacteria | 1125 |
| 107 | JGI24698J34947_10084152 | 3300002449 | Unclassified | 1482 |
| 108 | JGI24698J34947_10130292 | 3300002449 | Unclassified | 1076 |
| 109 | JGI24695J34938_10001047 | 3300002450 | Bacteria | 25078 |
| 110 | JGI24695J34938_10019962 | 3300002450 | Unclassified | 3308 |
| 111 | JGI24695J34938_10023141 | 3300002450 | Bacteria | 3000 |
| 112 | JGI24695J34938_10055346 | 3300002450 | Bacteria | 1715 |
| 113 | JGI24695J34938_10067977 | 3300002450 | Bacteria | 1498 |
| 114 | Ga0072941_1006916 | 3300005201 | Bacteria | 30596 |
| 115 | Ga0466712_026829 | 3300042614 | Bacteria | 12356 |
| 116 | Ga0466712_170752 | 3300042614 | Bacteria | 13256 |
| 117 | Ga0466715_510748 | 3300042616 | Bacteria | 7840 |
| 118 | Ga0466718_047740 | 3300042617 | Bacteria | 3576 |
| 119 | Ga0466723_299111 | 3300042618 | Bacteria | 1375 |
| 120 | Ga0466726_262321 | 3300042619 | Unclassified | 4450 |
| 121 | Ga0466716_203278 | 3300042605 | Bacteria | 16353 |
| 122 | Ga0466719_123057 | 3300042606 | Bacteria | 6145 |
| 123 | Ga0466720_125260 | 3300042607 | Bacteria | 23757 |
| 124 | Ga0466721_245055 | 3300042608 | Bacteria | 2429 |
| 125 | Ga0466699_002877 | 3300042597 | Bacteria | 3633 |
| 126 | Ga0466699_195595 | 3300042597 | Bacteria | 6554 |
| 127 | Ga0123356_10092604 | 3300010049 | Bacteria | 2883 |
| 128 | JGI24698J34947_10048291 | 3300002449 | Unclassified | 2156 |
| 129 | JGI24698J34947_10066010 | 3300002449 | Unclassified | 1762 |
| 130 | Ga0072941_1006687 | 3300005201 | Viruses | 6544 |
| 131 | Ga0466712_019884 | 3300042614 | Bacteria | 29756 |
| 132 | Ga0466711_402299 | 3300042615 | Bacteria | 2448 |
| 133 | Ga0466726_415631 | 3300042619 | Bacteria | 1030 |
| 134 | Ga0466735_101724 | 3300042624 | Bacteria | 1207 |
| 135 | Ga0466698_151722 | 3300042610 | Bacteria | 1565 |
| 136 | Ga0466698_187003 | 3300042610 | Bacteria | 1099 |
| 137 | Ga0466698_247671 | 3300042610 | Bacteria | 1029 |
| 138 | Ga0264413_111745 | 3300024493 | Bacteria | 49890 |
| 139 | Ga0264413_131435 | 3300024493 | Bacteria | 1136 |
| 140 | Ga0466694_231376 | 3300042594 | Bacteria | 1435 |
| 141 | Ga0466699_350672 | 3300042597 | Bacteria | 1071 |
| 142 | Ga0123355_10002462 | 3300009826 | Bacteria | 26192 |
| 143 | Ga0123355_10043557 | 3300009826 | Bacteria | 7303 |
| 144 | Ga0123355_10052842 | 3300009826 | Bacteria | 6590 |
| 145 | Ga0123356_12709180 | 3300010049 | Bacteria | 621 |
| 146 | Ga0123353_12354264 | 3300010167 | Bacteria | 638 |
| 147 | AustNasuHG_c1002582 | 3300000089 | Bacteria | 6539 |
| 148 | JGI24698J34947_10002841 | 3300002449 | Bacteria | 9386 |
| 149 | JGI24698J34947_10093878 | 3300002449 | Unclassified | 1368 |
| 150 | JGI24695J34938_10008531 | 3300002450 | Bacteria | 5832 |
| 151 | JGI24695J34938_10011796 | 3300002450 | Bacteria | 4684 |
| 152 | JGI24695J34938_10151531 | 3300002450 | Bacteria | 950 |
| 153 | JGI24695J34938_10487994 | 3300002450 | Bacteria | 561 |
| 154 | JGI24705J35276_12128700 | 3300002504 | Bacteria | 1097 |
| 155 | JGI24697J35500_11267992 | 3300002507 | Unclassified | 3735 |
| 156 | Ga0072941_1032534 | 3300005201 | Bacteria | 1394 |
| 157 | Ga0072941_1398944 | 3300005201 | Bacteria | 816 |
| 158 | Ga0466705_162064 | 3300042612 | Bacteria | 6369 |
| 159 | Ga0466705_347397 | 3300042612 | Unclassified | 1136 |
| 160 | Ga0466712_041064 | 3300042614 | Bacteria | 3002 |
| 161 | Ga0466702_255603 | 3300042635 | Bacteria | 4671 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_409018 | Ga0466726_409018_192_536 | 100 |
| 2 | iso_pr_bacteria | 2781125653 | 2781313535 | 100 |
| 3 | 3300042619 | Ga0466726_262321 | Ga0466726_262321_329_676 | 101 |
| 4 | iso_pr_bacteria | 2781125655 | 2781316952 | 107 |
| 5 | 3300009826 | Ga0123355_10000434 | Ga0123355_1000043437 | 108 |
| 6 | 3300024493 | Ga0264413_153367 | Ga0264413_1533674 | 108 |
| 7 | iso_pr_bacteria | 2781125655 | 2781317850 | 108 |
| 8 | iso_pr_bacteria | 2781125655 | 2781319406 | 108 |
| 9 | iso_pr_bacteria | 2781125655 | 2781319585 | 108 |
| 10 | 3300009826 | Ga0123355_10002462 | Ga0123355_1000246216 | 109 |
| 11 | 3300009826 | Ga0123355_10043557 | Ga0123355_100435576 | 109 |
| 12 | 3300009826 | Ga0123355_10121535 | Ga0123355_101215355 | 109 |
| 13 | 3300024493 | Ga0264413_134658 | Ga0264413_1346583 | 109 |
| 14 | 3300024493 | Ga0264413_139205 | Ga0264413_1392054 | 109 |
| 15 | 3300024493 | Ga0264413_149565 | Ga0264413_1495654 | 109 |
| 16 | 3300042610 | Ga0466698_002059 | Ga0466698_002059_759_1088 | 109 |
| 17 | 3300042614 | Ga0466712_029832 | Ga0466712_029832_276_605 | 109 |
| 18 | 3300042614 | Ga0466712_108850 | Ga0466712_108850_1232_1561 | 109 |
| 19 | 3300042614 | Ga0466712_239506 | Ga0466712_239506_615_944 | 109 |
| 20 | 3300042614 | Ga0466712_248065 | Ga0466712_248065_2267_2596 | 109 |
| 21 | iso_pr_bacteria | 2781125689 | 2781425704 | 109 |
| 22 | 3300000089 | AustNasuHG_c1002582 | AustNasuHG_10025824 | 110 |
| 23 | 3300002449 | JGI24698J34947_10002841 | JGI24698J34947_100028419 | 110 |
| 24 | 3300002449 | JGI24698J34947_10040343 | JGI24698J34947_100403432 | 110 |
| 25 | 3300002449 | JGI24698J34947_10048291 | JGI24698J34947_100482912 | 110 |
| 26 | 3300002449 | JGI24698J34947_10064935 | JGI24698J34947_100649355 | 110 |
| 27 | 3300002449 | JGI24698J34947_10084152 | JGI24698J34947_100841522 | 110 |
| 28 | 3300002449 | JGI24698J34947_10093878 | JGI24698J34947_100938782 | 110 |
| 29 | 3300002449 | JGI24698J34947_10107302 | JGI24698J34947_101073022 | 110 |
| 30 | 3300002449 | JGI24698J34947_10121009 | JGI24698J34947_101210092 | 110 |
| 31 | 3300002507 | JGI24697J35500_11267992 | JGI24697J35500_112679926 | 110 |
| 32 | 3300009826 | Ga0123355_10235754 | Ga0123355_102357542 | 111 |
| 33 | 3300038395 | Ga0415639_053949 | Ga0415639_053949_1184_1519 | 111 |
| 34 | 3300042614 | Ga0466712_041064 | Ga0466712_041064_2383_2718 | 111 |
| 35 | 3300002449 | JGI24698J34947_10004691 | JGI24698J34947_100046915 | 112 |
| 36 | 3300002449 | JGI24698J34947_10130292 | JGI24698J34947_101302921 | 112 |
| 37 | 3300002450 | JGI24695J34938_10005893 | JGI24695J34938_100058938 | 112 |
| 38 | 3300002450 | JGI24695J34938_10011796 | JGI24695J34938_100117962 | 112 |
| 39 | 3300002450 | JGI24695J34938_10067977 | JGI24695J34938_100679772 | 112 |
| 40 | 3300002450 | JGI24695J34938_10188246 | JGI24695J34938_101882462 | 112 |
| 41 | 3300010049 | Ga0123356_10092604 | Ga0123356_100926045 | 112 |
| 42 | 3300024493 | Ga0264413_131434 | Ga0264413_1314342 | 112 |
| 43 | 3300042593 | Ga0466691_142735 | Ga0466691_142735_1963_2301 | 112 |
| 44 | 3300042595 | Ga0466695_259092 | Ga0466695_259092_82598_82936 | 112 |
| 45 | 3300042597 | Ga0466699_195595 | Ga0466699_195595_2799_3137 | 112 |
| 46 | 3300042607 | Ga0466720_125260 | Ga0466720_125260_1304_1642 | 112 |
| 47 | 3300042607 | Ga0466720_237383 | Ga0466720_237383_1473_1811 | 112 |
| 48 | 3300042608 | Ga0466721_245055 | Ga0466721_245055_1390_1728 | 112 |
| 49 | 3300042610 | Ga0466698_187003 | Ga0466698_187003_624_962 | 112 |
| 50 | 3300042610 | Ga0466698_298870 | Ga0466698_298870_461_799 | 112 |
| 51 | 3300042612 | Ga0466705_299178 | Ga0466705_299178_397_735 | 112 |
| 52 | 3300042616 | Ga0466715_194695 | Ga0466715_194695_330_668 | 112 |
| 53 | 3300042619 | Ga0466726_153774 | Ga0466726_153774_467_805 | 112 |
| 54 | 3300042619 | Ga0466726_415631 | Ga0466726_415631_633_971 | 112 |
| 55 | iso_pr_bacteria | 2781125644 | 2781296675 | 112 |
| 56 | 3300002450 | JGI24695J34938_10001047 | JGI24695J34938_100010472 | 113 |
| 57 | 3300002450 | JGI24695J34938_10019962 | JGI24695J34938_100199624 | 113 |
| 58 | 3300005201 | Ga0072941_1006687 | Ga0072941_10066875 | 113 |
| 59 | 3300005201 | Ga0072941_1086892 | Ga0072941_10868921 | 113 |
| 60 | 3300010049 | Ga0123356_11695108 | Ga0123356_116951082 | 113 |
| 61 | 3300010049 | Ga0123356_12709180 | Ga0123356_127091801 | 113 |
| 62 | 3300010882 | Ga0123354_10676535 | Ga0123354_106765351 | 113 |
| 63 | 3300024493 | Ga0264413_127334 | Ga0264413_1273342 | 113 |
| 64 | 3300024493 | Ga0264413_131435 | Ga0264413_1314351 | 113 |
| 65 | 3300024493 | Ga0264413_133359 | Ga0264413_1333591 | 113 |
| 66 | 3300038395 | Ga0415639_045357 | Ga0415639_045357_901_1242 | 113 |
| 67 | 3300042594 | Ga0466694_003630 | Ga0466694_003630_158_499 | 113 |
| 68 | 3300042594 | Ga0466694_076399 | Ga0466694_076399_599_940 | 113 |
| 69 | 3300042594 | Ga0466694_079803 | Ga0466694_079803_2405_2746 | 113 |
| 70 | 3300042594 | Ga0466694_084755 | Ga0466694_084755_714_1055 | 113 |
| 71 | 3300042594 | Ga0466694_115078 | Ga0466694_115078_666_1007 | 113 |
| 72 | 3300042594 | Ga0466694_223327 | Ga0466694_223327_176_517 | 113 |
| 73 | 3300042594 | Ga0466694_231376 | Ga0466694_231376_654_995 | 113 |
| 74 | 3300042594 | Ga0466694_289922 | Ga0466694_289922_249_590 | 113 |
| 75 | 3300042596 | Ga0466696_007654 | Ga0466696_007654_476_817 | 113 |
| 76 | 3300042596 | Ga0466696_408451 | Ga0466696_408451_507_848 | 113 |
| 77 | 3300042597 | Ga0466699_002877 | Ga0466699_002877_2897_3238 | 113 |
| 78 | 3300042597 | Ga0466699_319264 | Ga0466699_319264_374_715 | 113 |
| 79 | 3300042597 | Ga0466699_350672 | Ga0466699_350672_528_869 | 113 |
| 80 | 3300042597 | Ga0466699_411310 | Ga0466699_411310_902_1243 | 113 |
| 81 | 3300042597 | Ga0466699_420840 | Ga0466699_420840_233_574 | 113 |
| 82 | 3300042601 | Ga0466707_260975 | Ga0466707_260975_577_918 | 113 |
| 83 | 3300042605 | Ga0466716_203278 | Ga0466716_203278_940_1281 | 113 |
| 84 | 3300042607 | Ga0466720_037399 | Ga0466720_037399_889_1230 | 113 |
| 85 | 3300042609 | Ga0466722_117404 | Ga0466722_117404_397_738 | 113 |
| 86 | 3300042610 | Ga0466698_151722 | Ga0466698_151722_688_1029 | 113 |
| 87 | 3300042610 | Ga0466698_247671 | Ga0466698_247671_471_812 | 113 |
| 88 | 3300042614 | Ga0466712_019884 | Ga0466712_019884_11959_12300 | 113 |
| 89 | 3300042614 | Ga0466712_021384 | Ga0466712_021384_22_363 | 113 |
| 90 | 3300042614 | Ga0466712_026829 | Ga0466712_026829_4984_5325 | 113 |
| 91 | 3300042614 | Ga0466712_040155 | Ga0466712_040155_195_536 | 113 |
| 92 | 3300042614 | Ga0466712_170752 | Ga0466712_170752_6241_6582 | 113 |
| 93 | 3300042614 | Ga0466712_173667 | Ga0466712_173667_791_1132 | 113 |
| 94 | 3300042614 | Ga0466712_303060 | Ga0466712_303060_1246_1587 | 113 |
| 95 | 3300042617 | Ga0466718_047740 | Ga0466718_047740_426_767 | 113 |
| 96 | 3300042619 | Ga0466726_278149 | Ga0466726_278149_3961_4302 | 113 |
| 97 | 3300042656 | Ga0466732_420036 | Ga0466732_420036_1083_1424 | 113 |
| 98 | iso_pr_bacteria | 2781125689 | 2781425717 | 113 |
| 99 | 3300000089 | AustNasuHG_c1001122 | AustNasuHG_10011227 | 114 |
| 100 | 3300000089 | AustNasuHG_c1069539 | AustNasuHG_10695392 | 114 |
| 101 | 3300002449 | JGI24698J34947_10017612 | JGI24698J34947_100176122 | 114 |
| 102 | 3300002449 | JGI24698J34947_10037149 | JGI24698J34947_100371492 | 114 |
| 103 | 3300002449 | JGI24698J34947_10040665 | JGI24698J34947_100406652 | 114 |
| 104 | 3300002449 | JGI24698J34947_10153988 | JGI24698J34947_101539882 | 114 |
| 105 | 3300002449 | JGI24698J34947_10181937 | JGI24698J34947_101819372 | 114 |
| 106 | 3300002449 | JGI24698J34947_10259657 | JGI24698J34947_102596571 | 114 |
| 107 | 3300002450 | JGI24695J34938_10008531 | JGI24695J34938_100085319 | 114 |
| 108 | 3300002450 | JGI24695J34938_10023141 | JGI24695J34938_100231412 | 114 |
| 109 | 3300002450 | JGI24695J34938_10151531 | JGI24695J34938_101515312 | 114 |
| 110 | 3300002509 | JGI24699J35502_11128913 | JGI24699J35502_111289136 | 114 |
| 111 | 3300005200 | Ga0072940_1051241 | Ga0072940_10512416 | 114 |
| 112 | 3300005201 | Ga0072941_1032534 | Ga0072941_10325343 | 114 |
| 113 | 3300005201 | Ga0072941_1042864 | Ga0072941_104286410 | 114 |
| 114 | 3300005201 | Ga0072941_1159618 | Ga0072941_11596182 | 114 |
| 115 | 3300005201 | Ga0072941_1398944 | Ga0072941_13989441 | 114 |
| 116 | 3300009826 | Ga0123355_10052842 | Ga0123355_100528427 | 114 |
| 117 | 3300009826 | Ga0123355_10229397 | Ga0123355_102293973 | 114 |
| 118 | 3300010049 | Ga0123356_10003429 | Ga0123356_1000342911 | 114 |
| 119 | 3300010049 | Ga0123356_10050704 | Ga0123356_100507044 | 114 |
| 120 | 3300010049 | Ga0123356_10790036 | Ga0123356_107900362 | 114 |
| 121 | 3300010049 | Ga0123356_11920201 | Ga0123356_119202012 | 114 |
| 122 | 3300010049 | Ga0123356_12382234 | Ga0123356_123822342 | 114 |
| 123 | 3300010167 | Ga0123353_12354264 | Ga0123353_123542641 | 114 |
| 124 | 3300042597 | Ga0466699_434374 | Ga0466699_434374_750_1094 | 114 |
| 125 | 3300042601 | Ga0466707_016425 | Ga0466707_016425_2069_2413 | 114 |
| 126 | 3300042601 | Ga0466707_204779 | Ga0466707_204779_145_489 | 114 |
| 127 | 3300042606 | Ga0466719_123057 | Ga0466719_123057_2143_2487 | 114 |
| 128 | 3300042614 | Ga0466712_140733 | Ga0466712_140733_885_1229 | 114 |
| 129 | 3300042617 | Ga0466718_056864 | Ga0466718_056864_3298_3642 | 114 |
| 130 | 3300042617 | Ga0466718_163816 | Ga0466718_163816_322_666 | 114 |
| 131 | 3300000089 | AustNasuHG_c1025039 | AustNasuHG_10250393 | 115 |
| 132 | 3300000089 | AustNasuHG_c1040900 | AustNasuHG_10409002 | 115 |
| 133 | 3300002449 | JGI24698J34947_10066010 | JGI24698J34947_100660101 | 115 |
| 134 | 3300005201 | Ga0072941_1006916 | Ga0072941_100691616 | 115 |
| 135 | 3300042610 | Ga0466698_452565 | Ga0466698_452565_1056_1403 | 115 |
| 136 | 3300042614 | Ga0466712_025980 | Ga0466712_025980_356_703 | 115 |
| 137 | 3300042614 | Ga0466712_229358 | Ga0466712_229358_2657_3004 | 115 |
| 138 | 3300042635 | Ga0466702_255603 | Ga0466702_255603_1403_1750 | 115 |
| 139 | iso_pr_bacteria | 2781125650 | 2781308654 | 115 |
| 140 | 3300002449 | JGI24698J34947_10066007 | JGI24698J34947_100660071 | 116 |
| 141 | 3300002450 | JGI24695J34938_10000751 | JGI24695J34938_100007519 | 116 |
| 142 | 3300002450 | JGI24695J34938_10002335 | JGI24695J34938_1000233510 | 116 |
| 143 | 3300005201 | Ga0072941_1012114 | Ga0072941_10121144 | 116 |
| 144 | 3300042615 | Ga0466711_402299 | Ga0466711_402299_777_1127 | 116 |
| 145 | 3300042624 | Ga0466735_101724 | Ga0466735_101724_778_1128 | 116 |
| 146 | 3300002449 | JGI24698J34947_10014227 | JGI24698J34947_100142272 | 117 |
| 147 | 3300002449 | JGI24698J34947_10285284 | JGI24698J34947_102852841 | 117 |
| 148 | 3300002450 | JGI24695J34938_10055346 | JGI24695J34938_100553462 | 117 |
| 149 | 3300042606 | Ga0466719_351591 | Ga0466719_351591_141_494 | 117 |
| 150 | 3300042610 | Ga0466698_191674 | Ga0466698_191674_6324_6677 | 117 |
| 151 | 3300042618 | Ga0466723_299111 | Ga0466723_299111_473_826 | 117 |
| 152 | 3300042656 | Ga0466732_258412 | Ga0466732_258412_90_443 | 117 |
| 153 | 3300002450 | JGI24695J34938_10441932 | JGI24695J34938_104419322 | 118 |
| 154 | 3300009784 | Ga0123357_10565687 | Ga0123357_105656872 | 118 |
| 155 | 3300042601 | Ga0466707_224022 | Ga0466707_224022_1671_2027 | 118 |
| 156 | 3300042601 | Ga0466707_291792 | Ga0466707_291792_420_776 | 118 |
| 157 | 3300042612 | Ga0466705_162064 | Ga0466705_162064_1498_1854 | 118 |
| 158 | 3300042612 | Ga0466705_347397 | Ga0466705_347397_178_534 | 118 |
| 159 | 3300002504 | JGI24705J35276_12128700 | JGI24705J35276_121287002 | 119 |
| 160 | 3300005201 | Ga0072941_1194010 | Ga0072941_11940104 | 119 |
| 161 | 3300042643 | Ga0466704_170656 | Ga0466704_170656_15258_15617 | 119 |
| 162 | 3300010049 | Ga0123356_10363678 | Ga0123356_103636782 | 120 |
| 163 | 3300038395 | Ga0415639_121329 | Ga0415639_121329_2974_3339 | 121 |
| 164 | 3300042616 | Ga0466715_510748 | Ga0466715_510748_3803_4168 | 121 |
| 165 | 3300042619 | Ga0466726_354783 | Ga0466726_354783_281_646 | 121 |
| 166 | 3300002450 | JGI24695J34938_10487994 | JGI24695J34938_104879941 | 123 |
| 167 | 3300042656 | Ga0466732_201694 | Ga0466732_201694_1493_1864 | 123 |
| 168 | 3300002450 | JGI24695J34938_10370343 | JGI24695J34938_103703431 | 124 |
| 169 | 3300024493 | Ga0264413_111745 | Ga0264413_1117455 | 135 |
| 170 | 3300042594 | Ga0466694_307399 | Ga0466694_307399_3700_4158 | 152 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.58 | 0.66 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.