Protein Family IF10234

Metagenome Isolate
122 Members
41 Samples
115 Scaffolds
569.61 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_099901|Ga0466732_099901_1270_3156
Length
605 aa
Sequence
MIEELSVRNFALIDSLNISFEKGFTVLSGETGAGKSIIVGSLGFLFGAKTDGEIIRSGSEEASVSAVVSIDGKNRDALQWLSQREIEQEDSRLVIRRSVKASGRNSIYIQNVPVTRNDLAEFTGFLFDLHGQHNHESLLRKETHRVYLDRFSGLEDEVAAFSRVFTELAEKRKTLEALNRSEKEREQRLEILNYAIEEITKADPKNGEIKELEAETQRLADFEKLSLHVNSVSSLLFEDSESRDSEVSFLSLARRLRASIENAASIDSSLSPMLKRLEDIYYEAEDLAAEFRNYRGRLSYDPAKLEEAEERLALLYKLKKKYRPACLPDSSGANSEAKSQLYKAEAXXXIEALSGAGENQDRIKAEITRLEKDIAARASVLSAKRNEGAKRLGEGITSILSRLGMPRAVFAASVKPKTMEGGAGLVCGPFGADDVEFMISANKGEPLKELARIASGGELSRVMLAIKTILLDSNGVAAGRASASDGSPQETLIFDEIDTGIGGEVALSVGEYLARIGKGKQIFCVTHLASIAVRADNHLKVEKKVIASGGGAGERTVTLVSQLKGAERRQEIARMLAGDSGKVALAHADELLAKYSVVKNGESNK

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.1%
Termitidae 34.1%
Unclassified 19.5%
Termopsidae 7.3%
Rhinotermitidae 4.9%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
23 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
29 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
38 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
39 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_018226 3300042612 Bacteria 5482
2 Ga0466705_364070 3300042612 Bacteria 8529
3 Ga0466733_047748 3300042659 Bacteria 18818
4 Ga0466733_057319 3300042659 Bacteria 6207
5 Ga0466733_061320 3300042659 Bacteria 23618
6 Ga0466703_008974 3300042636 Bacteria 24043
7 Ga0466703_118360 3300042636 Bacteria 9117
8 Ga0466703_339548 3300042636 Bacteria 12089
9 Ga0466712_009637 3300042614 Bacteria 6774
10 Ga0466715_067483 3300042616 Bacteria 42347
11 Ga0466715_296128 3300042616 Bacteria 9376
12 Ga0466723_035052 3300042618 Bacteria 2914
13 Ga0466723_124748 3300042618 Bacteria 48807
14 Ga0466728_325652 3300042620 Bacteria 12443
15 JGI24698J34947_10001087 3300002449 Bacteria 14019
16 JGI24702J35022_10003053 3300002462 Bacteria 10121
17 JGI24702J35022_10003935 3300002462 Bacteria 8924
18 Ga0466705_024380 3300042612 Bacteria 10141
19 Ga0466704_090497 3300042643 Bacteria 11716
20 Ga0466708_364014 3300042652 Bacteria 9931
21 Ga0123353_10001645 3300010167 Bacteria 27507
22 Ga0123353_10319779 3300010167 Bacteria 2356
23 Ga0466711_452100 3300042615 Bacteria 15067
24 Ga0466715_118473 3300042616 Bacteria 11378
25 Ga0466715_536102 3300042616 Bacteria 9488
26 Ga0466715_549980 3300042616 Bacteria 16549
27 Ga0466723_135869 3300042618 Bacteria 11379
28 Ga0466726_153903 3300042619 Bacteria 8761
29 Ga0466691_009800 3300042593 Bacteria 6571
30 Ga0466694_116198 3300042594 Bacteria 13971
31 Ga0466696_182880 3300042596 Bacteria 6456
32 Ga0466719_007851 3300042606 Bacteria 7496
33 Ga0466719_016801 3300042606 Bacteria 34227
34 JGI24698J34947_10003416 3300002449 Bacteria 8618
35 Ga0466733_152794 3300042659 Bacteria 22235
36 Ga0466735_118916 3300042624 Bacteria 2456
37 Ga0466704_175595 3300042643 Bacteria 5912
38 Ga0123353_10008059 3300010167 Bacteria 14334
39 Ga0466705_478818 3300042612 Bacteria 2685
40 Ga0466718_159405 3300042617 Bacteria 6433
41 Ga0466723_009351 3300042618 Bacteria 5637
42 Ga0466723_154064 3300042618 Unclassified 27270
43 Ga0415639_092158 3300038395 Bacteria 3701
44 JGI24702J35022_10006864 3300002462 Bacteria 6555
45 Ga0466705_142381 3300042612 Bacteria 9736
46 Ga0466704_068557 3300042643 Bacteria 4524
47 Ga0466704_509175 3300042643 Bacteria 22628
48 Ga0466708_369009 3300042652 Bacteria 6859
49 Ga0466712_030303 3300042614 Bacteria 13320
50 Ga0466712_109130 3300042614 Bacteria 13922
51 Ga0466715_164223 3300042616 Bacteria 8240
52 Ga0466723_249196 3300042618 Bacteria 8057
53 Ga0466696_045022 3300042596 Bacteria 11465
54 Ga0466716_384984 3300042605 Bacteria 16511
55 Ga0466719_053243 3300042606 Bacteria 17590
56 Ga0466719_071256 3300042606 Bacteria 12912
57 JGI24698J34947_10044003 3300002449 Bacteria 2287
58 Ga0466732_099901 3300042656 Bacteria 5146
59 Ga0466733_102077 3300042659 Bacteria 2117
60 Ga0466703_043864 3300042636 Bacteria 9104
61 Ga0466704_342680 3300042643 Unclassified 9772
62 Ga0466709_393295 3300042648 Bacteria 11437
63 Ga0466712_053813 3300042614 Bacteria 17032
64 Ga0466711_164377 3300042615 Bacteria 13533
65 Ga0466726_256636 3300042619 Bacteria 5022
66 Ga0466690_368980 3300042590 Unclassified 4700
67 Ga0466696_149909 3300042596 Bacteria 2643
68 Ga0466707_218761 3300042601 Bacteria 5973
69 Ga0466719_464750 3300042606 Bacteria 5564
70 JGI24702J35022_10004781 3300002462 Bacteria 8004
71 Ga0074263_107373 3300005485 Bacteria 3720
72 Ga0466705_213507 3300042612 Bacteria 9449
73 Ga0466704_026495 3300042643 Bacteria 14073
74 Ga0466704_495401 3300042643 Bacteria 8891
75 Ga0123355_10068730 3300009826 Bacteria 5698
76 Ga0466711_369740 3300042615 Bacteria 8357
77 Ga0466711_382714 3300042615 Bacteria 15087
78 Ga0466723_353581 3300042618 Bacteria 33076
79 Ga0466690_183771 3300042590 Bacteria 29648
80 Ga0466691_115982 3300042593 Bacteria 8897
81 Ga0466694_035606 3300042594 Bacteria 9819
82 Ga0466695_361079 3300042595 Bacteria 5673
83 Ga0466696_012443 3300042596 Bacteria 22314
84 Ga0466716_068534 3300042605 Bacteria 10766
85 Ga0466722_225630 3300042609 Bacteria 14425
86 AustNasuHG_c1000529 3300000089 Bacteria 13393
87 JGI24698J34947_10006705 3300002449 Bacteria 6323
88 Ga0466705_238865 3300042612 Bacteria 7111
89 Ga0466703_359189 3300042636 Bacteria 7606
90 Ga0466703_367991 3300042636 Bacteria 5692
91 Ga0466708_114772 3300042652 Bacteria 5434
92 Ga0466708_319097 3300042652 Bacteria 10816
93 Ga0123355_10001603 3300009826 Bacteria 31578
94 Ga0466705_425764 3300042612 Bacteria 5386
95 Ga0466712_055475 3300042614 Bacteria 18108
96 Ga0466715_002053 3300042616 Bacteria 10028
97 Ga0466728_158858 3300042620 Bacteria 3710
98 Ga0466691_179250 3300042593 Bacteria 50171
99 Ga0466707_156282 3300042601 Bacteria 2765
100 Ga0466716_466421 3300042605 Bacteria 7929
101 Ga0466719_412693 3300042606 Bacteria 14978
102 JGI24702J35022_10023523 3300002462 Bacteria 3331
103 Ga0466705_211889 3300042612 Bacteria 9256
104 Ga0466729_214176 3300042621 Bacteria 3453
105 Ga0466703_324914 3300042636 Bacteria 15390
106 Ga0466704_102735 3300042643 Bacteria 6816
107 Ga0466704_245588 3300042643 Bacteria 25369
108 Ga0466715_083864 3300042616 Bacteria 9437
109 Ga0466715_212868 3300042616 Bacteria 5617
110 Ga0466728_209244 3300042620 Bacteria 5375
111 Ga0466693_320956 3300042592 Bacteria 9680
112 Ga0466722_054557 3300042609 Bacteria 16684
113 JGI24698J34947_10006831 3300002449 Unclassified 6270
114 JGI24698J34947_10016551 3300002449 Bacteria 3999
115 Ga0068302_10191136 3300005071 Bacteria 2121

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_211889 Ga0466705_211889_4784_6499 493
2 3300042590 Ga0466690_368980 Ga0466690_368980_49_1551 500
3 3300042643 Ga0466704_068557 Ga0466704_068557_1480_3198 502
4 3300038395 Ga0415639_092158 Ga0415639_092158_1999_3594 511
5 3300042636 Ga0466703_118360 Ga0466703_118360_2525_4240 512
6 3300042606 Ga0466719_071256 Ga0466719_071256_8507_10267 525
7 3300042621 Ga0466729_214176 Ga0466729_214176_1120_2772 525
8 3300042643 Ga0466704_090497 Ga0466704_090497_7211_8947 525
9 3300042643 Ga0466704_102735 Ga0466704_102735_2514_4295 529
10 3300042616 Ga0466715_536102 Ga0466715_536102_4770_6491 530
11 3300042643 Ga0466704_495401 Ga0466704_495401_2646_4367 531
12 3300042596 Ga0466696_182880 Ga0466696_182880_1953_3701 533
13 3300042618 Ga0466723_135869 Ga0466723_135869_7746_9482 536
14 3300042643 Ga0466704_175595 Ga0466704_175595_1326_3062 537
15 3300042612 Ga0466705_018226 Ga0466705_018226_2848_4578 539
16 3300042615 Ga0466711_369740 Ga0466711_369740_4736_6526 540
17 3300009826 Ga0123355_10001603 Ga0123355_1000160311 543
18 3300042609 Ga0466722_054557 Ga0466722_054557_5111_6823 546
19 3300042612 Ga0466705_425764 Ga0466705_425764_657_2384 548
20 3300042643 Ga0466704_342680 Ga0466704_342680_2726_4453 550
21 3300042636 Ga0466703_367991 Ga0466703_367991_1515_3239 552
22 3300002462 JGI24702J35022_10003935 JGI24702J35022_100039355 553
23 3300042612 Ga0466705_024380 Ga0466705_024380_5588_7315 553
24 3300042615 Ga0466711_452100 Ga0466711_452100_8100_9761 553
25 3300042652 Ga0466708_364014 Ga0466708_364014_3665_5440 553
26 3300042593 Ga0466691_115982 Ga0466691_115982_4144_5883 554
27 3300042620 Ga0466728_209244 Ga0466728_209244_2780_4516 554
28 3300042609 Ga0466722_225630 Ga0466722_225630_6310_7995 556
29 3300042618 Ga0466723_035052 Ga0466723_035052_960_2651 556
30 3300042605 Ga0466716_068534 Ga0466716_068534_4407_6098 557
31 3300042606 Ga0466719_007851 Ga0466719_007851_3058_4749 557
32 3300042616 Ga0466715_164223 Ga0466715_164223_1654_3345 557
33 3300042619 Ga0466726_153903 Ga0466726_153903_5344_7062 557
34 3300042606 Ga0466719_412693 Ga0466719_412693_12290_14071 559
35 3300042620 Ga0466728_325652 Ga0466728_325652_10367_12085 559
36 3300042595 Ga0466695_361079 Ga0466695_361079_1992_3743 560
37 3300042620 Ga0466728_158858 Ga0466728_158858_711_2483 561
38 3300042659 Ga0466733_061320 Ga0466733_061320_15040_16728 562
39 3300042596 Ga0466696_045022 Ga0466696_045022_2712_4451 563
40 3300042636 Ga0466703_339548 Ga0466703_339548_4527_6218 563
41 3300042618 Ga0466723_009351 Ga0466723_009351_1222_2952 565
42 3300042636 Ga0466703_324914 Ga0466703_324914_2954_4684 565
43 3300042652 Ga0466708_319097 Ga0466708_319097_4943_6640 565
44 3300042659 Ga0466733_102077 Ga0466733_102077_190_1887 565
45 3300042593 Ga0466691_009800 Ga0466691_009800_1411_3111 566
46 3300042659 Ga0466733_047748 Ga0466733_047748_11581_13281 566
47 3300042593 Ga0466691_179250 Ga0466691_179250_10009_11712 567
48 3300042659 Ga0466733_057319 Ga0466733_057319_1939_3645 568
49 3300042659 Ga0466733_152794 Ga0466733_152794_11912_13621 569
50 3300042614 Ga0466712_053813 Ga0466712_053813_12529_14289 570
51 3300042616 Ga0466715_212868 Ga0466715_212868_1231_2994 570
52 3300042618 Ga0466723_353581 Ga0466723_353581_2918_4630 570
53 3300000089 AustNasuHG_c1000529 AustNasuHG_10005295 571
54 3300042616 Ga0466715_067483 Ga0466715_067483_35555_37270 571
55 3300042648 Ga0466709_393295 Ga0466709_393295_2643_4361 572
56 3300002462 JGI24702J35022_10006864 JGI24702J35022_100068644 573
57 3300010167 Ga0123353_10319779 Ga0123353_103197792 574
58 3300042596 Ga0466696_012443 Ga0466696_012443_17825_19597 574
59 3300042605 Ga0466716_384984 Ga0466716_384984_4255_5979 574
60 3300042605 Ga0466716_466421 Ga0466716_466421_1292_3031 574
61 3300042612 Ga0466705_142381 Ga0466705_142381_4964_6688 574
62 3300042636 Ga0466703_359189 Ga0466703_359189_2793_4517 574
63 3300042643 Ga0466704_026495 Ga0466704_026495_9659_11383 574
64 3300042594 Ga0466694_035606 Ga0466694_035606_5272_7059 575
65 3300042652 Ga0466708_369009 Ga0466708_369009_2278_4005 575
66 3300002449 JGI24698J34947_10006831 JGI24698J34947_100068313 576
67 3300042618 Ga0466723_124748 Ga0466723_124748_11902_13668 576
68 3300042590 Ga0466690_183771 Ga0466690_183771_22757_24493 578
69 3300042606 Ga0466719_016801 Ga0466719_016801_4659_6395 578
70 3300042612 Ga0466705_213507 Ga0466705_213507_3150_4886 578
71 3300042618 Ga0466723_154064 Ga0466723_154064_18697_20433 578
72 3300042652 Ga0466708_114772 Ga0466708_114772_1646_3385 579
73 3300042615 Ga0466711_164377 Ga0466711_164377_2989_4731 580
74 3300042615 Ga0466711_382714 Ga0466711_382714_10522_12264 580
75 3300042624 Ga0466735_118916 Ga0466735_118916_46_1788 580
76 3300042643 Ga0466704_509175 Ga0466704_509175_6990_8732 580
77 iso_pr_bacteria 2781125694 2781436428 580
78 iso_pr_bacteria 650716099 650878678 582
79 3300042606 Ga0466719_053243 Ga0466719_053243_3767_5518 583
80 iso_pr_bacteria 2781125655 2781317529 583
81 3300042616 Ga0466715_083864 Ga0466715_083864_2840_4594 584
82 3300042616 Ga0466715_118473 Ga0466715_118473_2988_4790 584
83 3300042616 Ga0466715_549980 Ga0466715_549980_14091_15845 584
84 3300042601 Ga0466707_218761 Ga0466707_218761_1207_2964 585
85 3300042614 Ga0466712_030303 Ga0466712_030303_1452_3209 585
86 3300042594 Ga0466694_116198 Ga0466694_116198_9051_10838 586
87 3300042614 Ga0466712_109130 Ga0466712_109130_10096_11856 586
88 3300042636 Ga0466703_008974 Ga0466703_008974_3450_5210 586
89 3300042592 Ga0466693_320956 Ga0466693_320956_5126_6940 587
90 3300042596 Ga0466696_149909 Ga0466696_149909_670_2433 587
91 3300042606 Ga0466719_464750 Ga0466719_464750_2741_4504 587
92 3300042612 Ga0466705_238865 Ga0466705_238865_2436_4199 587
93 3300042636 Ga0466703_043864 Ga0466703_043864_2838_4601 587
94 3300042643 Ga0466704_245588 Ga0466704_245588_20710_22473 587
95 iso_pr_bacteria 2781125632 2781269922 587
96 3300002449 JGI24698J34947_10001087 JGI24698J34947_1000108711 588
97 3300002449 JGI24698J34947_10006705 JGI24698J34947_100067054 588
98 3300005071 Ga0068302_10191136 Ga0068302_101911362 588
99 3300042614 Ga0466712_009637 Ga0466712_009637_2279_4045 588
100 3300010167 Ga0123353_10001645 Ga0123353_1000164523 589
101 3300042614 Ga0466712_055475 Ga0466712_055475_2070_3839 589
102 3300042616 Ga0466715_002053 Ga0466715_002053_6128_7900 590
103 3300042601 Ga0466707_156282 Ga0466707_156282_336_2111 591
104 3300002462 JGI24702J35022_10003053 JGI24702J35022_100030534 592
105 3300002462 JGI24702J35022_10004781 JGI24702J35022_100047814 592
106 3300005485 Ga0074263_107373 Ga0074263_1073732 593
107 3300042616 Ga0466715_296128 Ga0466715_296128_4923_6704 593
108 3300042618 Ga0466723_249196 Ga0466723_249196_4325_6106 593
109 iso_pr_bacteria 2781125697 2781443879 593
110 3300002462 JGI24702J35022_10023523 JGI24702J35022_100235233 594
111 iso_pr_bacteria 2781125653 2781313587 594
112 3300009826 Ga0123355_10068730 Ga0123355_100687302 595
113 3300042612 Ga0466705_478818 Ga0466705_478818_432_2222 596
114 3300010167 Ga0123353_10008059 Ga0123353_100080598 598
115 3300002449 JGI24698J34947_10044003 JGI24698J34947_100440031 600
116 3300002449 JGI24698J34947_10003416 JGI24698J34947_100034166 601
117 3300002449 JGI24698J34947_10016551 JGI24698J34947_100165512 601
118 3300042612 Ga0466705_364070 Ga0466705_364070_4651_6456 601
119 3300042619 Ga0466726_256636 Ga0466726_256636_2010_3899 601
120 iso_pr_bacteria 2781125681 2781406977 602
121 3300042617 Ga0466718_159405 Ga0466718_159405_3161_4972 603
122 3300042656 Ga0466732_099901 Ga0466732_099901_1270_3156 605

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02463 SMC_N RecF/RecN/SMC N terminal domain 1 543 0.94
PF13175 AAA_15 AAA ATPase domain 1 170 0.66
PF13476 AAA_23 AAA domain 5 201 0.47

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.