Protein Family IF10229

Metagenome Isolate
186 Members
41 Samples
178 Scaffolds
108.6 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_092388|Ga0466732_092388_2124_2510
Length
128 aa
Sequence
MIRCLSIRIKRLFNAIEGLVWMVEQELKTALGKNIKFLRFRRRFSQADLAEEAHISITFLSNIERGNNFPQPRTLCNLAEALDVQVWELFKGEGPLDHQETAIVDRLSEDFIKHVNLAMETVHKQYKT

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 65.8%
Unclassified 18.4%
Kalotermitidae 13.2%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 2
Bacteria 149
Eukaryota 0
Viruses 1
Unclassified 34

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
9 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
10 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
11 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
12 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
13 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
21 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
22 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_11213215 3300010049 Bacteria 920
2 Ga0123353_10979421 3300010167 Bacteria 1139
3 Ga0466720_057081 3300042607 Unclassified 1553
4 Ga0466720_113394 3300042607 Bacteria 5216
5 Ga0466720_140937 3300042607 Bacteria 22369
6 Ga0466698_071674 3300042610 Bacteria 4485
7 AustNasuHG_c1010649 3300000089 Unclassified 3199
8 FAAS_10657090 3300001880 Bacteria 540
9 JGI24695J34938_10049393 3300002450 Bacteria 1849
10 JGI24695J34938_10164935 3300002450 Archaea 912
11 Ga0072940_1013263 3300005200 Bacteria 4897
12 Ga0072941_1017224 3300005201 Bacteria 17207
13 Ga0072941_1024457 3300005201 Bacteria 5304
14 Ga0466732_427550 3300042656 Bacteria 1318
15 Ga0466718_101536 3300042617 Bacteria 2228
16 Ga0466718_108536 3300042617 Bacteria 1859
17 Ga0466718_134158 3300042617 Bacteria 5161
18 Ga0264413_101335 3300024493 Bacteria 2878
19 Ga0466694_019308 3300042594 Bacteria 2254
20 Ga0466694_032257 3300042594 Bacteria 1547
21 Ga0466699_014312 3300042597 Unclassified 2034
22 Ga0123356_10050288 3300010049 Unclassified 3879
23 Ga0466717_204132 3300042604 Bacteria 1170
24 Ga0466720_066678 3300042607 Bacteria 8491
25 Ga0466720_069293 3300042607 Bacteria 1482
26 Ga0466720_178854 3300042607 Unclassified 5619
27 Ga0466720_221088 3300042607 Bacteria 31188
28 AustNasuHG_c1012502 3300000089 Bacteria 2931
29 AustNasuHG_c1014488 3300000089 Bacteria 2679
30 JGI24698J34947_10078031 3300002449 Bacteria 1564
31 JGI24695J34938_10032397 3300002450 Bacteria 2415
32 JGI24695J34938_10107244 3300002450 Bacteria 1139
33 JGI24695J34938_10183587 3300002450 Bacteria 867
34 Ga0466712_062960 3300042614 Bacteria 2745
35 Ga0466712_183737 3300042614 Unclassified 1267
36 Ga0466718_105399 3300042617 Bacteria 1060
37 Ga0264413_116659 3300024493 Bacteria 3513
38 Ga0415639_020980 3300038395 Bacteria 5967
39 Ga0466694_144661 3300042594 Bacteria 3501
40 Ga0466694_157518 3300042594 Bacteria 1256
41 Ga0466694_194774 3300042594 Bacteria 2089
42 Ga0466699_180708 3300042597 Bacteria 2079
43 Ga0466708_018272 3300042652 Bacteria 1315
44 Ga0123355_12130422 3300009826 Bacteria 515
45 Ga0123356_10000102 3300010049 Bacteria 90045
46 Ga0123356_10044059 3300010049 Unclassified 4153
47 Ga0123356_10117740 3300010049 Bacteria 2578
48 Ga0123353_12288372 3300010167 Bacteria 650
49 Ga0466720_124320 3300042607 Bacteria 4239
50 AustNasuHG_c1012332 3300000089 Bacteria 2951
51 JGI24698J34947_10014474 3300002449 Bacteria 4296
52 JGI24698J34947_10027632 3300002449 Bacteria 3009
53 JGI24698J34947_10042727 3300002449 Unclassified 2327
54 JGI24695J34938_10000381 3300002450 Bacteria 43934
55 JGI24695J34938_10014282 3300002450 Bacteria 4124
56 JGI24695J34938_10022542 3300002450 Unclassified 3055
57 JGI24702J35022_10845440 3300002462 Bacteria 570
58 Ga0072940_1010137 3300005200 Bacteria 2188
59 Ga0072940_1038467 3300005200 Unclassified 3779
60 Ga0072941_1023773 3300005201 Bacteria 16468
61 Ga0466732_186284 3300042656 Bacteria 12295
62 Ga0466712_272587 3300042614 Bacteria 9718
63 Ga0466718_035590 3300042617 Bacteria 1899
64 Ga0466718_147793 3300042617 Bacteria 4518
65 Ga0415639_127991 3300038395 Bacteria 1325
66 Ga0466694_402432 3300042594 Bacteria 5371
67 Ga0466699_129070 3300042597 Bacteria 1141
68 Ga0466699_148759 3300042597 Bacteria 2560
69 Ga0123356_10050539 3300010049 Bacteria 3868
70 Ga0466720_063325 3300042607 Bacteria 2035
71 Ga0466720_135900 3300042607 Bacteria 5966
72 AustNasuHG_c1012561 3300000089 Bacteria 2923
73 JGI24698J34947_10018569 3300002449 Bacteria 3756
74 JGI24698J34947_10047668 3300002449 Bacteria 2174
75 JGI24698J34947_10069225 3300002449 Unclassified 1703
76 JGI24698J34947_10095577 3300002449 Unclassified 1350
77 JGI24698J34947_10318363 3300002449 Unclassified 554
78 JGI24695J34938_10001068 3300002450 Bacteria 24786
79 JGI24695J34938_10021158 3300002450 Unclassified 3186
80 JGI24695J34938_10033987 3300002450 Bacteria 2342
81 JGI24695J34938_10383689 3300002450 Bacteria 623
82 JGI24697J35500_11201915 3300002507 Bacteria 1680
83 Ga0072940_1072626 3300005200 Bacteria 2254
84 Ga0072941_1073722 3300005201 Bacteria 1960
85 Ga0466732_178798 3300042656 Bacteria 2445
86 Ga0466712_271304 3300042614 Bacteria 1062
87 Ga0466715_180970 3300042616 Bacteria 1334
88 Ga0466718_012225 3300042617 Bacteria 2950
89 Ga0264413_124392 3300024493 Bacteria 1858
90 Ga0415639_114097 3300038395 Bacteria 1734
91 Ga0466694_230555 3300042594 Bacteria 4479
92 Ga0466702_450656 3300042635 Bacteria 1280
93 Ga0123356_10355028 3300010049 Bacteria 1591
94 Ga0123356_10900847 3300010049 Bacteria 1056
95 Ga0123353_10669370 3300010167 Bacteria 1465
96 Ga0123353_11905834 3300010167 Bacteria 733
97 Ga0466720_043968 3300042607 Unclassified 1396
98 Ga0466698_038726 3300042610 Bacteria 1115
99 AustNasuHG_c1011337 3300000089 Bacteria 3090
100 FAAS_10835561 3300001880 Bacteria 556
101 JGI24698J34947_10000292 3300002449 Bacteria 21722
102 JGI24698J34947_10081056 3300002449 Bacteria 1522
103 JGI24698J34947_10146063 3300002449 Unclassified 989
104 JGI24695J34938_10002386 3300002450 Bacteria 14430
105 JGI24695J34938_10160423 3300002450 Bacteria 924
106 JGI24696J40584_12953287 3300002834 Unclassified 2461
107 Ga0072940_1067132 3300005200 Bacteria 812
108 Ga0466712_318652 3300042614 Bacteria 4171
109 Ga0466718_008611 3300042617 Bacteria 1925
110 Ga0466718_026075 3300042617 Bacteria 12343
111 Ga0466718_075327 3300042617 Bacteria 8975
112 Ga0466718_146770 3300042617 Unclassified 1400
113 Ga0264413_145868 3300024493 Unclassified 1029
114 Ga0466694_103729 3300042594 Bacteria 9752
115 Ga0466694_236771 3300042594 Bacteria 1167
116 Ga0466731_425550 3300042622 Viruses 3317
117 Ga0466702_343424 3300042635 Bacteria 6351
118 Ga0123356_10000269 3300010049 Bacteria 59524
119 Ga0123356_10071986 3300010049 Bacteria 3246
120 Ga0123353_10178887 3300010167 Bacteria 3360
121 Ga0123354_10100907 3300010882 Bacteria 3902
122 Ga0466698_263470 3300042610 Bacteria 2548
123 AustNasuHG_c1012663 3300000089 Bacteria 2910
124 AustNasuHG_c1012993 3300000089 Unclassified 2864
125 AustNasuHG_c1014216 3300000089 Bacteria 2712
126 AustNasuHG_c1042757 3300000089 Bacteria 1074
127 JGI24698J34947_10101340 3300002449 Unclassified 1294
128 JGI24698J34947_10119982 3300002449 Bacteria 1143
129 Ga0072940_1254688 3300005200 Bacteria 904
130 Ga0466732_092388 3300042656 Bacteria 4828
131 Ga0466732_178938 3300042656 Unclassified 3639
132 Ga0466718_017559 3300042617 Bacteria 3208
133 Ga0466718_047741 3300042617 Bacteria 2114
134 Ga0466693_276147 3300042592 Bacteria 1085
135 Ga0466694_028845 3300042594 Bacteria 1722
136 Ga0466731_034302 3300042622 Bacteria 6869
137 Ga0123356_10047937 3300010049 Bacteria 3975
138 Ga0123356_10641235 3300010049 Bacteria 1229
139 Ga0123353_10226358 3300010167 Bacteria 2919
140 Ga0466720_014287 3300042607 Bacteria 6510
141 Ga0466720_053229 3300042607 Bacteria 1755
142 Ga0466720_135334 3300042607 Bacteria 2018
143 AustNasuHG_c1010952 3300000089 Unclassified 3148
144 JGI24698J34947_10198204 3300002449 Unclassified 788
145 JGI24698J34947_10312985 3300002449 Bacteria 562
146 JGI24695J34938_10074389 3300002450 Bacteria 1413
147 JGI24695J34938_10154546 3300002450 Unclassified 941
148 Ga0466732_092224 3300042656 Bacteria 3897
149 Ga0466732_283877 3300042656 Bacteria 2188
150 Ga0466732_306800 3300042656 Bacteria 1125
151 Ga0466712_135660 3300042614 Unclassified 1929
152 Ga0466712_246102 3300042614 Bacteria 4737
153 Ga0466715_136031 3300042616 Bacteria 1081
154 Ga0466718_042872 3300042617 Unclassified 2266
155 Ga0466718_097981 3300042617 Unclassified 1664
156 Ga0466723_040433 3300042618 Bacteria 1532
157 Ga0415639_051162 3300038395 Bacteria 4831
158 Ga0466690_021480 3300042590 Bacteria 4265
159 Ga0466694_404720 3300042594 Bacteria 2227
160 Ga0466704_004848 3300042643 Bacteria 3791
161 Ga0466722_045521 3300042609 Bacteria 5517
162 AustNasuHG_c1001622 3300000089 Bacteria 8108
163 AustNasuHG_c1004857 3300000089 Bacteria 4811
164 FAAS_10486071 3300001880 Bacteria 530
165 JGI24698J34947_10087254 3300002449 Bacteria 1443
166 JGI24698J34947_10292198 3300002449 Unclassified 591
167 JGI24698J34947_10325962 3300002449 Unclassified 545
168 JGI24695J34938_10090676 3300002450 Archaea 1254
169 JGI24699J35502_10618720 3300002509 Unclassified 696
170 JGI24699J35502_10733781 3300002509 Unclassified 800
171 Ga0466733_207493 3300042659 Bacteria 1334
172 Ga0466712_226811 3300042614 Bacteria 1450
173 Ga0466712_298982 3300042614 Unclassified 1610
174 Ga0466718_088015 3300042617 Unclassified 1360
175 Ga0466718_105816 3300042617 Bacteria 1714
176 Ga0264413_100696 3300024493 Bacteria 17520
177 Ga0466694_064650 3300042594 Bacteria 1306
178 Ga0466694_068724 3300042594 Bacteria 15512

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_427550 Ga0466732_427550_150_500 103
2 3300042652 Ga0466708_018272 Ga0466708_018272_187_501 104
3 3300024493 Ga0264413_100696 Ga0264413_10069613 106
4 3300024493 Ga0264413_101335 Ga0264413_1013353 106
5 3300038395 Ga0415639_020980 Ga0415639_020980_1705_2025 106
6 3300038395 Ga0415639_051162 Ga0415639_051162_231_551 106
7 3300038395 Ga0415639_127991 Ga0415639_127991_91_411 106
8 3300042592 Ga0466693_276147 Ga0466693_276147_602_922 106
9 3300042594 Ga0466694_019308 Ga0466694_019308_443_763 106
10 3300042594 Ga0466694_028845 Ga0466694_028845_253_573 106
11 3300042594 Ga0466694_068724 Ga0466694_068724_12576_12896 106
12 3300042594 Ga0466694_157518 Ga0466694_157518_30_350 106
13 3300042597 Ga0466699_014312 Ga0466699_014312_608_928 106
14 3300042597 Ga0466699_148759 Ga0466699_148759_1414_1734 106
15 3300042607 Ga0466720_043968 Ga0466720_043968_572_892 106
16 3300042607 Ga0466720_057081 Ga0466720_057081_452_772 106
17 3300042607 Ga0466720_063325 Ga0466720_063325_780_1100 106
18 3300042607 Ga0466720_069293 Ga0466720_069293_504_824 106
19 3300042607 Ga0466720_113394 Ga0466720_113394_3925_4245 106
20 3300042607 Ga0466720_178854 Ga0466720_178854_4325_4645 106
21 3300042609 Ga0466722_045521 Ga0466722_045521_65_385 106
22 3300042610 Ga0466698_038726 Ga0466698_038726_611_931 106
23 3300042610 Ga0466698_071674 Ga0466698_071674_3445_3765 106
24 3300042614 Ga0466712_183737 Ga0466712_183737_873_1193 106
25 3300042614 Ga0466712_271304 Ga0466712_271304_673_993 106
26 3300042614 Ga0466712_272587 Ga0466712_272587_1899_2219 106
27 3300042616 Ga0466715_180970 Ga0466715_180970_752_1072 106
28 3300042617 Ga0466718_012225 Ga0466718_012225_160_480 106
29 3300042617 Ga0466718_042872 Ga0466718_042872_1794_2114 106
30 3300042617 Ga0466718_101536 Ga0466718_101536_1825_2145 106
31 3300042617 Ga0466718_105399 Ga0466718_105399_498_818 106
32 3300042618 Ga0466723_040433 Ga0466723_040433_901_1221 106
33 3300042643 Ga0466704_004848 Ga0466704_004848_2996_3316 106
34 3300042656 Ga0466732_178798 Ga0466732_178798_696_1016 106
35 3300042656 Ga0466732_178938 Ga0466732_178938_836_1156 106
36 3300042656 Ga0466732_306800 Ga0466732_306800_207_527 106
37 3300042659 Ga0466733_207493 Ga0466733_207493_395_715 106
38 iso_pr_bacteria 2781125635 2781278066 106
39 iso_pr_bacteria 2781125637 2781282080 106
40 iso_pr_bacteria 2781125645 2781298892 106
41 iso_pr_bacteria 2781125649 2781306702 106
42 iso_pr_bacteria 2781125661 2781334992 106
43 3300000089 AustNasuHG_c1001622 AustNasuHG_10016226 107
44 3300000089 AustNasuHG_c1004857 AustNasuHG_10048571 107
45 3300000089 AustNasuHG_c1010952 AustNasuHG_10109524 107
46 3300000089 AustNasuHG_c1012332 AustNasuHG_10123325 107
47 3300000089 AustNasuHG_c1012663 AustNasuHG_10126632 107
48 3300000089 AustNasuHG_c1012993 AustNasuHG_10129931 107
49 3300000089 AustNasuHG_c1014488 AustNasuHG_10144883 107
50 3300001880 FAAS_10486071 FAAS_104860712 107
51 3300001880 FAAS_10835561 FAAS_108355611 107
52 3300002449 JGI24698J34947_10042727 JGI24698J34947_100427272 107
53 3300002449 JGI24698J34947_10047668 JGI24698J34947_100476684 107
54 3300002449 JGI24698J34947_10087254 JGI24698J34947_100872543 107
55 3300002449 JGI24698J34947_10095577 JGI24698J34947_100955772 107
56 3300002449 JGI24698J34947_10101340 JGI24698J34947_101013401 107
57 3300002449 JGI24698J34947_10119982 JGI24698J34947_101199822 107
58 3300002449 JGI24698J34947_10198204 JGI24698J34947_101982042 107
59 3300002449 JGI24698J34947_10292198 JGI24698J34947_102921981 107
60 3300002449 JGI24698J34947_10318363 JGI24698J34947_103183631 107
61 3300002450 JGI24695J34938_10000381 JGI24695J34938_100003814 107
62 3300002450 JGI24695J34938_10002386 JGI24695J34938_100023864 107
63 3300002450 JGI24695J34938_10021158 JGI24695J34938_100211582 107
64 3300002450 JGI24695J34938_10022542 JGI24695J34938_100225424 107
65 3300002450 JGI24695J34938_10032397 JGI24695J34938_100323974 107
66 3300002450 JGI24695J34938_10033987 JGI24695J34938_100339872 107
67 3300002450 JGI24695J34938_10049393 JGI24695J34938_100493931 107
68 3300002450 JGI24695J34938_10074389 JGI24695J34938_100743892 107
69 3300002450 JGI24695J34938_10090676 JGI24695J34938_100906762 107
70 3300002450 JGI24695J34938_10154546 JGI24695J34938_101545462 107
71 3300002450 JGI24695J34938_10160423 JGI24695J34938_101604232 107
72 3300002450 JGI24695J34938_10164935 JGI24695J34938_101649352 107
73 3300002450 JGI24695J34938_10183587 JGI24695J34938_101835871 107
74 3300002450 JGI24695J34938_10383689 JGI24695J34938_103836891 107
75 3300002509 JGI24699J35502_10618720 JGI24699J35502_106187202 107
76 3300002509 JGI24699J35502_10733781 JGI24699J35502_107337811 107
77 3300002834 JGI24696J40584_12953287 JGI24696J40584_129532874 107
78 3300005200 Ga0072940_1038467 Ga0072940_10384673 107
79 3300005200 Ga0072940_1254688 Ga0072940_12546882 107
80 3300005201 Ga0072941_1017224 Ga0072941_101722416 107
81 3300005201 Ga0072941_1023773 Ga0072941_10237734 107
82 3300005201 Ga0072941_1024457 Ga0072941_10244573 107
83 3300009826 Ga0123355_12130422 Ga0123355_121304221 107
84 3300010049 Ga0123356_10047937 Ga0123356_100479376 107
85 3300010049 Ga0123356_10050539 Ga0123356_100505395 107
86 3300010049 Ga0123356_10117740 Ga0123356_101177404 107
87 3300010049 Ga0123356_10641235 Ga0123356_106412352 107
88 3300010049 Ga0123356_10900847 Ga0123356_109008472 107
89 3300010049 Ga0123356_11213215 Ga0123356_112132151 107
90 3300010167 Ga0123353_10178887 Ga0123353_101788873 107
91 3300010167 Ga0123353_10226358 Ga0123353_102263582 107
92 3300010167 Ga0123353_10669370 Ga0123353_106693701 107
93 3300010167 Ga0123353_11905834 Ga0123353_119058341 107
94 3300024493 Ga0264413_124392 Ga0264413_1243924 107
95 3300042590 Ga0466690_021480 Ga0466690_021480_2432_2755 107
96 3300042594 Ga0466694_144661 Ga0466694_144661_1130_1453 107
97 3300042607 Ga0466720_014287 Ga0466720_014287_2812_3135 107
98 3300042607 Ga0466720_124320 Ga0466720_124320_3396_3719 107
99 3300042614 Ga0466712_062960 Ga0466712_062960_209_532 107
100 3300042614 Ga0466712_246102 Ga0466712_246102_3091_3414 107
101 3300042614 Ga0466712_318652 Ga0466712_318652_3251_3574 107
102 3300042617 Ga0466718_047741 Ga0466718_047741_636_959 107
103 3300042617 Ga0466718_147793 Ga0466718_147793_4108_4431 107
104 iso_pr_bacteria 2781125650 2781308884 107
105 iso_pr_bacteria 2781125661 2781332539 107
106 3300000089 AustNasuHG_c1010649 AustNasuHG_10106496 108
107 3300000089 AustNasuHG_c1014216 AustNasuHG_10142163 108
108 3300002449 JGI24698J34947_10000292 JGI24698J34947_1000029215 108
109 3300002449 JGI24698J34947_10027632 JGI24698J34947_100276322 108
110 3300002449 JGI24698J34947_10078031 JGI24698J34947_100780312 108
111 3300002449 JGI24698J34947_10312985 JGI24698J34947_103129852 108
112 3300002450 JGI24695J34938_10001068 JGI24695J34938_1000106819 108
113 3300005200 Ga0072940_1067132 Ga0072940_10671321 108
114 3300010049 Ga0123356_10000269 Ga0123356_1000026935 108
115 3300010049 Ga0123356_10050288 Ga0123356_100502885 108
116 3300010049 Ga0123356_10355028 Ga0123356_103550282 108
117 3300010167 Ga0123353_12288372 Ga0123353_122883722 108
118 3300010882 Ga0123354_10100907 Ga0123354_101009074 108
119 3300042594 Ga0466694_404720 Ga0466694_404720_1419_1745 108
120 3300042616 Ga0466715_136031 Ga0466715_136031_580_906 108
121 3300002450 JGI24695J34938_10107244 JGI24695J34938_101072442 109
122 3300042594 Ga0466694_194774 Ga0466694_194774_1220_1549 109
123 3300042614 Ga0466712_135660 Ga0466712_135660_1424_1753 109
124 3300042614 Ga0466712_298982 Ga0466712_298982_689_1018 109
125 3300002449 JGI24698J34947_10325962 JGI24698J34947_103259621 110
126 3300042594 Ga0466694_064650 Ga0466694_064650_430_762 110
127 3300042594 Ga0466694_230555 Ga0466694_230555_220_552 110
128 3300042597 Ga0466699_129070 Ga0466699_129070_60_392 110
129 3300042597 Ga0466699_180708 Ga0466699_180708_864_1196 110
130 3300042610 Ga0466698_263470 Ga0466698_263470_2095_2427 110
131 3300042617 Ga0466718_108536 Ga0466718_108536_297_629 110
132 3300042622 Ga0466731_425550 Ga0466731_425550_2465_2797 110
133 3300005200 Ga0072940_1013263 Ga0072940_10132639 111
134 3300010167 Ga0123353_10979421 Ga0123353_109794212 111
135 3300024493 Ga0264413_116659 Ga0264413_1166595 111
136 3300024493 Ga0264413_145868 Ga0264413_1458681 111
137 3300042594 Ga0466694_236771 Ga0466694_236771_684_1019 111
138 3300042594 Ga0466694_402432 Ga0466694_402432_4577_4912 111
139 3300042607 Ga0466720_053229 Ga0466720_053229_833_1168 111
140 3300042607 Ga0466720_066678 Ga0466720_066678_27_362 111
141 3300042607 Ga0466720_135334 Ga0466720_135334_389_724 111
142 3300042607 Ga0466720_135900 Ga0466720_135900_1939_2274 111
143 3300042607 Ga0466720_140937 Ga0466720_140937_226_561 111
144 3300042607 Ga0466720_221088 Ga0466720_221088_8917_9252 111
145 3300042614 Ga0466712_226811 Ga0466712_226811_748_1083 111
146 3300042617 Ga0466718_008611 Ga0466718_008611_1118_1453 111
147 3300042617 Ga0466718_017559 Ga0466718_017559_1327_1662 111
148 3300042617 Ga0466718_035590 Ga0466718_035590_734_1069 111
149 3300042617 Ga0466718_075327 Ga0466718_075327_1558_1893 111
150 3300042617 Ga0466718_088015 Ga0466718_088015_20_355 111
151 3300042617 Ga0466718_097981 Ga0466718_097981_288_623 111
152 3300042617 Ga0466718_105816 Ga0466718_105816_802_1137 111
153 3300042617 Ga0466718_146770 Ga0466718_146770_168_503 111
154 3300042622 Ga0466731_034302 Ga0466731_034302_4159_4494 111
155 3300042635 Ga0466702_450656 Ga0466702_450656_242_577 111
156 3300042656 Ga0466732_186284 Ga0466732_186284_5438_5773 111
157 3300042656 Ga0466732_283877 Ga0466732_283877_489_824 111
158 3300000089 AustNasuHG_c1011337 AustNasuHG_10113371 112
159 3300000089 AustNasuHG_c1012502 AustNasuHG_10125024 112
160 3300000089 AustNasuHG_c1012561 AustNasuHG_10125611 112
161 3300000089 AustNasuHG_c1042757 AustNasuHG_10427573 112
162 3300001880 FAAS_10657090 FAAS_106570902 112
163 3300002449 JGI24698J34947_10014474 JGI24698J34947_100144742 112
164 3300002449 JGI24698J34947_10018569 JGI24698J34947_100185694 112
165 3300002449 JGI24698J34947_10069225 JGI24698J34947_100692253 112
166 3300002449 JGI24698J34947_10081056 JGI24698J34947_100810561 112
167 3300002449 JGI24698J34947_10146063 JGI24698J34947_101460632 112
168 3300002450 JGI24695J34938_10014282 JGI24695J34938_100142824 112
169 3300002462 JGI24702J35022_10845440 JGI24702J35022_108454402 112
170 3300002507 JGI24697J35500_11201915 JGI24697J35500_112019152 112
171 3300005200 Ga0072940_1010137 Ga0072940_10101371 112
172 3300005200 Ga0072940_1072626 Ga0072940_10726262 112
173 3300010049 Ga0123356_10044059 Ga0123356_100440592 112
174 3300042635 Ga0466702_343424 Ga0466702_343424_230_568 112
175 3300042617 Ga0466718_026075 Ga0466718_026075_2238_2579 113
176 3300042617 Ga0466718_134158 Ga0466718_134158_2238_2579 113
177 3300042656 Ga0466732_092224 Ga0466732_092224_3434_3775 113
178 iso_pr_bacteria 2781125665 2781341017 113
179 3300005201 Ga0072941_1073722 Ga0072941_10737223 114
180 3300010049 Ga0123356_10000102 Ga0123356_1000010289 114
181 3300042594 Ga0466694_032257 Ga0466694_032257_854_1201 115
182 3300042604 Ga0466717_204132 Ga0466717_204132_55_402 115
183 3300042594 Ga0466694_103729 Ga0466694_103729_7237_7587 116
184 3300010049 Ga0123356_10071986 Ga0123356_100719864 119
185 3300038395 Ga0415639_114097 Ga0415639_114097_1116_1487 123
186 3300042656 Ga0466732_092388 Ga0466732_092388_2124_2510 128

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12844 HTH_19 Helix-turn-helix domain 32 94 0.97
PF13560 HTH_31 Helix-turn-helix domain 31 85 0.92
PF01381 HTH_3 Helix-turn-helix 41 85 0.91

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1y7y-assembly1.cif.gz_B High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila 0.983 28 90
3f52-assembly1.cif.gz_E Crystal structure of the clp gene regulator ClgR from C. glutamicum 0.968 27 90
1y7y-assembly1.cif.gz_A High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila 0.965 25 90
4yba-assembly1.cif.gz_A The structure of the C.Kpn2I controller protein 0.965 35 83
3zkc-assembly1.cif.gz_B Crystal structure of the master regulator for biofilm formation SinR in complex with DNA. 0.957 31 91
IDDescriptionScoreStartEndSuperfamily
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9832 28 90 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9679 27 90 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9649 25 90 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9648 35 83 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9615 24 90 1.10.260.40
IDDescriptionScoreStartEndGO Terms
AF-A0A3M1ZZ09-F1-model_v4 Uncharacterized/unreviewed 0.997 20 91
AF-A0A420FTH1-F1-model_v4 Uncharacterized/unreviewed 0.9968 19 92 GO:0003677
AF-A0A6J7KRH3-F1-model_v4 Uncharacterized/unreviewed 0.9957 17 91 GO:0005829
GO:0003677
GO:0003700

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.