Protein Family IF10225

Metagenome Metatranscriptome Isolate
229 Members
96 Samples
199 Scaffolds
62.1 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_053935|Ga0466732_053935_25_252
Length
75 aa
Sequence
MVPLQFELENIKIMAKKNKEARQQIILECTEQKTSGIAGMSRYISTKNRKNSPERLELKKYNPFLKKVTVHKEIK

📊 Sample Types

Isolate 13.1%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.8%
Unclassified 19.6%
Kalotermitidae 15.2%
Elmidae 4.3%
Pseudophyllodromiidae 3.3%
Culicidae 3.3%
Rhinotermitidae 3.3%
Formicidae 2.2%
Passalidae 2.2%
Blattidae 2.2%
Termopsidae 2.2%
Hodotermitidae 1.1%
Aphididae 1.1%
Tryonicidae 1.1%
Daphniidae 1.1%
Cambaridae 1.1%
Nephropidae 1.1%
Drosophilidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 79

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2882250448 Bizionia sp. APA-3 Isolate
2 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3002026254 Blattabacterium cuenoti BALTAsp Isolate Pseudophyllodromiidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
13 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3002031819 Blattabacterium cuenoti SHELFORDIsp Isolate Pseudophyllodromiidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
34 2864836148 Arcicella rosea S00070 Isolate Elmidae
35 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
36 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
41 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
42 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
43 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
44 3002022645 Blattabacterium cuenoti TRYONIpar Isolate Tryonicidae
45 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
55 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
56 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
57 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
58 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
66 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
67 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
70 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
71 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
75 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
76 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
77 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
78 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
79 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
80 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
81 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
82 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
83 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
84 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
85 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
86 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
87 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
88 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
89 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
90 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
91 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
92 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
93 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
94 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
95 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
96 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_045970 3300042612 Bacteria 6685
2 Ga0466705_138505 3300042612 Bacteria 4048
3 Ga0466715_523101 3300042616 Bacteria 3340
4 Ga0466726_485687 3300042619 Bacteria 5085
5 Ga0466729_152690 3300042621 Bacteria 1416
6 Ga0123355_10295375 3300009826 Bacteria 2217
7 Ga0123356_11963125 3300010049 Bacteria 729
8 Ga0123353_10126978 3300010167 Bacteria 4098
9 Ga0123353_11692404 3300010167 Unclassified 793
10 Ga0123354_10179874 3300010882 Unclassified 2420
11 Ga0160471_122075 3300012812 Bacteria 566
12 Ga0466729_222099 3300042621 Bacteria 9877
13 Ga0466709_207629 3300042648 Bacteria 2798
14 Ga0466708_170875 3300042652 Bacteria 19923
15 Ga0466727_071315 3300042655 Bacteria 5261
16 Ga0466706_079875 3300042599 Unclassified 1366
17 Ga0466716_040990 3300042605 Bacteria 3678
18 Ga0160459_120352 3300012831 Unclassified 713
19 Ga0466692_191312 3300042591 Bacteria 9441
20 Ga0466693_448766 3300042592 Unclassified 1334
21 IMNBL1DRAFT_c0037434 3300000062 Bacteria 1681
22 IMNBL1DRAFT_c0052720 3300000062 Unclassified 1272
23 JGI24699J35502_10433241 3300002509 Bacteria 580
24 Ga0068305_10421606 3300005083 Bacteria 2347
25 Ga0103264_1000031 3300007188 Bacteria 88926
26 Ga0466697_144690 3300042611 Unclassified 1705
27 Ga0466732_012384 3300042656 Bacteria 6388
28 Ga0466732_301888 3300042656 Unclassified 2903
29 Ga0466733_096297 3300042659 Unclassified 6297
30 Ga0466711_009899 3300042615 Bacteria 28031
31 Ga0466726_300616 3300042619 Bacteria 2863
32 Ga0123356_10004417 3300010049 Bacteria 14534
33 Ga0123353_10955867 3300010167 Unclassified 1158
34 Ga0466729_285140 3300042621 Bacteria 9746
35 Ga0466731_255059 3300042622 Unclassified 3500
36 Ga0466725_097183 3300042654 Bacteria 17786
37 Ga0466707_376833 3300042601 Bacteria 9714
38 Ga0466722_025381 3300042609 Bacteria 16120
39 Ga0255786_1026738 3300022815 Bacteria 988
40 Ga0466656_070045 3300042550 Bacteria 1284
41 Ga0466690_394866 3300042590 Bacteria 116329
42 Ga0466694_375854 3300042594 Unclassified 2126
43 2227465524 2225789004 Unclassified 974
44 JGI24702J35022_10012592 3300002462 Unclassified 4696
45 Ga0105005_1100372 3300007505 Bacteria 2255
46 Ga0466732_053935 3300042656 Bacteria 1342
47 Ga0466715_224612 3300042616 Bacteria 7778
48 Ga0466723_314940 3300042618 Bacteria 4877
49 Ga0466729_116601 3300042621 Bacteria 6871
50 Ga0466729_180507 3300042621 Bacteria 9099
51 Ga0123356_11636188 3300010049 Unclassified 798
52 Ga0123356_13162616 3300010049 Unclassified 573
53 Ga0123353_10168242 3300010167 Unclassified 3482
54 Ga0123354_10471383 3300010882 Bacteria 1000
55 Ga0466703_305977 3300042636 Unclassified 3419
56 Ga0466704_461004 3300042643 Bacteria 8737
57 Ga0466727_080573 3300042655 Bacteria 1778
58 Ga0466706_057633 3300042599 Bacteria 4689
59 Ga0466713_141397 3300042602 Bacteria 4712
60 Ga0466720_212859 3300042607 Unclassified 1289
61 Ga0466698_284397 3300042610 Bacteria 1178
62 Ga0466656_111342 3300042550 Bacteria 1647
63 Ga0466692_108411 3300042591 Bacteria 15895
64 Ga0466693_112491 3300042592 Unclassified 1395
65 Ga0466695_160287 3300042595 Unclassified 1136
66 Ga0466695_243041 3300042595 Unclassified 1840
67 Ga0466699_230644 3300042597 Unclassified 2018
68 2227574615 2225789004 Bacteria 13777
69 IMNBL1DRAFT_c0011574 3300000062 Bacteria 4112
70 JGI24695J34938_10176038 3300002450 Unclassified 884
71 JGI24702J35022_10004789 3300002462 Bacteria 7993
72 JGI24702J35022_10019861 3300002462 Unclassified 3653
73 JGI24702J35022_10152817 3300002462 Bacteria 1296
74 Ga0103267_1000282 3300007190 Unclassified 19664
75 Ga0127649_100753 3300009460 Bacteria 72069
76 Ga0466732_248632 3300042656 Unclassified 1413
77 Ga0466733_152570 3300042659 Bacteria 60084
78 Ga0466710_211503 3300042613 Unclassified 1038
79 Ga0466710_378434 3300042613 Unclassified 1940
80 Ga0466715_235999 3300042616 Bacteria 4568
81 Ga0466728_340570 3300042620 Bacteria 1960
82 Ga0123357_10149746 3300009784 Bacteria 2837
83 Ga0123355_11818724 3300009826 Bacteria 574
84 Ga0123356_10072424 3300010049 Unclassified 3237
85 Ga0123356_10791947 3300010049 Unclassified 1119
86 Ga0123356_11875228 3300010049 Unclassified 746
87 Ga0123353_10360970 3300010167 Unclassified 2183
88 Ga0123353_10657476 3300010167 Unclassified 1482
89 Ga0466731_021732 3300042622 Bacteria 1039
90 Ga0466708_131174 3300042652 Bacteria 21946
91 Ga0466701_032206 3300042598 Bacteria 3049
92 Ga0466701_048254 3300042598 Bacteria 1778
93 Ga0466713_108603 3300042602 Bacteria 12563
94 Ga0466717_173099 3300042604 Unclassified 1023
95 Ga0466719_212331 3300042606 Bacteria 1153
96 Ga0466722_086635 3300042609 Bacteria 4339
97 Ga0415639_127654 3300038395 Unclassified 1059
98 Ga0466701_008346 3300042598 Bacteria 3738
99 IMNBL1DRAFT_c0042068 3300000062 Unclassified 1527
100 IMNBL1DRAFT_c0112913 3300000062 Bacteria 720
101 JGI24695J34938_10062722 3300002450 Unclassified 1577
102 JGI24705J35276_12219990 3300002504 Unclassified 2238
103 JGI24696J40584_12897152 3300002834 Unclassified 1163
104 JGI24696J40584_12906240 3300002834 Bacteria 1220
105 JGI24696J40584_12956663 3300002834 Unclassified 3187
106 Ga0466715_054005 3300042616 Unclassified 2933
107 Ga0466715_230175 3300042616 Unclassified 1651
108 Ga0466723_345193 3300042618 Bacteria 1990
109 Ga0466728_182834 3300042620 Unclassified 1308
110 Ga0123355_10000003 3300009826 Bacteria 224088
111 Ga0123353_12145616 3300010167 Unclassified 678
112 Ga0466729_203921 3300042621 Bacteria 1355
113 Ga0466731_094301 3300042622 Bacteria 71133
114 Ga0466703_345312 3300042636 Bacteria 2445
115 Ga0466709_183247 3300042648 Bacteria 3970
116 Ga0466727_180441 3300042655 Bacteria 4321
117 Ga0466701_066521 3300042598 Bacteria 14955
118 Ga0466706_021441 3300042599 Bacteria 78920
119 Ga0466700_357923 3300042600 Bacteria 6283
120 Ga0466722_118799 3300042609 Bacteria 5856
121 Ga0466697_032966 3300042611 Bacteria 1214
122 Ga0466657_259302 3300042582 Bacteria 12981
123 Ga0466696_346629 3300042596 Unclassified 1134
124 2227518832 2225789004 Unclassified 671
125 Ga0466733_038690 3300042659 Bacteria 100300
126 Ga0466729_074859 3300042621 Bacteria 14023
127 Ga0123356_10874694 3300010049 Bacteria 1070
128 Ga0123356_12367605 3300010049 Unclassified 664
129 Ga0123353_10000041 3300010167 Bacteria 137212
130 Ga0123353_10079546 3300010167 Unclassified 5270
131 Ga0123353_13389417 3300010167 Unclassified 506
132 Ga0466734_102924 3300042623 Unclassified 1978
133 Ga0466706_121373 3300042599 Bacteria 45048
134 Ga0466706_128660 3300042599 Bacteria 41980
135 Ga0466700_331025 3300042600 Bacteria 1027
136 Ga0466714_015825 3300042603 Bacteria 102725
137 Ga0466722_174660 3300042609 Bacteria 3818
138 Ga0415639_136978 3300038395 Unclassified 1853
139 Ga0466690_060977 3300042590 Unclassified 3591
140 Ga0466690_198735 3300042590 Bacteria 14984
141 Ga0466694_013682 3300042594 Unclassified 3150
142 Ga0466694_215724 3300042594 Unclassified 3480
143 Ga0466695_310116 3300042595 Bacteria 1279
144 Ga0466699_231248 3300042597 Unclassified 1976
145 2227486679 2225789004 Bacteria 815
146 JGI24696J40584_12803151 3300002834 Unclassified 873
147 JGI24696J40584_12951665 3300002834 Unclassified 2266
148 Ga0072941_1315850 3300005201 Bacteria 756
149 Ga0466697_135422 3300042611 Unclassified 2478
150 Ga0466733_135608 3300042659 Unclassified 1594
151 Ga0466710_033506 3300042613 Bacteria 2617
152 Ga0466710_180526 3300042613 Unclassified 2053
153 Ga0466710_404631 3300042613 Bacteria 2296
154 Ga0466711_288037 3300042615 Bacteria 4448
155 Ga0466711_331426 3300042615 Bacteria 7251
156 Ga0466715_018721 3300042616 Bacteria 59480
157 Ga0466723_115921 3300042618 Unclassified 3478
158 Ga0466723_204706 3300042618 Bacteria 1474
159 Ga0123355_10002918 3300009826 Bacteria 24295
160 Ga0123356_12065684 3300010049 Unclassified 711
161 Ga0123353_10357296 3300010167 Bacteria 2197
162 Ga0123353_10971459 3300010167 Unclassified 1146
163 Ga0123353_12678180 3300010167 Unclassified 588
164 Ga0123353_12955327 3300010167 Bacteria 552
165 Ga0466727_025519 3300042655 Bacteria 1080
166 Ga0466701_027187 3300042598 Bacteria 1966
167 Ga0466701_043606 3300042598 Bacteria 24638
168 Ga0466701_097857 3300042598 Bacteria 3598
169 Ga0466700_308703 3300042600 Bacteria 1484
170 Ga0466714_015759 3300042603 Bacteria 13284
171 Ga0466721_006866 3300042608 Bacteria 1103
172 Ga0160440_118599 3300012815 Unclassified 598
173 Ga0466657_119731 3300042582 Unclassified 1821
174 Ga0466690_081262 3300042590 Bacteria 11472
175 Ga0466690_130976 3300042590 Bacteria 5979
176 Ga0466691_050111 3300042593 Bacteria 49131
177 Ga0466696_305779 3300042596 Unclassified 1099
178 JGI24696J40584_12908042 3300002834 Unclassified 1233
179 Ga0466733_193881 3300042659 Unclassified 9464
180 Ga0466710_358407 3300042613 Bacteria 4106
181 Ga0466715_253205 3300042616 Bacteria 7992
182 Ga0466729_151093 3300042621 Unclassified 1837
183 Ga0123357_10284154 3300009784 Unclassified 1703
184 Ga0123355_11640135 3300009826 Unclassified 617
185 Ga0123356_10294308 3300010049 Unclassified 1725
186 Ga0123356_10431708 3300010049 Bacteria 1462
187 Ga0123353_10714339 3300010167 Unclassified 1403
188 Ga0466734_049571 3300042623 Unclassified 1515
189 Ga0466719_372678 3300042606 Bacteria 2620
190 Ga0466721_099063 3300042608 Bacteria 1729
191 Ga0466698_498956 3300042610 Unclassified 3339
192 Ga0160472_100005 3300012839 Bacteria 734812
193 Ga0466692_062645 3300042591 Bacteria 1632
194 Ga0466691_011534 3300042593 Bacteria 26579
195 Ga0466696_415766 3300042596 Unclassified 1484
196 IMNBL1DRAFT_c0044762 3300000062 Bacteria 1451
197 JGI24695J34938_10114017 3300002450 Bacteria 1101
198 JGI24702J35022_10000345 3300002462 Bacteria 27477
199 JGI24696J40584_12480901 3300002834 Unclassified 590

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_108411 Ga0466692_108411_12153_12335 60
2 3300042591 Ga0466692_191312 Ga0466692_191312_5247_5429 60
3 3300042596 Ga0466696_415766 Ga0466696_415766_186_368 60
4 3300042598 Ga0466701_066521 Ga0466701_066521_239_421 60
5 3300042599 Ga0466706_021441 Ga0466706_021441_13544_13726 60
6 3300042599 Ga0466706_079875 Ga0466706_079875_807_989 60
7 3300042599 Ga0466706_121373 Ga0466706_121373_36658_36840 60
8 3300042599 Ga0466706_128660 Ga0466706_128660_35720_35902 60
9 3300042600 Ga0466700_308703 Ga0466700_308703_288_470 60
10 3300042602 Ga0466713_141397 Ga0466713_141397_4121_4303 60
11 3300042605 Ga0466716_040990 Ga0466716_040990_2090_2272 60
12 3300042606 Ga0466719_212331 Ga0466719_212331_912_1094 60
13 3300042609 Ga0466722_025381 Ga0466722_025381_14859_15041 60
14 3300042609 Ga0466722_118799 Ga0466722_118799_2661_2843 60
15 3300042615 Ga0466711_331426 Ga0466711_331426_6739_6921 60
16 3300042616 Ga0466715_230175 Ga0466715_230175_1250_1432 60
17 3300042618 Ga0466723_314940 Ga0466723_314940_309_491 60
18 3300042618 Ga0466723_345193 Ga0466723_345193_1155_1337 60
19 3300042621 Ga0466729_152690 Ga0466729_152690_526_708 60
20 3300042621 Ga0466729_203921 Ga0466729_203921_713_895 60
21 3300042648 Ga0466709_207629 Ga0466709_207629_501_683 60
22 3300042654 Ga0466725_097183 Ga0466725_097183_8522_8704 60
23 3300042655 Ga0466727_071315 Ga0466727_071315_2509_2691 60
24 3300042655 Ga0466727_180441 Ga0466727_180441_2427_2609 60
25 iso_pr_bacteria 2561511170 2562331815 60
26 iso_pr_bacteria 2687453786 2690170447 60
27 iso_pr_bacteria 2811995047 2812946418 60
28 iso_pr_bacteria 2838772460 2838774188 60
29 iso_pr_bacteria 2864836148 2864838983 60
30 iso_pr_bacteria 2864878056 2864879544 60
31 iso_pr_bacteria 2864886855 2864888345 60
32 iso_pr_bacteria 2864891731 2864893350 60
33 iso_pr_bacteria 2882250448 2882251520 60
34 iso_pr_bacteria 2894649344 2894650931 60
35 iso_pr_bacteria 2921902974 2921905107 60
36 iso_pr_bacteria 2998929858 2998930745 60
37 iso_pr_bacteria 3002005207 3002005321 60
38 iso_pr_bacteria 3002022645 3002022753 60
39 iso_pr_bacteria 3002026254 3002026356 60
40 iso_pr_bacteria 3002029927 3002030038 60
41 iso_pr_bacteria 3002031819 3002031923 60
42 iso_pr_bacteria 646311912 646377336 60
43 3300005201 Ga0072941_1315850 Ga0072941_13158503 61
44 3300007188 Ga0103264_1000031 Ga0103264_10000319 61
45 3300007190 Ga0103267_1000282 Ga0103267_100028212 61
46 3300007505 Ga0105005_1100372 Ga0105005_11003724 61
47 3300009460 Ga0127649_100753 Ga0127649_10075333 61
48 3300009784 Ga0123357_10284154 Ga0123357_102841543 61
49 3300010167 Ga0123353_10357296 Ga0123353_103572964 61
50 3300012812 Ga0160471_122075 Ga0160471_1220752 61
51 3300012815 Ga0160440_118599 Ga0160440_1185992 61
52 3300012831 Ga0160459_120352 Ga0160459_1203521 61
53 3300012839 Ga0160472_100005 Ga0160472_100005101 61
54 3300042590 Ga0466690_081262 Ga0466690_081262_6895_7080 61
55 3300042618 Ga0466723_204706 Ga0466723_204706_571_756 61
56 2225789004 2227465524 2227903723 62
57 2225789004 2227486679 2227953766 62
58 2225789004 2227518832 2228020042 62
59 2225789004 2227574615 2228122012 62
60 3300022815 Ga0255786_1026738 Ga0255786_10267382 62
61 3300038395 Ga0415639_127654 Ga0415639_127654_282_470 62
62 3300038395 Ga0415639_136978 Ga0415639_136978_1376_1564 62
63 3300042550 Ga0466656_070045 Ga0466656_070045_37_225 62
64 3300042550 Ga0466656_111342 Ga0466656_111342_1235_1423 62
65 3300042582 Ga0466657_119731 Ga0466657_119731_688_876 62
66 3300042582 Ga0466657_259302 Ga0466657_259302_5259_5447 62
67 3300042590 Ga0466690_060977 Ga0466690_060977_819_1007 62
68 3300042590 Ga0466690_130976 Ga0466690_130976_1469_1657 62
69 3300042590 Ga0466690_198735 Ga0466690_198735_10428_10616 62
70 3300042590 Ga0466690_394866 Ga0466690_394866_19907_20095 62
71 3300042591 Ga0466692_062645 Ga0466692_062645_396_584 62
72 3300042592 Ga0466693_112491 Ga0466693_112491_61_249 62
73 3300042592 Ga0466693_448766 Ga0466693_448766_669_857 62
74 3300042593 Ga0466691_011534 Ga0466691_011534_20550_20738 62
75 3300042593 Ga0466691_050111 Ga0466691_050111_8317_8505 62
76 3300042594 Ga0466694_013682 Ga0466694_013682_2893_3081 62
77 3300042594 Ga0466694_215724 Ga0466694_215724_1891_2079 62
78 3300042594 Ga0466694_375854 Ga0466694_375854_1575_1763 62
79 3300042595 Ga0466695_160287 Ga0466695_160287_274_462 62
80 3300042595 Ga0466695_243041 Ga0466695_243041_990_1178 62
81 3300042595 Ga0466695_310116 Ga0466695_310116_707_895 62
82 3300042596 Ga0466696_305779 Ga0466696_305779_747_935 62
83 3300042596 Ga0466696_346629 Ga0466696_346629_393_581 62
84 3300042597 Ga0466699_230644 Ga0466699_230644_662_850 62
85 3300042597 Ga0466699_231248 Ga0466699_231248_291_479 62
86 3300042598 Ga0466701_008346 Ga0466701_008346_1393_1581 62
87 3300042598 Ga0466701_027187 Ga0466701_027187_334_522 62
88 3300042598 Ga0466701_032206 Ga0466701_032206_300_488 62
89 3300042598 Ga0466701_043606 Ga0466701_043606_22230_22418 62
90 3300042598 Ga0466701_048254 Ga0466701_048254_770_958 62
91 3300042598 Ga0466701_097857 Ga0466701_097857_1148_1336 62
92 3300042599 Ga0466706_057633 Ga0466706_057633_356_544 62
93 3300042600 Ga0466700_331025 Ga0466700_331025_540_728 62
94 3300042600 Ga0466700_357923 Ga0466700_357923_263_451 62
95 3300042601 Ga0466707_376833 Ga0466707_376833_6679_6867 62
96 3300042602 Ga0466713_108603 Ga0466713_108603_4998_5186 62
97 3300042603 Ga0466714_015759 Ga0466714_015759_12089_12277 62
98 3300042603 Ga0466714_015825 Ga0466714_015825_62620_62808 62
99 3300042604 Ga0466717_173099 Ga0466717_173099_228_416 62
100 3300042606 Ga0466719_372678 Ga0466719_372678_401_589 62
101 3300042607 Ga0466720_212859 Ga0466720_212859_547_735 62
102 3300042608 Ga0466721_099063 Ga0466721_099063_62_250 62
103 3300042609 Ga0466722_086635 Ga0466722_086635_3699_3887 62
104 3300042609 Ga0466722_174660 Ga0466722_174660_3082_3270 62
105 3300042610 Ga0466698_284397 Ga0466698_284397_354_542 62
106 3300042610 Ga0466698_498956 Ga0466698_498956_2925_3113 62
107 3300042611 Ga0466697_032966 Ga0466697_032966_520_708 62
108 3300042611 Ga0466697_135422 Ga0466697_135422_1561_1749 62
109 3300042611 Ga0466697_144690 Ga0466697_144690_107_295 62
110 3300042612 Ga0466705_045970 Ga0466705_045970_525_713 62
111 3300042612 Ga0466705_138505 Ga0466705_138505_3781_3969 62
112 3300042613 Ga0466710_033506 Ga0466710_033506_1914_2102 62
113 3300042613 Ga0466710_180526 Ga0466710_180526_1834_2022 62
114 3300042613 Ga0466710_211503 Ga0466710_211503_394_582 62
115 3300042613 Ga0466710_358407 Ga0466710_358407_2270_2458 62
116 3300042613 Ga0466710_378434 Ga0466710_378434_1053_1241 62
117 3300042613 Ga0466710_404631 Ga0466710_404631_1319_1507 62
118 3300042615 Ga0466711_009899 Ga0466711_009899_24064_24252 62
119 3300042615 Ga0466711_288037 Ga0466711_288037_355_543 62
120 3300042616 Ga0466715_018721 Ga0466715_018721_39750_39938 62
121 3300042616 Ga0466715_054005 Ga0466715_054005_241_429 62
122 3300042616 Ga0466715_224612 Ga0466715_224612_4829_5017 62
123 3300042616 Ga0466715_235999 Ga0466715_235999_1902_2090 62
124 3300042616 Ga0466715_253205 Ga0466715_253205_7508_7696 62
125 3300042616 Ga0466715_523101 Ga0466715_523101_2054_2242 62
126 3300042618 Ga0466723_115921 Ga0466723_115921_3001_3189 62
127 3300042619 Ga0466726_300616 Ga0466726_300616_673_861 62
128 3300042620 Ga0466728_182834 Ga0466728_182834_267_455 62
129 3300042620 Ga0466728_340570 Ga0466728_340570_1260_1448 62
130 3300042621 Ga0466729_074859 Ga0466729_074859_12771_12959 62
131 3300042621 Ga0466729_116601 Ga0466729_116601_6282_6470 62
132 3300042621 Ga0466729_151093 Ga0466729_151093_1277_1465 62
133 3300042621 Ga0466729_180507 Ga0466729_180507_3296_3484 62
134 3300042621 Ga0466729_222099 Ga0466729_222099_9191_9379 62
135 3300042621 Ga0466729_285140 Ga0466729_285140_1998_2186 62
136 3300042622 Ga0466731_094301 Ga0466731_094301_58244_58432 62
137 3300042622 Ga0466731_255059 Ga0466731_255059_1171_1359 62
138 3300042623 Ga0466734_049571 Ga0466734_049571_275_463 62
139 3300042623 Ga0466734_102924 Ga0466734_102924_851_1039 62
140 3300042636 Ga0466703_305977 Ga0466703_305977_966_1154 62
141 3300042636 Ga0466703_345312 Ga0466703_345312_749_937 62
142 3300042643 Ga0466704_461004 Ga0466704_461004_4537_4725 62
143 3300042648 Ga0466709_183247 Ga0466709_183247_3223_3411 62
144 3300042652 Ga0466708_131174 Ga0466708_131174_1531_1719 62
145 3300042652 Ga0466708_170875 Ga0466708_170875_2817_3005 62
146 3300042655 Ga0466727_025519 Ga0466727_025519_129_317 62
147 3300042655 Ga0466727_080573 Ga0466727_080573_667_855 62
148 3300042656 Ga0466732_012384 Ga0466732_012384_529_717 62
149 3300042656 Ga0466732_248632 Ga0466732_248632_211_399 62
150 3300042656 Ga0466732_301888 Ga0466732_301888_1233_1421 62
151 3300042659 Ga0466733_038690 Ga0466733_038690_60656_60844 62
152 3300042659 Ga0466733_096297 Ga0466733_096297_2843_3031 62
153 3300042659 Ga0466733_135608 Ga0466733_135608_870_1058 62
154 3300042659 Ga0466733_152570 Ga0466733_152570_18262_18450 62
155 3300042659 Ga0466733_193881 Ga0466733_193881_3912_4100 62
156 iso_pr_bacteria 2820735654 2820735816 62
157 iso_pr_bacteria 2820737921 2820739550 62
158 iso_pr_bacteria 2820746860 2820748524 62
159 iso_pr_bacteria 2820751898 2820752321 62
160 iso_pr_bacteria 2820753519 2820754522 62
161 iso_pr_bacteria 2820755292 2820756659 62
162 iso_pr_bacteria 2820776227 2820778730 62
163 iso_pr_bacteria 2820783511 2820783612 62
164 iso_pr_bacteria 2820786992 2820787423 62
165 iso_pr_bacteria 2820788205 2820789534 62
166 iso_pr_bacteria 2820792843 2820793764 62
167 iso_pr_bacteria 2820795054 2820796683 62
168 3300000062 IMNBL1DRAFT_c0011574 IMNBL1DRAFT_00115745 63
169 3300000062 IMNBL1DRAFT_c0037434 IMNBL1DRAFT_00374343 63
170 3300000062 IMNBL1DRAFT_c0042068 IMNBL1DRAFT_00420682 63
171 3300000062 IMNBL1DRAFT_c0044762 IMNBL1DRAFT_00447621 63
172 3300000062 IMNBL1DRAFT_c0052720 IMNBL1DRAFT_00527202 63
173 3300000062 IMNBL1DRAFT_c0112913 IMNBL1DRAFT_01129132 63
174 3300002450 JGI24695J34938_10062722 JGI24695J34938_100627223 63
175 3300002450 JGI24695J34938_10114017 JGI24695J34938_101140173 63
176 3300002450 JGI24695J34938_10176038 JGI24695J34938_101760383 63
177 3300002462 JGI24702J35022_10000345 JGI24702J35022_100003453 63
178 3300002462 JGI24702J35022_10004789 JGI24702J35022_100047896 63
179 3300002462 JGI24702J35022_10012592 JGI24702J35022_100125922 63
180 3300002462 JGI24702J35022_10019861 JGI24702J35022_100198613 63
181 3300002462 JGI24702J35022_10152817 JGI24702J35022_101528174 63
182 3300002504 JGI24705J35276_12219990 JGI24705J35276_122199902 63
183 3300002509 JGI24699J35502_10433241 JGI24699J35502_104332412 63
184 3300002834 JGI24696J40584_12480901 JGI24696J40584_124809011 63
185 3300002834 JGI24696J40584_12803151 JGI24696J40584_128031511 63
186 3300002834 JGI24696J40584_12897152 JGI24696J40584_128971522 63
187 3300002834 JGI24696J40584_12906240 JGI24696J40584_129062404 63
188 3300002834 JGI24696J40584_12908042 JGI24696J40584_129080421 63
189 3300002834 JGI24696J40584_12951665 JGI24696J40584_129516651 63
190 3300002834 JGI24696J40584_12956663 JGI24696J40584_129566634 63
191 3300005083 Ga0068305_10421606 Ga0068305_104216063 63
192 3300009784 Ga0123357_10149746 Ga0123357_101497463 63
193 3300009826 Ga0123355_10000003 Ga0123355_10000003204 63
194 3300009826 Ga0123355_10002918 Ga0123355_100029187 63
195 3300009826 Ga0123355_10295375 Ga0123355_102953753 63
196 3300009826 Ga0123355_11640135 Ga0123355_116401353 63
197 3300009826 Ga0123355_11818724 Ga0123355_118187242 63
198 3300010049 Ga0123356_10004417 Ga0123356_100044179 63
199 3300010049 Ga0123356_10072424 Ga0123356_100724244 63
200 3300010049 Ga0123356_10294308 Ga0123356_102943083 63
201 3300010049 Ga0123356_10431708 Ga0123356_104317082 63
202 3300010049 Ga0123356_10791947 Ga0123356_107919473 63
203 3300010049 Ga0123356_11636188 Ga0123356_116361882 63
204 3300010049 Ga0123356_11875228 Ga0123356_118752281 63
205 3300010049 Ga0123356_11963125 Ga0123356_119631251 63
206 3300010049 Ga0123356_12065684 Ga0123356_120656841 63
207 3300010049 Ga0123356_12367605 Ga0123356_123676051 63
208 3300010049 Ga0123356_13162616 Ga0123356_131626161 63
209 3300010167 Ga0123353_10000041 Ga0123353_1000004198 63
210 3300010167 Ga0123353_10079546 Ga0123353_100795463 63
211 3300010167 Ga0123353_10126978 Ga0123353_101269783 63
212 3300010167 Ga0123353_10168242 Ga0123353_101682424 63
213 3300010167 Ga0123353_10360970 Ga0123353_103609703 63
214 3300010167 Ga0123353_10657476 Ga0123353_106574763 63
215 3300010167 Ga0123353_10714339 Ga0123353_107143393 63
216 3300010167 Ga0123353_10955867 Ga0123353_109558673 63
217 3300010167 Ga0123353_10971459 Ga0123353_109714592 63
218 3300010167 Ga0123353_11692404 Ga0123353_116924043 63
219 3300010167 Ga0123353_12145616 Ga0123353_121456162 63
220 3300010167 Ga0123353_12678180 Ga0123353_126781802 63
221 3300010167 Ga0123353_12955327 Ga0123353_129553272 63
222 3300010167 Ga0123353_13389417 Ga0123353_133894171 63
223 3300010882 Ga0123354_10179874 Ga0123354_101798743 63
224 3300010882 Ga0123354_10471383 Ga0123354_104713832 63
225 3300042608 Ga0466721_006866 Ga0466721_006866_211_459 65
226 3300042622 Ga0466731_021732 Ga0466731_021732_709_930 73
227 3300042619 Ga0466726_485687 Ga0466726_485687_4780_5004 74
228 3300042656 Ga0466732_053935 Ga0466732_053935_25_252 75
229 3300010049 Ga0123356_10874694 Ga0123356_108746943 87

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00471 Ribosomal_L33 Ribosomal protein L33 24 75 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.