Protein Family IF10220

Metagenome Isolate
169 Members
41 Samples
157 Scaffolds
127.69 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_025340|Ga0466732_025340_1518_1916
Length
132 aa
Sequence
VHESAENYLETILILSSRGKVRSIDIVNELEYSKPSVSVAMKNLRSKGCITTDGGCIALTDEGRKIAVSMYERHVAISDWLIFLGVDKKTAVQDACRMEHAMSEKSFSAIKKHIEKWKKETNKPDDTKPKKP

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.1%
Unclassified 30.8%
Passalidae 2.6%
Kalotermitidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
3 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
4 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
5 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
6 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
24 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
25 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
26 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
27 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
28 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
31 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
38 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1003095 3300000089 Bacteria 6007
2 JGI24698J34947_10102273 3300002449 Bacteria 1285
3 JGI24695J34938_10014832 3300002450 Bacteria 4019
4 JGI24705J35276_11493117 3300002504 Bacteria 555
5 JGI24705J35276_12139141 3300002504 Bacteria 1134
6 Ga0466712_035861 3300042614 Bacteria 4986
7 Ga0466712_053039 3300042614 Bacteria 1209
8 Ga0466712_278342 3300042614 Bacteria 2617
9 Ga0466712_297775 3300042614 Bacteria 1374
10 Ga0466712_314887 3300042614 Bacteria 10326
11 Ga0466699_012538 3300042597 Unclassified 1743
12 Ga0466699_058934 3300042597 Bacteria 1407
13 Ga0466699_218119 3300042597 Bacteria 9194
14 Ga0466699_238109 3300042597 Bacteria 1736
15 Ga0466699_242531 3300042597 Bacteria 1137
16 Ga0466699_328563 3300042597 Bacteria 1362
17 Ga0466699_359606 3300042597 Bacteria 9816
18 Ga0466720_005202 3300042607 Unclassified 4305
19 Ga0466720_020983 3300042607 Bacteria 11224
20 Ga0466720_069212 3300042607 Bacteria 9347
21 Ga0466720_098254 3300042607 Unclassified 1395
22 Ga0123355_10000488 3300009826 Bacteria 52648
23 Ga0123353_11043338 3300010167 Bacteria 1093
24 AustNasuHG_c1015454 3300000089 Bacteria 2575
25 JGI24698J34947_10240898 3300002449 Bacteria 681
26 JGI24695J34938_10005470 3300002450 Bacteria 7913
27 JGI24695J34938_10081767 3300002450 Bacteria 1334
28 JGI24702J35022_10039716 3300002462 Bacteria 2510
29 JGI24702J35022_10042064 3300002462 Bacteria 2435
30 JGI24702J35022_10541201 3300002462 Bacteria 717
31 JGI24705J35276_11600651 3300002504 Bacteria 591
32 JGI24697J35500_11266947 3300002507 Unclassified 3583
33 Ga0072941_1079929 3300005201 Bacteria 18238
34 Ga0466712_008265 3300042614 Bacteria 1129
35 Ga0466718_129342 3300042617 Archaea 5282
36 Ga0264413_102061 3300024493 Bacteria 2277
37 Ga0466699_122570 3300042597 Unclassified 2466
38 Ga0466699_172754 3300042597 Unclassified 1712
39 Ga0466699_194813 3300042597 Unclassified 1340
40 Ga0466699_387770 3300042597 Bacteria 2078
41 Ga0466720_019572 3300042607 Bacteria 7555
42 Ga0123357_10394068 3300009784 Bacteria 1268
43 Ga0123356_10188763 3300010049 Bacteria 2089
44 Ga0123353_10148173 3300010167 Bacteria 3750
45 Ga0123353_12159032 3300010167 Bacteria 675
46 AustNasuHG_c1007943 3300000089 Bacteria 3761
47 JGI24698J34947_10002453 3300002449 Bacteria 9995
48 JGI24698J34947_10058495 3300002449 Bacteria 1908
49 JGI24698J34947_10247491 3300002449 Bacteria 668
50 JGI24702J35022_10918002 3300002462 Bacteria 545
51 Ga0072941_1006989 3300005201 Bacteria 5078
52 Ga0072941_1024500 3300005201 Bacteria 1394
53 Ga0466693_091587 3300042592 Unclassified 1035
54 Ga0466714_033518 3300042603 Bacteria 19938
55 Ga0466720_021177 3300042607 Unclassified 7356
56 Ga0123357_10278316 3300009784 Bacteria 1734
57 Ga0123353_10126089 3300010167 Bacteria 4114
58 Ga0123354_10038518 3300010882 Bacteria 7420
59 Ga0123354_11052576 3300010882 Bacteria 520
60 AustNasuHG_c1014204 3300000089 Bacteria 2714
61 JGI24698J34947_10002903 3300002449 Bacteria 9293
62 JGI24698J34947_10086879 3300002449 Unclassified 1447
63 JGI24698J34947_10156987 3300002449 Unclassified 937
64 JGI24695J34938_10006167 3300002450 Bacteria 7290
65 JGI24695J34938_10103481 3300002450 Bacteria 1162
66 JGI24695J34938_10159377 3300002450 Bacteria 927
67 JGI24702J35022_10111275 3300002462 Bacteria 1506
68 JGI24705J35276_11655561 3300002504 Bacteria 613
69 Ga0074263_119771 3300005485 Unclassified 840
70 Ga0466712_150871 3300042614 Bacteria 6880
71 Ga0466715_029604 3300042616 Bacteria 97338
72 Ga0466718_043993 3300042617 Bacteria 1528
73 Ga0466656_197221 3300042550 Bacteria 1773
74 Ga0466699_138509 3300042597 Bacteria 1649
75 Ga0466699_325728 3300042597 Bacteria 11474
76 Ga0466699_381813 3300042597 Bacteria 1219
77 Ga0466720_135295 3300042607 Bacteria 9104
78 Ga0466720_217711 3300042607 Bacteria 2189
79 Ga0123353_10270143 3300010167 Bacteria 2620
80 Ga0123353_10585711 3300010167 Bacteria 1599
81 Ga0123354_11004533 3300010882 Bacteria 536
82 Ga0466732_023718 3300042656 Bacteria 2564
83 Ga0466702_272464 3300042635 Bacteria 1752
84 JGI24698J34947_10024477 3300002449 Bacteria 3223
85 JGI24698J34947_10044748 3300002449 Bacteria 2263
86 JGI24698J34947_10065255 3300002449 Bacteria 1775
87 JGI24698J34947_10087172 3300002449 Unclassified 1444
88 JGI24695J34938_10000821 3300002450 Bacteria 28895
89 JGI24695J34938_10014240 3300002450 Bacteria 4133
90 JGI24695J34938_10122331 3300002450 Bacteria 1059
91 JGI24695J34938_10161768 3300002450 Bacteria 920
92 Ga0072941_1017551 3300005201 Bacteria 6972
93 Ga0466712_066074 3300042614 Bacteria 6320
94 Ga0466712_083777 3300042614 Bacteria 8878
95 Ga0466712_085272 3300042614 Bacteria 7460
96 Ga0466712_121129 3300042614 Bacteria 2631
97 Ga0466712_237446 3300042614 Bacteria 2254
98 Ga0466712_323876 3300042614 Bacteria 1467
99 Ga0466718_030669 3300042617 Bacteria 1143
100 Ga0415639_043715 3300038395 Bacteria 2873
101 Ga0466694_028651 3300042594 Unclassified 1671
102 Ga0466699_035590 3300042597 Bacteria 1799
103 Ga0466699_090719 3300042597 Bacteria 11658
104 Ga0466699_247004 3300042597 Bacteria 1355
105 Ga0466699_443791 3300042597 Bacteria 1691
106 Ga0466714_021559 3300042603 Bacteria 2267
107 Ga0466720_069356 3300042607 Bacteria 6117
108 Ga0466732_025340 3300042656 Bacteria 3804
109 Ga0466702_270546 3300042635 Bacteria 3123
110 JGI24698J34947_10003508 3300002449 Bacteria 8519
111 JGI24698J34947_10004965 3300002449 Bacteria 7288
112 JGI24698J34947_10044758 3300002449 Bacteria 2263
113 JGI24698J34947_10079921 3300002449 Bacteria 1538
114 JGI24695J34938_10002162 3300002450 Bacteria 15341
115 JGI24695J34938_10021649 3300002450 Bacteria 3139
116 JGI24696J40584_12953977 3300002834 Bacteria 2564
117 Ga0466712_134669 3300042614 Bacteria 13333
118 Ga0466694_269583 3300042594 Bacteria 2807
119 Ga0466699_050918 3300042597 Bacteria 1266
120 Ga0466699_099509 3300042597 Bacteria 5436
121 Ga0466699_216839 3300042597 Bacteria 1144
122 Ga0466720_059350 3300042607 Bacteria 27311
123 Ga0466720_062545 3300042607 Bacteria 17805
124 Ga0466720_064009 3300042607 Unclassified 1697
125 Ga0123356_10138449 3300010049 Bacteria 2398
126 Ga0123353_10083432 3300010167 Bacteria 5142
127 Ga0123353_10443726 3300010167 Bacteria 1913
128 Ga0123353_12378051 3300010167 Unclassified 634
129 2227080807 2225789004 Bacteria 40165
130 JGI24698J34947_10004668 3300002449 Bacteria 7475
131 JGI24705J35276_11633584 3300002504 Bacteria 604
132 JGI24699J35502_11097337 3300002509 Unclassified 2268
133 Ga0466712_022092 3300042614 Bacteria 5123
134 Ga0466712_055457 3300042614 Bacteria 16691
135 Ga0466712_090232 3300042614 Bacteria 2131
136 Ga0466712_237664 3300042614 Bacteria 1289
137 Ga0466712_254852 3300042614 Bacteria 1122
138 Ga0466712_261754 3300042614 Bacteria 4997
139 Ga0415639_087480 3300038395 Bacteria 1587
140 Ga0466694_142503 3300042594 Bacteria 10299
141 Ga0466694_223281 3300042594 Bacteria 2707
142 Ga0466699_167042 3300042597 Bacteria 4024
143 Ga0466699_427813 3300042597 Bacteria 2935
144 Ga0466720_062977 3300042607 Bacteria 6347
145 Ga0466720_187419 3300042607 Bacteria 11208
146 Ga0466732_090691 3300042656 Bacteria 1183
147 Ga0466702_449492 3300042635 Bacteria 10647
148 JGI24698J34947_10008999 3300002449 Bacteria 5476
149 JGI24698J34947_10026200 3300002449 Bacteria 3100
150 JGI24698J34947_10066252 3300002449 Unclassified 1758
151 JGI24695J34938_10001404 3300002450 Bacteria 20578
152 JGI24695J34938_10084534 3300002450 Bacteria 1308
153 Ga0466712_099190 3300042614 Bacteria 4778
154 Ga0466712_142643 3300042614 Bacteria 11754
155 Ga0466718_105215 3300042617 Bacteria 3635
156 Ga0466699_034467 3300042597 Unclassified 2468
157 Ga0466720_083301 3300042607 Bacteria 8629

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10188763 Ga0123356_101887632 120
2 3300042607 Ga0466720_059350 Ga0466720_059350_10129_10491 120
3 3300042607 Ga0466720_083301 Ga0466720_083301_4859_5221 120
4 3300042614 Ga0466712_237664 Ga0466712_237664_421_783 120
5 3300042614 Ga0466712_297775 Ga0466712_297775_439_801 120
6 3300042614 Ga0466712_323876 Ga0466712_323876_82_444 120
7 3300042635 Ga0466702_270546 Ga0466702_270546_97_459 120
8 3300002449 JGI24698J34947_10002903 JGI24698J34947_100029034 121
9 3300002449 JGI24698J34947_10102273 JGI24698J34947_101022733 121
10 3300002834 JGI24696J40584_12953977 JGI24696J40584_129539772 121
11 3300005201 Ga0072941_1006989 Ga0072941_10069896 121
12 3300005201 Ga0072941_1024500 Ga0072941_10245002 121
13 3300042592 Ga0466693_091587 Ga0466693_091587_576_941 121
14 3300042617 Ga0466718_105215 Ga0466718_105215_232_597 121
15 iso_pr_bacteria 2781125643 2781294567 121
16 3300002449 JGI24698J34947_10156987 JGI24698J34947_101569872 122
17 3300002450 JGI24695J34938_10005470 JGI24695J34938_100054705 122
18 3300002450 JGI24695J34938_10021649 JGI24695J34938_100216492 122
19 3300009826 Ga0123355_10000488 Ga0123355_1000048847 122
20 3300010167 Ga0123353_10443726 Ga0123353_104437261 122
21 3300042597 Ga0466699_012538 Ga0466699_012538_345_713 122
22 3300042603 Ga0466714_021559 Ga0466714_021559_210_578 122
23 3300042607 Ga0466720_069212 Ga0466720_069212_4148_4516 122
24 3300042617 Ga0466718_129342 Ga0466718_129342_1081_1449 122
25 3300042635 Ga0466702_449492 Ga0466702_449492_2605_2973 122
26 3300000089 AustNasuHG_c1014204 AustNasuHG_10142041 123
27 3300002449 JGI24698J34947_10002453 JGI24698J34947_100024534 123
28 3300002449 JGI24698J34947_10066252 JGI24698J34947_100662521 123
29 3300002450 JGI24695J34938_10014832 JGI24695J34938_100148323 123
30 3300005201 Ga0072941_1017551 Ga0072941_10175512 123
31 3300005485 Ga0074263_119771 Ga0074263_1197712 123
32 3300042597 Ga0466699_034467 Ga0466699_034467_966_1337 123
33 3300042597 Ga0466699_090719 Ga0466699_090719_6914_7285 123
34 3300042597 Ga0466699_172754 Ga0466699_172754_1124_1495 123
35 3300042597 Ga0466699_427813 Ga0466699_427813_2243_2614 123
36 3300042607 Ga0466720_005202 Ga0466720_005202_373_744 123
37 3300042607 Ga0466720_020983 Ga0466720_020983_9917_10288 123
38 3300042607 Ga0466720_021177 Ga0466720_021177_2124_2495 123
39 3300042607 Ga0466720_062977 Ga0466720_062977_5510_5881 123
40 3300042607 Ga0466720_064009 Ga0466720_064009_915_1286 123
41 3300042607 Ga0466720_135295 Ga0466720_135295_4608_4979 123
42 3300042607 Ga0466720_217711 Ga0466720_217711_383_754 123
43 3300042614 Ga0466712_134669 Ga0466712_134669_4759_5130 123
44 iso_pr_bacteria 2781125647 2781303330 123
45 2225789004 2227080807 2227454689 124
46 3300002450 JGI24695J34938_10000821 JGI24695J34938_1000082114 124
47 3300042597 Ga0466699_122570 Ga0466699_122570_1555_1929 124
48 3300042607 Ga0466720_062545 Ga0466720_062545_14070_14444 124
49 3300042614 Ga0466712_008265 Ga0466712_008265_430_804 124
50 3300042614 Ga0466712_314887 Ga0466712_314887_9278_9652 124
51 3300042617 Ga0466718_030669 Ga0466718_030669_565_939 124
52 3300042617 Ga0466718_043993 Ga0466718_043993_462_836 124
53 3300042635 Ga0466702_272464 Ga0466702_272464_1314_1688 124
54 3300042656 Ga0466732_023718 Ga0466732_023718_867_1241 124
55 3300000089 AustNasuHG_c1007943 AustNasuHG_10079432 125
56 3300002462 JGI24702J35022_10918002 JGI24702J35022_109180021 125
57 3300002504 JGI24705J35276_11633584 JGI24705J35276_116335841 125
58 3300009784 Ga0123357_10278316 Ga0123357_102783162 125
59 3300010882 Ga0123354_11004533 Ga0123354_110045331 125
60 3300042550 Ga0466656_197221 Ga0466656_197221_108_485 125
61 3300042597 Ga0466699_099509 Ga0466699_099509_3108_3485 125
62 3300042614 Ga0466712_066074 Ga0466712_066074_3531_3908 125
63 3300042614 Ga0466712_121129 Ga0466712_121129_578_955 125
64 3300042614 Ga0466712_237446 Ga0466712_237446_1453_1830 125
65 iso_pr_bacteria 2781125689 2781426477 125
66 3300000089 AustNasuHG_c1003095 AustNasuHG_10030952 126
67 3300000089 AustNasuHG_c1015454 AustNasuHG_10154542 126
68 3300002450 JGI24695J34938_10006167 JGI24695J34938_100061673 126
69 3300002504 JGI24705J35276_11493117 JGI24705J35276_114931171 126
70 3300010167 Ga0123353_10270143 Ga0123353_102701433 126
71 3300042597 Ga0466699_216839 Ga0466699_216839_357_737 126
72 3300042597 Ga0466699_328563 Ga0466699_328563_941_1321 126
73 3300042607 Ga0466720_098254 Ga0466720_098254_267_647 126
74 3300042607 Ga0466720_187419 Ga0466720_187419_749_1129 126
75 3300042614 Ga0466712_083777 Ga0466712_083777_31_411 126
76 3300042614 Ga0466712_099190 Ga0466712_099190_4368_4748 126
77 iso_pr_bacteria 2781125632 2781271569 126
78 iso_pr_bacteria 2819992462 2819992972 126
79 iso_pr_bacteria 2820020240 2820021429 126
80 3300002449 JGI24698J34947_10058495 JGI24698J34947_100584952 127
81 3300002450 JGI24695J34938_10159377 JGI24695J34938_101593772 127
82 3300024493 Ga0264413_102061 Ga0264413_1020615 127
83 3300038395 Ga0415639_043715 Ga0415639_043715_519_902 127
84 3300042597 Ga0466699_381813 Ga0466699_381813_298_681 127
85 3300042614 Ga0466712_278342 Ga0466712_278342_1002_1385 127
86 3300002449 JGI24698J34947_10065255 JGI24698J34947_100652553 128
87 3300002449 JGI24698J34947_10079921 JGI24698J34947_100799212 128
88 3300002450 JGI24695J34938_10081767 JGI24695J34938_100817671 128
89 3300002450 JGI24695J34938_10103481 JGI24695J34938_101034811 128
90 3300002509 JGI24699J35502_11097337 JGI24699J35502_110973372 128
91 3300005201 Ga0072941_1079929 Ga0072941_10799294 128
92 3300010167 Ga0123353_10148173 Ga0123353_101481733 128
93 3300010167 Ga0123353_11043338 Ga0123353_110433382 128
94 3300010167 Ga0123353_12378051 Ga0123353_123780511 128
95 3300042594 Ga0466694_028651 Ga0466694_028651_232_618 128
96 3300042594 Ga0466694_269583 Ga0466694_269583_702_1088 128
97 3300042597 Ga0466699_194813 Ga0466699_194813_460_846 128
98 3300042614 Ga0466712_090232 Ga0466712_090232_1370_1756 128
99 3300042614 Ga0466712_150871 Ga0466712_150871_2872_3258 128
100 iso_pr_bacteria 2819990093 2819991311 128
101 3300002449 JGI24698J34947_10086879 JGI24698J34947_100868792 129
102 3300002449 JGI24698J34947_10087172 JGI24698J34947_100871722 129
103 3300002462 JGI24702J35022_10111275 JGI24702J35022_101112752 129
104 3300002504 JGI24705J35276_11655561 JGI24705J35276_116555611 129
105 3300042597 Ga0466699_035590 Ga0466699_035590_1342_1731 129
106 3300042597 Ga0466699_167042 Ga0466699_167042_2585_2974 129
107 3300042607 Ga0466720_019572 Ga0466720_019572_1016_1405 129
108 3300042614 Ga0466712_022092 Ga0466712_022092_2098_2487 129
109 3300042614 Ga0466712_053039 Ga0466712_053039_406_795 129
110 3300042614 Ga0466712_055457 Ga0466712_055457_15444_15833 129
111 3300042614 Ga0466712_254852 Ga0466712_254852_30_419 129
112 3300042614 Ga0466712_261754 Ga0466712_261754_321_710 129
113 3300042616 Ga0466715_029604 Ga0466715_029604_71791_72180 129
114 iso_pr_bacteria 2781125650 2781308993 129
115 3300002449 JGI24698J34947_10003508 JGI24698J34947_100035087 130
116 3300002449 JGI24698J34947_10044748 JGI24698J34947_100447481 130
117 3300002449 JGI24698J34947_10044758 JGI24698J34947_100447581 130
118 3300002449 JGI24698J34947_10240898 JGI24698J34947_102408981 130
119 3300002450 JGI24695J34938_10001404 JGI24695J34938_1000140413 130
120 3300002450 JGI24695J34938_10002162 JGI24695J34938_100021629 130
121 3300002462 JGI24702J35022_10541201 JGI24702J35022_105412011 130
122 3300002504 JGI24705J35276_11600651 JGI24705J35276_116006511 130
123 3300010167 Ga0123353_12159032 Ga0123353_121590322 130
124 3300010882 Ga0123354_11052576 Ga0123354_110525761 130
125 3300042597 Ga0466699_218119 Ga0466699_218119_7813_8205 130
126 3300042597 Ga0466699_238109 Ga0466699_238109_645_1037 130
127 3300042597 Ga0466699_325728 Ga0466699_325728_7839_8231 130
128 3300042597 Ga0466699_387770 Ga0466699_387770_1276_1668 130
129 3300042597 Ga0466699_443791 Ga0466699_443791_544_936 130
130 3300042603 Ga0466714_033518 Ga0466714_033518_12169_12561 130
131 3300042614 Ga0466712_142643 Ga0466712_142643_3991_4383 130
132 iso_pr_bacteria 2820576413 2820577642 130
133 3300002449 JGI24698J34947_10004965 JGI24698J34947_100049653 131
134 3300002449 JGI24698J34947_10008999 JGI24698J34947_100089992 131
135 3300002462 JGI24702J35022_10042064 JGI24702J35022_100420642 131
136 3300002507 JGI24697J35500_11266947 JGI24697J35500_112669472 131
137 3300009784 Ga0123357_10394068 Ga0123357_103940682 131
138 3300010167 Ga0123353_10083432 Ga0123353_100834322 131
139 3300010167 Ga0123353_10585711 Ga0123353_105857112 131
140 3300010882 Ga0123354_10038518 Ga0123354_100385183 131
141 3300042594 Ga0466694_142503 Ga0466694_142503_3864_4259 131
142 3300042607 Ga0466720_069356 Ga0466720_069356_701_1096 131
143 3300002450 JGI24695J34938_10084534 JGI24695J34938_100845342 132
144 3300038395 Ga0415639_087480 Ga0415639_087480_888_1286 132
145 3300042597 Ga0466699_058934 Ga0466699_058934_198_596 132
146 3300042597 Ga0466699_138509 Ga0466699_138509_964_1362 132
147 3300042614 Ga0466712_085272 Ga0466712_085272_4401_4799 132
148 3300042656 Ga0466732_025340 Ga0466732_025340_1518_1916 132
149 3300002450 JGI24695J34938_10014240 JGI24695J34938_100142402 133
150 3300042597 Ga0466699_359606 Ga0466699_359606_7469_7870 133
151 iso_pr_bacteria 2781125655 2781318351 133
152 3300002449 JGI24698J34947_10004668 JGI24698J34947_100046682 134
153 3300002449 JGI24698J34947_10024477 JGI24698J34947_100244772 134
154 3300002462 JGI24702J35022_10039716 JGI24702J35022_100397163 134
155 3300002504 JGI24705J35276_12139141 JGI24705J35276_121391412 134
156 3300042594 Ga0466694_223281 Ga0466694_223281_2009_2413 134
157 iso_pr_bacteria 2781125634 2781274294 134
158 iso_pr_bacteria 2781125641 2781291007 134
159 3300002450 JGI24695J34938_10122331 JGI24695J34938_101223312 135
160 3300042597 Ga0466699_050918 Ga0466699_050918_155_565 136
161 3300010049 Ga0123356_10138449 Ga0123356_101384493 137
162 3300042597 Ga0466699_247004 Ga0466699_247004_731_1144 137
163 3300010167 Ga0123353_10126089 Ga0123353_101260892 140
164 3300042656 Ga0466732_090691 Ga0466732_090691_680_1102 140
165 3300042597 Ga0466699_242531 Ga0466699_242531_677_1102 141
166 3300002450 JGI24695J34938_10161768 JGI24695J34938_101617681 148
167 3300002449 JGI24698J34947_10026200 JGI24698J34947_100262005 150
168 3300042614 Ga0466712_035861 Ga0466712_035861_781_1236 151
169 3300002449 JGI24698J34947_10247491 JGI24698J34947_102474911 154

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain 3 50 0.94
PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain 60 119 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01325 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.