Protein Family IF10197

Metagenome Isolate
197 Members
57 Samples
185 Scaffolds
490.82 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_302825|Ga0466727_302825_89_1726
Length
545 aa
Sequence
LTVKEKRCTALFFGKLTATSFGSFATSFFSKKIRCNFAPDFYYFIQIIMAYKKITAEEAAQLIKNDDVIGFSGFTAAGCPKVVTKALAKRAEEEHAKGNPLKIGIYTGASTGDSIDGALARAHAIKFRSPYQSNKDLRTELNNRDAHYFDLHLSELAQYLRYGFLERPNWAILEACDITEDGKVYLTSAVGIAPTVARLADHIVIELNQYHPKELAGMHDIYEPADPPKRREIPVYSPSDRIGTPYLQIDPKKVVGIVDTNLPNEVGAFTPSDEVTNQIGKNVAGFLSSEIKAGRIPASFLPVQSGVGNVANAVLGAMGENEDIPPFEIYTEVIQDSVIKLMQDGNVKFASGCSLTLSTPALENVYENLAEFKSKLLLRPQEISNSPELARRMGLISINTALEADIFGNINSTHVLGTKMMNGIGGSGDFCRNAFLSIFTTPSIAKEGKISAIVPMVSHLDHSEHSVKILITEHGIADLRGKSPIQRAEEIINNCVAPQYKGLLREYLKLGQKGHTPQNMSAALAFHDTFIKTGDMSQVNWENYK

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.1%
Kalotermitidae 25.0%
Unclassified 19.6%
Blattidae 7.1%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Passalidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 189
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
18 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
35 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
38 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
43 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3004667792 Bacteroides sp. 519 Isolate Blattidae
48 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
54 2920168565 Paludibacter sp. 221 Isolate Blattidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2820219087 Unclassified Ignavibacteria Th196P3bin14 Isolate Unclassified
57 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_106608 3300042612 Bacteria 6137
2 Ga0123357_10001096 3300009784 Bacteria 28022
3 Ga0123357_10003319 3300009784 Bacteria 18391
4 Ga0466711_056243 3300042615 Bacteria 13739
5 Ga0466715_045705 3300042616 Bacteria 11443
6 Ga0466715_546483 3300042616 Bacteria 18843
7 Ga0466715_550706 3300042616 Bacteria 11761
8 Ga0466723_301979 3300042618 Bacteria 2148
9 Ga0466726_350838 3300042619 Bacteria 7791
10 Ga0466729_155206 3300042621 Bacteria 1878
11 Ga0123357_10183770 3300009784 Bacteria 2432
12 Ga0123356_10035555 3300010049 Bacteria 4654
13 Ga0123353_10000120 3300010167 Bacteria 93172
14 Ga0466690_076732 3300042590 Unclassified 3304
15 Ga0466690_109982 3300042590 Bacteria 42880
16 Ga0466692_040598 3300042591 Bacteria 5314
17 Ga0466735_050358 3300042624 Bacteria 9507
18 Ga0466704_113211 3300042643 Bacteria 20850
19 Ga0466716_070236 3300042605 Bacteria 6353
20 Ga0466722_112312 3300042609 Bacteria 19782
21 Ga0466722_113613 3300042609 Bacteria 129604
22 Ga0466705_338023 3300042612 Bacteria 7679
23 IMNBL1DRAFT_c0025105 3300000062 Bacteria 2292
24 JGI24699J35502_11131564 3300002509 Bacteria 5816
25 Ga0123357_10001409 3300009784 Bacteria 25443
26 Ga0466723_041933 3300042618 Bacteria 18221
27 Ga0466728_069051 3300042620 Bacteria 14732
28 Ga0466696_194787 3300042596 Bacteria 14213
29 Ga0466735_171760 3300042624 Bacteria 3382
30 Ga0466703_101316 3300042636 Bacteria 3921
31 Ga0466709_177105 3300042648 Bacteria 35753
32 Ga0466701_052963 3300042598 Bacteria 41459
33 Ga0466707_232641 3300042601 Bacteria 41634
34 Ga0466713_021600 3300042602 Bacteria 3948
35 Ga0466719_011720 3300042606 Bacteria 2980
36 Ga0466719_257731 3300042606 Bacteria 16904
37 Ga0466715_384156 3300042616 Bacteria 12865
38 Ga0466729_146389 3300042621 Bacteria 2710
39 Ga0123357_10025010 3300009784 Bacteria 8049
40 Ga0123354_10000991 3300010882 Bacteria 32314
41 Ga0123354_10020549 3300010882 Bacteria 10388
42 Ga0123354_10042411 3300010882 Bacteria 7013
43 Ga0123354_10166008 3300010882 Bacteria 2595
44 Ga0466690_138394 3300042590 Bacteria 16005
45 Ga0466696_214654 3300042596 Bacteria 2571
46 Ga0466735_104954 3300042624 Bacteria 2314
47 Ga0466735_125753 3300042624 Bacteria 3333
48 Ga0466735_203743 3300042624 Bacteria 3027
49 Ga0466703_058748 3300042636 Bacteria 9160
50 Ga0466703_327537 3300042636 Bacteria 2037
51 Ga0466704_129209 3300042643 Bacteria 3056
52 Ga0466704_145587 3300042643 Unclassified 31424
53 Ga0466727_081454 3300042655 Bacteria 2403
54 Ga0466727_116386 3300042655 Bacteria 8479
55 Ga0466701_079500 3300042598 Bacteria 18987
56 Ga0466716_101932 3300042605 Bacteria 5890
57 Ga0466719_163244 3300042606 Bacteria 2808
58 Ga0466722_064746 3300042609 Bacteria 2447
59 Ga0466732_161312 3300042656 Bacteria 40269
60 Ga0466733_093649 3300042659 Bacteria 3130
61 Ga0068305_10415775 3300005083 Bacteria 3128
62 Ga0466711_010261 3300042615 Bacteria 26630
63 Ga0466715_582778 3300042616 Bacteria 14448
64 Ga0466723_073883 3300042618 Bacteria 10153
65 Ga0466723_219467 3300042618 Bacteria 13446
66 Ga0466723_355141 3300042618 Bacteria 11770
67 Ga0466728_058988 3300042620 Bacteria 29164
68 Ga0123357_10008793 3300009784 Bacteria 12667
69 Ga0123355_10027211 3300009826 Bacteria 9233
70 Ga0123356_10010218 3300010049 Bacteria 9231
71 Ga0123353_10002330 3300010167 Bacteria 23620
72 Ga0123353_10277401 3300010167 Bacteria 2577
73 Ga0123353_10399956 3300010167 Bacteria 2045
74 Ga0466690_129095 3300042590 Bacteria 5304
75 Ga0466691_044225 3300042593 Bacteria 8455
76 Ga0466691_211175 3300042593 Unclassified 5868
77 Ga0466703_049405 3300042636 Bacteria 6589
78 Ga0466703_338442 3300042636 Bacteria 4023
79 Ga0466704_565564 3300042643 Bacteria 28607
80 Ga0466709_000274 3300042648 Bacteria 16787
81 Ga0466708_199202 3300042652 Bacteria 16986
82 Ga0466708_337866 3300042652 Bacteria 5019
83 Ga0466708_361464 3300042652 Bacteria 9570
84 Ga0466725_442772 3300042654 Bacteria 25386
85 Ga0466706_025174 3300042599 Bacteria 118676
86 Ga0466707_050522 3300042601 Bacteria 1874
87 Ga0466707_136298 3300042601 Bacteria 30628
88 Ga0466713_068672 3300042602 Bacteria 133468
89 Ga0466716_373889 3300042605 Bacteria 10551
90 Ga0466722_021201 3300042609 Bacteria 9615
91 Ga0466722_169457 3300042609 Bacteria 4821
92 Ga0466705_175096 3300042612 Bacteria 32654
93 Ga0466705_517123 3300042612 Bacteria 11084
94 Ga0466711_176231 3300042615 Bacteria 10764
95 Ga0466711_328046 3300042615 Bacteria 10660
96 Ga0466715_065243 3300042616 Bacteria 4274
97 Ga0466690_004052 3300042590 Unclassified 11857
98 Ga0466690_171877 3300042590 Bacteria 3907
99 Ga0466696_050124 3300042596 Bacteria 20961
100 Ga0466735_045098 3300042624 Bacteria 6110
101 Ga0466735_098185 3300042624 Bacteria 4584
102 Ga0466703_132998 3300042636 Bacteria 24818
103 Ga0466703_258898 3300042636 Bacteria 4796
104 Ga0466708_072313 3300042652 Bacteria 12841
105 Ga0466727_219301 3300042655 Unclassified 2103
106 Ga0466706_217108 3300042599 Bacteria 6516
107 Ga0466700_052954 3300042600 Bacteria 9411
108 Ga0466707_377635 3300042601 Bacteria 12151
109 IMNBL1DRAFT_c0003213 3300000062 Bacteria 10683
110 JGI24699J35502_11133974 3300002509 Bacteria 22272
111 JGI24696J40584_12959592 3300002834 Bacteria 5347
112 Ga0072941_1527007 3300005201 Bacteria 2102
113 Ga0466715_101154 3300042616 Bacteria 18269
114 Ga0466715_405663 3300042616 Bacteria 18925
115 Ga0466723_006195 3300042618 Bacteria 9413
116 Ga0466726_442562 3300042619 Bacteria 24934
117 Ga0466728_112789 3300042620 Bacteria 14570
118 Ga0123357_10017653 3300009784 Bacteria 9453
119 Ga0123354_10136553 3300010882 Bacteria 3062
120 Ga0123354_10140097 3300010882 Bacteria 2998
121 Ga0466692_184355 3300042591 Bacteria 12681
122 Ga0466691_088234 3300042593 Bacteria 133743
123 Ga0466735_162187 3300042624 Bacteria 2050
124 Ga0466703_113752 3300042636 Bacteria 45034
125 Ga0466703_142164 3300042636 Bacteria 6140
126 Ga0466703_242016 3300042636 Bacteria 4155
127 Ga0466709_079354 3300042648 Bacteria 5238
128 Ga0466700_233863 3300042600 Bacteria 3878
129 Ga0466700_478773 3300042600 Bacteria 4417
130 Ga0466707_073185 3300042601 Unclassified 7467
131 Ga0466713_065740 3300042602 Bacteria 4316
132 Ga0466713_143507 3300042602 Bacteria 11210
133 Ga0466714_162103 3300042603 Bacteria 35358
134 Ga0466722_197625 3300042609 Bacteria 7732
135 Ga0466705_092633 3300042612 Bacteria 28689
136 Ga0466705_235584 3300042612 Bacteria 1916
137 2227555740 2225789004 Bacteria 2791
138 JGI24702J35022_10002190 3300002462 Bacteria 12032
139 Ga0068305_10130983 3300005083 Unclassified 2032
140 Ga0466715_058785 3300042616 Bacteria 6906
141 Ga0466715_163266 3300042616 Bacteria 6579
142 Ga0466726_044030 3300042619 Bacteria 4771
143 Ga0466726_057843 3300042619 Bacteria 10697
144 Ga0466728_414517 3300042620 Bacteria 3958
145 Ga0123354_10000494 3300010882 Bacteria 39538
146 Ga0123354_10057460 3300010882 Bacteria 5793
147 Ga0123354_10211967 3300010882 Unclassified 2090
148 Ga0466696_014207 3300042596 Bacteria 6439
149 Ga0466696_159649 3300042596 Bacteria 13088
150 Ga0466696_375260 3300042596 Bacteria 12113
151 Ga0466735_180447 3300042624 Bacteria 2525
152 Ga0466704_021218 3300042643 Bacteria 6130
153 Ga0466709_403996 3300042648 Bacteria 22459
154 Ga0466706_133211 3300042599 Bacteria 3483
155 Ga0466707_144707 3300042601 Bacteria 2053
156 Ga0466714_148745 3300042603 Bacteria 6334
157 Ga0466716_059168 3300042605 Bacteria 5752
158 Ga0466722_268486 3300042609 Bacteria 2101
159 Ga0466697_172135 3300042611 Bacteria 2438
160 Ga0466705_045791 3300042612 Bacteria 26557
161 2227155791 2225789004 Bacteria 8477
162 2227325230 2225789004 Bacteria 6372
163 IMNBL1DRAFT_c0000805 3300000062 Bacteria 24698
164 IMNBL1DRAFT_c0001493 3300000062 Bacteria 17437
165 JGI24705J35276_12222035 3300002504 Bacteria 2387
166 Ga0466711_343758 3300042615 Bacteria 3362
167 Ga0466715_232113 3300042616 Bacteria 3549
168 Ga0466723_167541 3300042618 Bacteria 38557
169 Ga0466728_186186 3300042620 Bacteria 11725
170 Ga0466729_185722 3300042621 Bacteria 4419
171 Ga0123353_10399283 3300010167 Bacteria 2047
172 Ga0123354_10015129 3300010882 Bacteria 12033
173 Ga0123354_10079287 3300010882 Bacteria 4660
174 Ga0466692_090996 3300042591 Bacteria 32249
175 Ga0466693_125699 3300042592 Bacteria 1911
176 Ga0466691_001999 3300042593 Bacteria 5983
177 Ga0466696_350726 3300042596 Bacteria 10131
178 Ga0466734_132994 3300042623 Bacteria 2161
179 Ga0466703_268591 3300042636 Bacteria 7731
180 Ga0466704_433222 3300042643 Bacteria 27622
181 Ga0466708_074679 3300042652 Bacteria 22411
182 Ga0466727_034281 3300042655 Bacteria 3015
183 Ga0466727_302825 3300042655 Bacteria 1910
184 Ga0466707_183678 3300042601 Bacteria 8035
185 Ga0466719_414090 3300042606 Bacteria 7663

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_058785 Ga0466715_058785_1912_3399 459
2 3300042592 Ga0466693_125699 Ga0466693_125699_133_1620 462
3 3300042619 Ga0466726_442562 Ga0466726_442562_10231_11724 467
4 3300042609 Ga0466722_113613 Ga0466722_113613_78092_79558 468
5 3300042609 Ga0466722_197625 Ga0466722_197625_2404_3897 469
6 3300042601 Ga0466707_183678 Ga0466707_183678_755_2221 471
7 3300042636 Ga0466703_268591 Ga0466703_268591_1753_3246 471
8 3300042600 Ga0466700_478773 Ga0466700_478773_2761_4254 472
9 3300042601 Ga0466707_050522 Ga0466707_050522_323_1816 474
10 3300042601 Ga0466707_073185 Ga0466707_073185_2659_4152 474
11 3300042620 Ga0466728_414517 Ga0466728_414517_275_1756 474
12 3300042590 Ga0466690_109982 Ga0466690_109982_612_2099 475
13 3300042593 Ga0466691_044225 Ga0466691_044225_2055_3551 475
14 3300042602 Ga0466713_068672 Ga0466713_068672_31021_32502 475
15 3300010049 Ga0123356_10010218 Ga0123356_1001021810 476
16 3300010882 Ga0123354_10000494 Ga0123354_1000049435 476
17 3300042591 Ga0466692_184355 Ga0466692_184355_6975_8453 476
18 3300042605 Ga0466716_373889 Ga0466716_373889_6686_8164 476
19 3300042616 Ga0466715_546483 Ga0466715_546483_5949_7436 476
20 3300042623 Ga0466734_132994 Ga0466734_132994_384_1868 476
21 3300042591 Ga0466692_090996 Ga0466692_090996_26615_28096 477
22 3300042618 Ga0466723_355141 Ga0466723_355141_257_1744 477
23 3300009784 Ga0123357_10183770 Ga0123357_101837702 478
24 3300010049 Ga0123356_10035555 Ga0123356_100355552 478
25 3300042591 Ga0466692_040598 Ga0466692_040598_690_2183 478
26 3300042601 Ga0466707_144707 Ga0466707_144707_275_1756 478
27 3300042621 Ga0466729_185722 Ga0466729_185722_2549_4042 478
28 3300042624 Ga0466735_098185 Ga0466735_098185_357_1850 478
29 3300010167 Ga0123353_10000120 Ga0123353_1000012021 479
30 3300042606 Ga0466719_011720 Ga0466719_011720_1052_2539 479
31 3300042655 Ga0466727_081454 Ga0466727_081454_599_2092 479
32 3300042601 Ga0466707_136298 Ga0466707_136298_2843_4327 480
33 3300042659 Ga0466733_093649 Ga0466733_093649_1344_2831 480
34 3300010882 Ga0123354_10136553 Ga0123354_101365532 481
35 3300010882 Ga0123354_10211967 Ga0123354_102119673 481
36 3300042590 Ga0466690_076732 Ga0466690_076732_1363_2844 481
37 3300042600 Ga0466700_052954 Ga0466700_052954_6759_8246 481
38 3300042615 Ga0466711_343758 Ga0466711_343758_1068_2549 481
39 3300042618 Ga0466723_073883 Ga0466723_073883_2623_4104 481
40 3300010882 Ga0123354_10057460 Ga0123354_100574604 482
41 3300042606 Ga0466719_414090 Ga0466719_414090_458_1951 482
42 3300042590 Ga0466690_129095 Ga0466690_129095_3120_4613 483
43 3300042624 Ga0466735_203743 Ga0466735_203743_1364_2851 483
44 3300042636 Ga0466703_049405 Ga0466703_049405_4494_5987 483
45 3300042636 Ga0466703_132998 Ga0466703_132998_1174_2664 483
46 3300042636 Ga0466703_142164 Ga0466703_142164_4482_5975 483
47 3300010882 Ga0123354_10079287 Ga0123354_100792874 484
48 3300042599 Ga0466706_025174 Ga0466706_025174_7848_9347 484
49 3300042603 Ga0466714_162103 Ga0466714_162103_12944_14434 484
50 3300002462 JGI24702J35022_10002190 JGI24702J35022_100021902 485
51 3300009784 Ga0123357_10001409 Ga0123357_1000140923 485
52 3300010882 Ga0123354_10000991 Ga0123354_1000099112 485
53 3300042598 Ga0466701_052963 Ga0466701_052963_14198_15691 485
54 3300042601 Ga0466707_232641 Ga0466707_232641_19622_21109 485
55 3300042624 Ga0466735_050358 Ga0466735_050358_3173_4666 485
56 2225789004 2227325230 2227773200 486
57 2225789004 2227555740 2228088850 486
58 3300009784 Ga0123357_10008793 Ga0123357_100087933 486
59 3300042624 Ga0466735_162187 Ga0466735_162187_315_1808 486
60 3300000062 IMNBL1DRAFT_c0001493 IMNBL1DRAFT_000149313 487
61 3300002504 JGI24705J35276_12222035 JGI24705J35276_122220352 487
62 3300002509 JGI24699J35502_11131564 JGI24699J35502_111315642 487
63 3300005083 Ga0068305_10415775 Ga0068305_104157753 487
64 3300009784 Ga0123357_10003319 Ga0123357_1000331910 487
65 3300009784 Ga0123357_10025010 Ga0123357_100250104 487
66 3300010882 Ga0123354_10042411 Ga0123354_100424113 487
67 3300042599 Ga0466706_133211 Ga0466706_133211_1404_2921 487
68 3300042612 Ga0466705_338023 Ga0466705_338023_1405_2868 487
69 3300042620 Ga0466728_069051 Ga0466728_069051_8708_10171 487
70 3300042620 Ga0466728_112789 Ga0466728_112789_12808_14271 487
71 3300042620 Ga0466728_186186 Ga0466728_186186_5376_6839 487
72 3300042624 Ga0466735_125753 Ga0466735_125753_1306_2802 487
73 3300042609 Ga0466722_112312 Ga0466722_112312_11287_12753 488
74 3300042609 Ga0466722_169457 Ga0466722_169457_489_1955 488
75 3300002834 JGI24696J40584_12959592 JGI24696J40584_129595924 489
76 3300042598 Ga0466701_079500 Ga0466701_079500_775_2274 489
77 3300042606 Ga0466719_163244 Ga0466719_163244_374_1867 490
78 3300042612 Ga0466705_235584 Ga0466705_235584_359_1852 490
79 3300042621 Ga0466729_146389 Ga0466729_146389_1079_2572 490
80 3300042655 Ga0466727_034281 Ga0466727_034281_688_2160 490
81 3300042596 Ga0466696_050124 Ga0466696_050124_16258_17733 491
82 3300042596 Ga0466696_350726 Ga0466696_350726_8209_9684 491
83 3300042618 Ga0466723_219467 Ga0466723_219467_8412_9887 491
84 3300042648 Ga0466709_079354 Ga0466709_079354_1406_2881 491
85 3300042609 Ga0466722_268486 Ga0466722_268486_537_2015 492
86 3300042612 Ga0466705_106608 Ga0466705_106608_2298_3776 492
87 3300042615 Ga0466711_056243 Ga0466711_056243_6773_8269 492
88 3300042616 Ga0466715_550706 Ga0466715_550706_9690_11168 492
89 3300042618 Ga0466723_041933 Ga0466723_041933_1477_2955 492
90 3300042620 Ga0466728_058988 Ga0466728_058988_24250_25728 492
91 3300042643 Ga0466704_021218 Ga0466704_021218_1447_2925 492
92 3300009784 Ga0123357_10001096 Ga0123357_1000109623 493
93 3300042596 Ga0466696_194787 Ga0466696_194787_8761_10242 493
94 3300042602 Ga0466713_143507 Ga0466713_143507_3962_5443 493
95 3300042609 Ga0466722_064746 Ga0466722_064746_236_1717 493
96 3300042616 Ga0466715_065243 Ga0466715_065243_566_2047 493
97 3300042619 Ga0466726_350838 Ga0466726_350838_1311_2792 493
98 3300042636 Ga0466703_327537 Ga0466703_327537_390_1871 493
99 iso_pr_bacteria 2820219087 2820220346 493
100 iso_pr_bacteria 643348524 643423095 493
101 3300005083 Ga0068305_10130983 Ga0068305_101309832 494
102 3300010167 Ga0123353_10277401 Ga0123353_102774012 494
103 3300042590 Ga0466690_004052 Ga0466690_004052_2512_3996 494
104 3300042590 Ga0466690_138394 Ga0466690_138394_10466_11950 494
105 3300042590 Ga0466690_171877 Ga0466690_171877_2163_3647 494
106 3300042593 Ga0466691_001999 Ga0466691_001999_3914_5398 494
107 3300042593 Ga0466691_211175 Ga0466691_211175_1120_2604 494
108 3300042596 Ga0466696_214654 Ga0466696_214654_147_1631 494
109 3300042596 Ga0466696_375260 Ga0466696_375260_2635_4119 494
110 3300042606 Ga0466719_257731 Ga0466719_257731_6428_7912 494
111 3300042616 Ga0466715_582778 Ga0466715_582778_8119_9603 494
112 3300042618 Ga0466723_006195 Ga0466723_006195_4884_6368 494
113 3300042618 Ga0466723_167541 Ga0466723_167541_36716_38230 494
114 3300042618 Ga0466723_301979 Ga0466723_301979_285_1769 494
115 3300042636 Ga0466703_242016 Ga0466703_242016_1347_2831 494
116 3300042652 Ga0466708_074679 Ga0466708_074679_3525_5009 494
117 iso_pr_bacteria 2820789850 2820792038 494
118 2225789004 2227155791 2227563330 495
119 3300010882 Ga0123354_10140097 Ga0123354_101400973 495
120 3300042601 Ga0466707_377635 Ga0466707_377635_9992_11479 495
121 3300042602 Ga0466713_021600 Ga0466713_021600_328_1815 495
122 3300042603 Ga0466714_148745 Ga0466714_148745_2400_3887 495
123 3300042605 Ga0466716_059168 Ga0466716_059168_3251_4738 495
124 3300042605 Ga0466716_070236 Ga0466716_070236_3437_4924 495
125 3300042612 Ga0466705_045791 Ga0466705_045791_15837_17324 495
126 3300042616 Ga0466715_405663 Ga0466715_405663_6645_8165 495
127 3300042636 Ga0466703_101316 Ga0466703_101316_1477_2964 495
128 3300042643 Ga0466704_565564 Ga0466704_565564_19721_21208 495
129 3300042648 Ga0466709_403996 Ga0466709_403996_6748_8235 495
130 3300042654 Ga0466725_442772 Ga0466725_442772_18820_20307 495
131 3300042655 Ga0466727_219301 Ga0466727_219301_338_1825 495
132 3300042656 Ga0466732_161312 Ga0466732_161312_37109_38596 495
133 iso_pr_bacteria 2820765201 2820765960 495
134 3300000062 IMNBL1DRAFT_c0000805 IMNBL1DRAFT_00008052 496
135 3300000062 IMNBL1DRAFT_c0025105 IMNBL1DRAFT_00251052 496
136 3300042602 Ga0466713_065740 Ga0466713_065740_409_1899 496
137 3300042619 Ga0466726_044030 Ga0466726_044030_3159_4649 496
138 3300042624 Ga0466735_180447 Ga0466735_180447_515_2005 496
139 3300042636 Ga0466703_113752 Ga0466703_113752_7956_9446 496
140 3300042636 Ga0466703_258898 Ga0466703_258898_2510_4000 496
141 3300042643 Ga0466704_113211 Ga0466704_113211_17313_18803 496
142 3300042652 Ga0466708_072313 Ga0466708_072313_5390_6880 496
143 3300005201 Ga0072941_1527007 Ga0072941_15270071 497
144 3300010167 Ga0123353_10399956 Ga0123353_103999561 497
145 3300042600 Ga0466700_233863 Ga0466700_233863_375_1868 497
146 3300042615 Ga0466711_010261 Ga0466711_010261_24400_25893 497
147 3300042615 Ga0466711_328046 Ga0466711_328046_1163_2656 497
148 3300042616 Ga0466715_163266 Ga0466715_163266_338_1831 497
149 3300042616 Ga0466715_232113 Ga0466715_232113_563_2056 497
150 3300042619 Ga0466726_057843 Ga0466726_057843_8667_10160 497
151 3300042636 Ga0466703_338442 Ga0466703_338442_2171_3664 497
152 3300042652 Ga0466708_199202 Ga0466708_199202_8253_9746 497
153 3300042655 Ga0466727_116386 Ga0466727_116386_144_1637 497
154 iso_pr_bacteria 2820759988 2820761366 497
155 iso_pr_bacteria 2940239174 2940239282 497
156 iso_pr_bacteria 2940377351 2940378790 497
157 iso_pr_bacteria 2967483437 2967486014 497
158 3300002509 JGI24699J35502_11133974 JGI24699J35502_111339749 498
159 3300009784 Ga0123357_10017653 Ga0123357_100176535 498
160 3300010882 Ga0123354_10015129 Ga0123354_100151293 498
161 3300010882 Ga0123354_10020549 Ga0123354_100205496 498
162 3300042593 Ga0466691_088234 Ga0466691_088234_110808_112304 498
163 3300042599 Ga0466706_217108 Ga0466706_217108_3881_5377 498
164 3300042611 Ga0466697_172135 Ga0466697_172135_866_2362 498
165 3300042643 Ga0466704_129209 Ga0466704_129209_561_2057 498
166 3300042648 Ga0466709_000274 Ga0466709_000274_10919_12415 498
167 3300042652 Ga0466708_337866 Ga0466708_337866_757_2253 498
168 3300042652 Ga0466708_361464 Ga0466708_361464_2739_4235 498
169 iso_pr_bacteria 3004667792 3004671401 498
170 3300000062 IMNBL1DRAFT_c0003213 IMNBL1DRAFT_00032134 499
171 3300010882 Ga0123354_10166008 Ga0123354_101660083 499
172 3300042612 Ga0466705_175096 Ga0466705_175096_25208_26707 499
173 3300042615 Ga0466711_176231 Ga0466711_176231_9126_10625 499
174 3300042616 Ga0466715_045705 Ga0466715_045705_9108_10607 499
175 3300042636 Ga0466703_058748 Ga0466703_058748_116_1669 499
176 iso_pr_bacteria 2820751898 2820752293 499
177 iso_pr_bacteria 2820776227 2820776856 499
178 iso_pr_bacteria 2920168565 2920170410 499
179 3300009826 Ga0123355_10027211 Ga0123355_100272117 500
180 3300042596 Ga0466696_014207 Ga0466696_014207_4440_5942 500
181 3300042596 Ga0466696_159649 Ga0466696_159649_6877_8379 500
182 3300042612 Ga0466705_092633 Ga0466705_092633_10430_11932 500
183 3300042621 Ga0466729_155206 Ga0466729_155206_355_1857 500
184 3300042624 Ga0466735_171760 Ga0466735_171760_1257_2792 500
185 3300042643 Ga0466704_433222 Ga0466704_433222_24864_26366 500
186 3300042605 Ga0466716_101932 Ga0466716_101932_706_2211 501
187 3300042609 Ga0466722_021201 Ga0466722_021201_7111_8616 501
188 3300042612 Ga0466705_517123 Ga0466705_517123_9139_10644 501
189 3300042643 Ga0466704_145587 Ga0466704_145587_25230_26735 501
190 3300042648 Ga0466709_177105 Ga0466709_177105_22839_24374 501
191 3300042616 Ga0466715_384156 Ga0466715_384156_5641_7170 509
192 3300010167 Ga0123353_10399283 Ga0123353_103992832 510
193 3300042616 Ga0466715_101154 Ga0466715_101154_583_2115 510
194 3300010167 Ga0123353_10002330 Ga0123353_1000233016 520
195 3300042624 Ga0466735_104954 Ga0466735_104954_168_1745 525
196 3300042624 Ga0466735_045098 Ga0466735_045098_3936_5561 541
197 3300042655 Ga0466727_302825 Ga0466727_302825_89_1726 545

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain 364 507 0.97
PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain 52 258 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02550 GO:0008410 CoA-transferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.