Protein Family IF10186

Metagenome Isolate
184 Members
61 Samples
170 Scaffolds
509.41 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_270522|Ga0466727_270522_3150_4835
Length
561 aa
Sequence
MSIAGGQAFSIFCSHRSFFSVSLQNFFDGQLQIRRQARRGEINLFGQMDIIEDTGFSLKSLKGIILKGEEIVLSDITKKRVAACFDFLETFSTEKIIYGINTGFGPMAQYRIDNESLMQLQYNIIRSHSTGAGAPLPDLYVRAAMVARLGTFLQARSGVHFELVELLIEFINRGIYPFVPEHGSVGASGDLVQLAHIALTLIGEGEVHYNGAWIPAKEALDANGLTPFRIHIREGLSVTNGTSVMTGIGIVNLIYARRLLEWATLASVWMNEIASSYDDLMSDELNRTKRHADQHEIARWMRLFARGGACLQKREIKLYDHAHAHEKVFTEKIQAYYSLRCAPQVLGPVLTAIRQAEKILVDEVNSACDNPIIDCESGNVYHGGNFHGDYVSFEMDKLKIAVTKLTMLMERQLNYLCHDRINDGILPPFLNLGVRGLNYGLQAAQFTATSTTAENQTLSNPMSIHSIPCNNDNQDIVSMGTNAALMAKTVIENAWQVTAIHYMALTQATECLGIAGKLSFQTRRTYADIRKIFPAEAEDTPKYREIAAVKEYLTHHAPELI

📊 Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 23.3%
Unclassified 18.3%
Blattidae 6.7%
Rhinotermitidae 5.0%
Termopsidae 5.0%
Passalidae 3.3%
Armadillidiidae 1.7%
Hodotermitidae 1.7%
Nephropidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
2 2882250448 Bizionia sp. APA-3 Isolate
3 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
27 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
39 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
40 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
41 3004667792 Bacteroides sp. 519 Isolate Blattidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
49 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
53 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
56 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
57 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
58 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
59 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
60 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10002651 3300010167 Bacteria 22277
2 Ga0466657_392747 3300042582 Bacteria 1866
3 Ga0466690_126528 3300042590 Bacteria 5048
4 Ga0466690_227385 3300042590 Bacteria 20859
5 Ga0466692_010939 3300042591 Bacteria 6058
6 Ga0466693_300446 3300042592 Bacteria 3405
7 Ga0466696_426152 3300042596 Bacteria 4582
8 Ga0466704_012910 3300042643 Bacteria 8254
9 Ga0466704_141833 3300042643 Bacteria 10073
10 Ga0466708_060683 3300042652 Bacteria 49198
11 Ga0466727_093739 3300042655 Bacteria 17800
12 Ga0466707_134177 3300042601 Bacteria 1987
13 Ga0466714_083434 3300042603 Bacteria 6796
14 Ga0466714_124180 3300042603 Bacteria 24229
15 Ga0466716_025176 3300042605 Bacteria 14391
16 Ga0466715_036672 3300042616 Bacteria 23788
17 Ga0466715_539776 3300042616 Bacteria 10244
18 Ga0466728_433988 3300042620 Bacteria 3539
19 2227502413 2225789004 Bacteria 19081
20 JGI24705J35276_12233371 3300002504 Bacteria 4809
21 Ga0466705_130431 3300042612 Bacteria 14655
22 Ga0466705_158758 3300042612 Bacteria 11045
23 Ga0466733_187358 3300042659 Bacteria 6340
24 Ga0123356_10032917 3300010049 Bacteria 4847
25 Ga0123353_10086243 3300010167 Bacteria 5056
26 Ga0123354_10011041 3300010882 Bacteria 13936
27 Ga0466691_039935 3300042593 Bacteria 25425
28 Ga0466691_051351 3300042593 Bacteria 7659
29 Ga0466703_129758 3300042636 Bacteria 19384
30 Ga0466709_137910 3300042648 Bacteria 40589
31 Ga0466709_315607 3300042648 Bacteria 6478
32 Ga0466708_347084 3300042652 Bacteria 11166
33 Ga0466716_202600 3300042605 Bacteria 25648
34 Ga0466716_241172 3300042605 Bacteria 3486
35 Ga0466711_219626 3300042615 Bacteria 16517
36 Ga0466711_384618 3300042615 Bacteria 22548
37 Ga0466728_046855 3300042620 Bacteria 21751
38 JGI24696J40584_12955961 3300002834 Bacteria 2977
39 Ga0466705_158223 3300042612 Bacteria 15543
40 Ga0466733_064215 3300042659 Bacteria 7594
41 Ga0123353_10054406 3300010167 Bacteria 6400
42 Ga0123353_10282514 3300010167 Bacteria 2548
43 Ga0466690_319186 3300042590 Bacteria 19732
44 Ga0466691_006190 3300042593 Bacteria 85330
45 Ga0466735_138918 3300042624 Bacteria 5162
46 Ga0466735_158460 3300042624 Bacteria 7315
47 Ga0466703_173935 3300042636 Bacteria 16868
48 Ga0466703_217268 3300042636 Bacteria 30172
49 Ga0466704_102498 3300042643 Bacteria 21970
50 Ga0466709_279583 3300042648 Bacteria 6500
51 Ga0466724_02291 3300042649 Bacteria 3950
52 Ga0466708_187729 3300042652 Bacteria 24305
53 Ga0466727_172844 3300042655 Bacteria 7424
54 Ga0466714_021774 3300042603 Bacteria 11888
55 Ga0466714_135156 3300042603 Bacteria 46237
56 Ga0466716_041784 3300042605 Bacteria 12286
57 Ga0466722_006441 3300042609 Bacteria 9912
58 Ga0466722_021911 3300042609 Bacteria 53346
59 Ga0466722_042797 3300042609 Bacteria 13226
60 Ga0466711_075016 3300042615 Bacteria 12505
61 Ga0466715_340747 3300042616 Bacteria 15029
62 Ga0466726_301212 3300042619 Unclassified 2839
63 Ga0466728_010149 3300042620 Bacteria 2570
64 Ga0466728_116793 3300042620 Bacteria 97907
65 Ga0466705_208476 3300042612 Bacteria 5967
66 Ga0466733_044551 3300042659 Bacteria 2245
67 Ga0466690_015023 3300042590 Bacteria 27335
68 Ga0466690_063142 3300042590 Bacteria 12647
69 Ga0466690_120487 3300042590 Bacteria 49787
70 Ga0466692_046708 3300042591 Bacteria 150257
71 Ga0466696_165406 3300042596 Bacteria 15212
72 Ga0466703_210249 3300042636 Bacteria 11501
73 Ga0466704_151657 3300042643 Bacteria 2919
74 Ga0466724_21271 3300042649 Bacteria 4583
75 Ga0466707_063845 3300042601 Bacteria 8868
76 Ga0466713_043123 3300042602 Bacteria 81226
77 Ga0466713_049669 3300042602 Bacteria 3414
78 Ga0466714_134893 3300042603 Bacteria 4620
79 Ga0466714_158735 3300042603 Bacteria 13111
80 Ga0466719_499653 3300042606 Bacteria 1986
81 Ga0466722_154847 3300042609 Bacteria 2309
82 Ga0466711_016056 3300042615 Bacteria 3895
83 Ga0466711_045136 3300042615 Bacteria 25795
84 Ga0466711_278242 3300042615 Bacteria 27669
85 Ga0466711_340642 3300042615 Bacteria 19711
86 Ga0466715_309128 3300042616 Bacteria 18162
87 Ga0466728_221052 3300042620 Bacteria 15724
88 Ga0466728_281160 3300042620 Bacteria 13069
89 Ga0466728_372833 3300042620 Bacteria 4556
90 JGI24696J40584_12961677 3300002834 Bacteria 34081
91 Ga0068305_10014021 3300005083 Bacteria 5645
92 Ga0466705_182143 3300042612 Bacteria 4669
93 Ga0466705_365057 3300042612 Bacteria 11803
94 Ga0123357_10010479 3300009784 Bacteria 11793
95 Ga0123356_10000138 3300010049 Bacteria 82103
96 Ga0123356_10083711 3300010049 Bacteria 3022
97 Ga0160467_104640 3300012829 Bacteria 1896
98 Ga0466690_126870 3300042590 Bacteria 3111
99 Ga0466696_013750 3300042596 Bacteria 6973
100 Ga0466735_050611 3300042624 Bacteria 11617
101 Ga0466704_002372 3300042643 Bacteria 57196
102 Ga0466704_094724 3300042643 Bacteria 10795
103 Ga0466709_331194 3300042648 Bacteria 8170
104 Ga0466727_005019 3300042655 Bacteria 2887
105 Ga0466727_270522 3300042655 Bacteria 9416
106 Ga0466713_086346 3300042602 Bacteria 12025
107 Ga0466713_137191 3300042602 Bacteria 44160
108 Ga0466714_040261 3300042603 Bacteria 10231
109 Ga0466711_204147 3300042615 Bacteria 19807
110 JGI24695J34938_10002176 3300002450 Bacteria 15288
111 Ga0123354_10232662 3300010882 Bacteria 1921
112 Ga0466690_051493 3300042590 Bacteria 11140
113 Ga0466692_202069 3300042591 Bacteria 2364
114 Ga0466696_120177 3300042596 Bacteria 12396
115 Ga0466696_340248 3300042596 Bacteria 11516
116 Ga0466704_100467 3300042643 Bacteria 21863
117 Ga0466704_156837 3300042643 Bacteria 12573
118 Ga0466708_061784 3300042652 Bacteria 8976
119 Ga0466707_327113 3300042601 Bacteria 3225
120 Ga0466716_291493 3300042605 Bacteria 16470
121 Ga0466722_059383 3300042609 Bacteria 11770
122 Ga0466698_053877 3300042610 Bacteria 1910
123 Ga0466711_261761 3300042615 Bacteria 7646
124 Ga0466715_404214 3300042616 Bacteria 35013
125 Ga0466723_002914 3300042618 Bacteria 32279
126 Ga0466723_072995 3300042618 Bacteria 71631
127 Ga0466729_195397 3300042621 Bacteria 9904
128 JGI24702J35022_10002422 3300002462 Bacteria 11391
129 JGI24702J35022_10071318 3300002462 Bacteria 1871
130 JGI24696J40584_12961652 3300002834 Bacteria 28415
131 Ga0466697_192850 3300042611 Bacteria 17708
132 Ga0123353_10138027 3300010167 Bacteria 3909
133 Ga0123354_10123407 3300010882 Bacteria 3326
134 Ga0466657_105158 3300042582 Bacteria 4192
135 Ga0466690_255880 3300042590 Bacteria 9031
136 Ga0466692_097315 3300042591 Bacteria 10528
137 Ga0466696_091816 3300042596 Bacteria 11965
138 Ga0466735_178543 3300042624 Bacteria 5627
139 Ga0466706_054201 3300042599 Bacteria 6950
140 Ga0466707_140740 3300042601 Bacteria 10682
141 Ga0466714_115794 3300042603 Bacteria 9635
142 Ga0466722_265049 3300042609 Bacteria 14900
143 Ga0466715_234297 3300042616 Bacteria 23273
144 Ga0466723_147104 3300042618 Bacteria 15942
145 Ga0466726_172879 3300042619 Bacteria 6101
146 Ga0466726_405595 3300042619 Bacteria 8079
147 Ga0466726_442357 3300042619 Bacteria 2343
148 IMNBGM34_c000511 3300000036 Bacteria 10296
149 Ga0068305_10057746 3300005083 Unclassified 11121
150 Ga0466705_264324 3300042612 Bacteria 17030
151 Ga0466705_315418 3300042612 Bacteria 36789
152 Ga0466705_372016 3300042612 Bacteria 17065
153 Ga0466733_018691 3300042659 Bacteria 7747
154 Ga0466733_035383 3300042659 Bacteria 60826
155 Ga0123353_10064852 3300010167 Bacteria 5862
156 Ga0466691_028335 3300042593 Bacteria 20105
157 Ga0466695_330923 3300042595 Bacteria 4603
158 Ga0466701_015312 3300042598 Bacteria 9824
159 Ga0466731_336997 3300042622 Bacteria 40948
160 Ga0466727_120065 3300042655 Bacteria 6775
161 Ga0466706_218375 3300042599 Bacteria 57228
162 Ga0466700_193309 3300042600 Bacteria 37158
163 Ga0466713_033344 3300042602 Bacteria 37079
164 Ga0466716_031359 3300042605 Bacteria 13466
165 Ga0466719_009948 3300042606 Bacteria 7289
166 Ga0466719_449519 3300042606 Bacteria 14404
167 Ga0466722_023973 3300042609 Bacteria 11071
168 Ga0466710_162759 3300042613 Bacteria 7608
169 Ga0466723_287832 3300042618 Bacteria 14308
170 Ga0466728_222804 3300042620 Bacteria 2638

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_044551 Ga0466733_044551_936_2156 406
2 3300042655 Ga0466727_120065 Ga0466727_120065_5396_6745 449
3 3300042624 Ga0466735_178543 Ga0466735_178543_10_1377 455
4 3300042610 Ga0466698_053877 Ga0466698_053877_493_1872 459
5 3300042591 Ga0466692_202069 Ga0466692_202069_920_2332 470
6 3300042603 Ga0466714_124180 Ga0466714_124180_11467_12972 478
7 3300005083 Ga0068305_10014021 Ga0068305_100140213 486
8 3300042599 Ga0466706_218375 Ga0466706_218375_2889_4403 488
9 3300042602 Ga0466713_043123 Ga0466713_043123_13250_14782 488
10 3300042602 Ga0466713_049669 Ga0466713_049669_904_2436 492
11 3300042609 Ga0466722_154847 Ga0466722_154847_593_2095 492
12 3300042603 Ga0466714_083434 Ga0466714_083434_627_2147 495
13 3300042602 Ga0466713_033344 Ga0466713_033344_21985_23526 496
14 3300042612 Ga0466705_130431 Ga0466705_130431_19_1509 496
15 3300042648 Ga0466709_315607 Ga0466709_315607_147_1673 497
16 3300042590 Ga0466690_051493 Ga0466690_051493_767_2263 498
17 3300042591 Ga0466692_097315 Ga0466692_097315_8497_10029 498
18 3300042590 Ga0466690_255880 Ga0466690_255880_6530_8032 500
19 3300042603 Ga0466714_040261 Ga0466714_040261_2644_4149 501
20 3300042603 Ga0466714_115794 Ga0466714_115794_3888_5393 501
21 3300042603 Ga0466714_134893 Ga0466714_134893_2837_4342 501
22 3300042603 Ga0466714_158735 Ga0466714_158735_3978_5483 501
23 3300042612 Ga0466705_208476 Ga0466705_208476_3391_4929 501
24 3300042615 Ga0466711_278242 Ga0466711_278242_7763_9268 501
25 3300042659 Ga0466733_018691 Ga0466733_018691_1813_3318 501
26 3300042659 Ga0466733_064215 Ga0466733_064215_1802_3307 501
27 3300042603 Ga0466714_021774 Ga0466714_021774_8953_10461 502
28 3300042609 Ga0466722_023973 Ga0466722_023973_8540_10072 502
29 3300042624 Ga0466735_050611 Ga0466735_050611_4384_5892 502
30 3300042655 Ga0466727_005019 Ga0466727_005019_138_1646 502
31 3300042591 Ga0466692_010939 Ga0466692_010939_1782_3293 503
32 3300042616 Ga0466715_404214 Ga0466715_404214_5160_6671 503
33 3300042619 Ga0466726_405595 Ga0466726_405595_6004_7515 503
34 3300042620 Ga0466728_010149 Ga0466728_010149_854_2365 503
35 3300042636 Ga0466703_173935 Ga0466703_173935_7539_9050 503
36 iso_pr_bacteria 2820750388 2820751077 503
37 iso_pr_bacteria 3004667792 3004668049 503
38 3300042590 Ga0466690_063142 Ga0466690_063142_3725_5239 504
39 3300042601 Ga0466707_063845 Ga0466707_063845_4750_6264 504
40 3300042603 Ga0466714_135156 Ga0466714_135156_14302_15816 504
41 3300042621 Ga0466729_195397 Ga0466729_195397_4753_6267 504
42 3300042624 Ga0466735_138918 Ga0466735_138918_2499_4013 504
43 3300042643 Ga0466704_002372 Ga0466704_002372_1039_2553 504
44 3300042643 Ga0466704_094724 Ga0466704_094724_1016_2530 504
45 iso_pr_bacteria 2820776227 2820777912 504
46 2225789004 2227502413 2227986678 505
47 3300002504 JGI24705J35276_12233371 JGI24705J35276_122333713 505
48 3300042602 Ga0466713_137191 Ga0466713_137191_41718_43235 505
49 3300042612 Ga0466705_182143 Ga0466705_182143_3069_4601 505
50 3300042643 Ga0466704_156837 Ga0466704_156837_59_1591 505
51 3300042590 Ga0466690_319186 Ga0466690_319186_1084_2604 506
52 3300042601 Ga0466707_140740 Ga0466707_140740_2023_3543 506
53 3300042612 Ga0466705_158758 Ga0466705_158758_7655_9175 506
54 3300042616 Ga0466715_036672 Ga0466715_036672_12754_14274 506
55 3300042619 Ga0466726_442357 Ga0466726_442357_297_1817 506
56 3300042652 Ga0466708_347084 Ga0466708_347084_265_1785 506
57 3300042601 Ga0466707_327113 Ga0466707_327113_1621_3144 507
58 3300042605 Ga0466716_202600 Ga0466716_202600_18414_19937 507
59 3300042609 Ga0466722_021911 Ga0466722_021911_36696_38219 507
60 3300042609 Ga0466722_265049 Ga0466722_265049_837_2360 507
61 3300042612 Ga0466705_264324 Ga0466705_264324_8269_9813 507
62 3300042620 Ga0466728_046855 Ga0466728_046855_1799_3322 507
63 3300042620 Ga0466728_221052 Ga0466728_221052_14044_15567 507
64 3300042615 Ga0466711_261761 Ga0466711_261761_1189_2715 508
65 3300042616 Ga0466715_539776 Ga0466715_539776_2396_3922 508
66 iso_pr_bacteria 2882250448 2882250634 508
67 3300042590 Ga0466690_126528 Ga0466690_126528_1368_2897 509
68 3300042591 Ga0466692_046708 Ga0466692_046708_140292_141821 509
69 3300042593 Ga0466691_006190 Ga0466691_006190_65739_67268 509
70 3300042596 Ga0466696_013750 Ga0466696_013750_1458_2987 509
71 3300042599 Ga0466706_054201 Ga0466706_054201_768_2297 509
72 3300042606 Ga0466719_009948 Ga0466719_009948_233_1762 509
73 3300042609 Ga0466722_042797 Ga0466722_042797_349_1878 509
74 3300042615 Ga0466711_219626 Ga0466711_219626_13684_15213 509
75 3300042616 Ga0466715_309128 Ga0466715_309128_14108_15637 509
76 3300042620 Ga0466728_116793 Ga0466728_116793_35271_36800 509
77 3300042620 Ga0466728_222804 Ga0466728_222804_952_2481 509
78 3300042624 Ga0466735_158460 Ga0466735_158460_2684_4213 509
79 3300042636 Ga0466703_210249 Ga0466703_210249_3970_5499 509
80 iso_pr_bacteria 2820053807 2820053971 509
81 3300042590 Ga0466690_227385 Ga0466690_227385_6869_8416 510
82 3300042601 Ga0466707_134177 Ga0466707_134177_163_1695 510
83 3300042618 Ga0466723_002914 Ga0466723_002914_7572_9104 510
84 3300010882 Ga0123354_10011041 Ga0123354_100110416 511
85 3300010882 Ga0123354_10232662 Ga0123354_102326622 511
86 3300042605 Ga0466716_041784 Ga0466716_041784_3248_4783 511
87 iso_pr_bacteria 2838772460 2838772517 511
88 3300010167 Ga0123353_10282514 Ga0123353_102825142 512
89 3300042590 Ga0466690_126870 Ga0466690_126870_377_1915 512
90 3300042593 Ga0466691_051351 Ga0466691_051351_1476_3014 512
91 3300042595 Ga0466695_330923 Ga0466695_330923_1876_3414 512
92 3300042605 Ga0466716_241172 Ga0466716_241172_805_2343 512
93 3300042605 Ga0466716_291493 Ga0466716_291493_510_2048 512
94 3300042606 Ga0466719_499653 Ga0466719_499653_227_1765 512
95 3300042609 Ga0466722_006441 Ga0466722_006441_412_1950 512
96 3300042609 Ga0466722_059383 Ga0466722_059383_8596_10134 512
97 3300042613 Ga0466710_162759 Ga0466710_162759_1343_2881 512
98 3300042618 Ga0466723_147104 Ga0466723_147104_12688_14226 512
99 3300042620 Ga0466728_372833 Ga0466728_372833_1835_3373 512
100 3300042643 Ga0466704_151657 Ga0466704_151657_1080_2618 512
101 3300042652 Ga0466708_061784 Ga0466708_061784_3048_4586 512
102 3300042655 Ga0466727_093739 Ga0466727_093739_7262_8800 512
103 3300042659 Ga0466733_035383 Ga0466733_035383_28648_30186 512
104 3300000036 IMNBGM34_c000511 IMNBGM34_00051112 513
105 3300042582 Ga0466657_392747 Ga0466657_392747_58_1599 513
106 3300042593 Ga0466691_039935 Ga0466691_039935_8397_9938 513
107 3300042615 Ga0466711_016056 Ga0466711_016056_1728_3269 513
108 3300042615 Ga0466711_075016 Ga0466711_075016_8522_10063 513
109 3300042616 Ga0466715_340747 Ga0466715_340747_7425_8966 513
110 3300042619 Ga0466726_301212 Ga0466726_301212_1057_2598 513
111 3300042636 Ga0466703_217268 Ga0466703_217268_4260_5801 513
112 3300042643 Ga0466704_100467 Ga0466704_100467_17395_18936 513
113 3300042643 Ga0466704_102498 Ga0466704_102498_10743_12284 513
114 3300042652 Ga0466708_060683 Ga0466708_060683_43268_44809 513
115 3300042652 Ga0466708_187729 Ga0466708_187729_18426_19967 513
116 3300002834 JGI24696J40584_12961652 JGI24696J40584_1296165222 514
117 3300042582 Ga0466657_105158 Ga0466657_105158_104_1648 514
118 3300042592 Ga0466693_300446 Ga0466693_300446_307_1851 514
119 3300042593 Ga0466691_028335 Ga0466691_028335_12737_14281 514
120 3300042598 Ga0466701_015312 Ga0466701_015312_2071_3615 514
121 3300042602 Ga0466713_086346 Ga0466713_086346_6942_8486 514
122 3300042605 Ga0466716_025176 Ga0466716_025176_5521_7065 514
123 3300042611 Ga0466697_192850 Ga0466697_192850_305_1849 514
124 3300042615 Ga0466711_384618 Ga0466711_384618_7509_9053 514
125 3300042636 Ga0466703_129758 Ga0466703_129758_11753_13297 514
126 3300042643 Ga0466704_141833 Ga0466704_141833_3136_4680 514
127 3300042648 Ga0466709_279583 Ga0466709_279583_710_2254 514
128 3300042649 Ga0466724_02291 Ga0466724_02291_1667_3211 514
129 3300042649 Ga0466724_21271 Ga0466724_21271_2255_3799 514
130 3300042659 Ga0466733_187358 Ga0466733_187358_3154_4698 514
131 iso_pr_bacteria 2820797595 2820798067 514
132 3300002450 JGI24695J34938_10002176 JGI24695J34938_100021769 515
133 3300002462 JGI24702J35022_10071318 JGI24702J35022_100713183 515
134 3300002834 JGI24696J40584_12955961 JGI24696J40584_129559613 515
135 3300002834 JGI24696J40584_12961677 JGI24696J40584_129616772 515
136 3300005083 Ga0068305_10057746 Ga0068305_100577465 515
137 3300010049 Ga0123356_10083711 Ga0123356_100837112 515
138 3300010167 Ga0123353_10002651 Ga0123353_1000265116 515
139 3300010167 Ga0123353_10138027 Ga0123353_101380272 515
140 3300010882 Ga0123354_10123407 Ga0123354_101234072 515
141 3300042590 Ga0466690_120487 Ga0466690_120487_45163_46710 515
142 3300042605 Ga0466716_031359 Ga0466716_031359_7886_9433 515
143 3300042612 Ga0466705_158223 Ga0466705_158223_2393_3940 515
144 3300042615 Ga0466711_340642 Ga0466711_340642_12713_14260 515
145 3300042620 Ga0466728_281160 Ga0466728_281160_10781_12328 515
146 iso_pr_bacteria 2820737921 2820738398 515
147 3300002462 JGI24702J35022_10002422 JGI24702J35022_100024225 516
148 3300012829 Ga0160467_104640 Ga0160467_1046402 516
149 3300042655 Ga0466727_172844 Ga0466727_172844_3261_4811 516
150 iso_pr_bacteria 2940199050 2940201533 516
151 iso_pr_bacteria 2940209341 2940211334 516
152 iso_pr_bacteria 2940346213 2940348650 516
153 3300042596 Ga0466696_165406 Ga0466696_165406_4652_6205 517
154 3300010049 Ga0123356_10032917 Ga0123356_100329172 518
155 3300010167 Ga0123353_10054406 Ga0123353_100544062 518
156 3300010167 Ga0123353_10086243 Ga0123353_100862432 518
157 3300042590 Ga0466690_015023 Ga0466690_015023_25738_27294 518
158 3300042596 Ga0466696_340248 Ga0466696_340248_3459_5015 518
159 3300009784 Ga0123357_10010479 Ga0123357_1001047913 519
160 3300042596 Ga0466696_091816 Ga0466696_091816_5775_7334 519
161 3300042596 Ga0466696_120177 Ga0466696_120177_4755_6314 519
162 3300042612 Ga0466705_315418 Ga0466705_315418_30797_32356 519
163 3300042618 Ga0466723_287832 Ga0466723_287832_1285_2844 519
164 3300042643 Ga0466704_012910 Ga0466704_012910_3784_5343 519
165 3300042648 Ga0466709_137910 Ga0466709_137910_16773_18332 519
166 iso_pr_bacteria 2820166269 2820168082 519
167 iso_pr_bacteria 2820168331 2820168596 519
168 iso_pr_bacteria 2820170025 2820170616 519
169 3300010049 Ga0123356_10000138 Ga0123356_1000013815 520
170 3300042618 Ga0466723_072995 Ga0466723_072995_19731_21293 520
171 3300042622 Ga0466731_336997 Ga0466731_336997_18279_19841 520
172 3300042648 Ga0466709_331194 Ga0466709_331194_3286_4848 520
173 3300042612 Ga0466705_365057 Ga0466705_365057_3527_5092 521
174 3300042596 Ga0466696_426152 Ga0466696_426152_2089_3660 523
175 3300010167 Ga0123353_10064852 Ga0123353_100648523 524
176 3300042612 Ga0466705_372016 Ga0466705_372016_4631_6208 525
177 3300042620 Ga0466728_433988 Ga0466728_433988_110_1687 525
178 3300042600 Ga0466700_193309 Ga0466700_193309_5199_6791 530
179 3300042616 Ga0466715_234297 Ga0466715_234297_14018_15610 530
180 3300042619 Ga0466726_172879 Ga0466726_172879_1375_2973 532
181 3300042615 Ga0466711_045136 Ga0466711_045136_9000_10610 536
182 3300042606 Ga0466719_449519 Ga0466719_449519_8055_9710 551
183 3300042615 Ga0466711_204147 Ga0466711_204147_15523_17199 558
184 3300042655 Ga0466727_270522 Ga0466727_270522_3150_4835 561

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00221 Lyase_aromatic Aromatic amino acid lyase 58 531 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.