Protein Family IF10178

Metagenome Isolate
121 Members
40 Samples
117 Scaffolds
368.91 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_245563|Ga0466727_245563_1692_2921
Length
409 aa
Sequence
MKKIIFPLCMFCLASCVFAQSSDHKKLFDKKYIKSTMLKVTEWQLANPNHDTRDWTNGAFYAGVFAAWETTKSKDVYKAMLDMGDKVNWTPYKRWYHADDVAICQTYIDIYRKEKRQEMIQSTIDTLSKFMANPYPVKGIEVIKWWWCDALFMAPPVLAKMGTTTGNPEYFKKNDIYFKECYDLLYNKEEHLFARDLNYVIKNDGNDRYEANGKRIFWSRGNGWVMGGLVRILKELPKDYSQRPFYEQLYKEMAAKIVSIQQADGLWRASLLDPDSYPGGEVSGSGFFCYALAWGINAGLLDKSTYLPAVKKSWIALNNCVNGEGRVGWVQPIGADPRKNFNADSWEVYGTGAFLLAGSEIIKLKKEESMREWRQNHRHRIRSYPICRAIRRRKSDVMMGMFRRVTGAS

📊 Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.9%
Termitidae 23.1%
Termopsidae 10.3%
Blattidae 7.7%
Rhinotermitidae 7.7%
Unclassified 7.7%
Hydrophilidae 2.6%
Tenebrionidae 2.6%
Passalidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2923982719 Parabacteroides sp. 52 Isolate Blattidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
11 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
25 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_325447 3300042612 Bacteria 1982
2 Ga0466690_163568 3300042590 Bacteria 12107
3 Ga0466690_278049 3300042590 Bacteria 2823
4 Ga0466723_313763 3300042618 Bacteria 27327
5 Ga0466728_298211 3300042620 Bacteria 4100
6 Ga0466728_388918 3300042620 Bacteria 5805
7 Ga0466713_108972 3300042602 Bacteria 12162
8 Ga0466716_431468 3300042605 Bacteria 3005
9 Ga0068302_10128338 3300005071 Bacteria 5945
10 Ga0466703_082228 3300042636 Bacteria 4411
11 Ga0466704_181630 3300042643 Bacteria 23359
12 Ga0466708_024917 3300042652 Bacteria 2539
13 Ga0466727_295895 3300042655 Bacteria 3089
14 Ga0466690_053103 3300042590 Bacteria 2977
15 Ga0466696_354588 3300042596 Bacteria 9039
16 Ga0466705_401674 3300042612 Bacteria 8967
17 Ga0466711_299662 3300042615 Bacteria 6865
18 Ga0466711_512929 3300042615 Bacteria 34740
19 Ga0466726_120645 3300042619 Bacteria 15026
20 Ga0466713_129443 3300042602 Bacteria 2226
21 Ga0068305_10047805 3300005083 Bacteria 10204
22 Ga0466704_534771 3300042643 Bacteria 20297
23 Ga0466708_053720 3300042652 Bacteria 9924
24 Ga0466708_084406 3300042652 Bacteria 7220
25 Ga0466705_378646 3300042612 Bacteria 13233
26 Ga0123353_10447870 3300010167 Bacteria 1902
27 Ga0123354_10014914 3300010882 Bacteria 12107
28 Ga0466690_070479 3300042590 Bacteria 3700
29 Ga0466690_143631 3300042590 Bacteria 10843
30 Ga0466690_261819 3300042590 Unclassified 17369
31 Ga0466692_116427 3300042591 Bacteria 133716
32 Ga0466691_221216 3300042593 Bacteria 13784
33 Ga0466715_032997 3300042616 Bacteria 17847
34 Ga0466715_107240 3300042616 Bacteria 39584
35 Ga0466723_348379 3300042618 Bacteria 11357
36 Ga0466728_010141 3300042620 Bacteria 10438
37 Ga0466729_057315 3300042621 Bacteria 6451
38 Ga0466713_026342 3300042602 Bacteria 39766
39 Ga0466713_062780 3300042602 Bacteria 19729
40 Ga0466714_128036 3300042603 Bacteria 5486
41 Ga0466719_202584 3300042606 Bacteria 2119
42 Ga0466722_039197 3300042609 Bacteria 6191
43 Ga0466722_060929 3300042609 Bacteria 2750
44 Ga0466722_154349 3300042609 Bacteria 3356
45 JGI24705J35276_12236124 3300002504 Bacteria 7508
46 Ga0466727_167044 3300042655 Bacteria 32161
47 Ga0466727_245563 3300042655 Bacteria 3440
48 Ga0123356_10039058 3300010049 Unclassified 4423
49 Ga0123354_10244562 3300010882 Bacteria 1836
50 Ga0265387_1001222 3300024582 Bacteria 3796
51 Ga0466690_189913 3300042590 Bacteria 2976
52 Ga0466690_430694 3300042590 Bacteria 3544
53 Ga0466711_137218 3300042615 Bacteria 4189
54 Ga0466723_141613 3300042618 Bacteria 10974
55 Ga0466723_246901 3300042618 Bacteria 2862
56 Ga0466728_281316 3300042620 Bacteria 3655
57 Ga0466713_137657 3300042602 Bacteria 5152
58 Ga0466722_185555 3300042609 Bacteria 14474
59 2227562400 2225789004 Bacteria 2708
60 Ga0466735_004085 3300042624 Bacteria 3700
61 Ga0466704_085637 3300042643 Bacteria 11308
62 Ga0466709_087661 3300042648 Bacteria 14801
63 Ga0466705_200742 3300042612 Bacteria 6204
64 Ga0123356_10184162 3300010049 Bacteria 2113
65 Ga0466723_309462 3300042618 Bacteria 2221
66 Ga0466716_215719 3300042605 Bacteria 18909
67 Ga0466719_400337 3300042606 Bacteria 12697
68 Ga0466722_225310 3300042609 Bacteria 6520
69 JGI24696J40584_12934350 3300002834 Bacteria 1538
70 Ga0466703_159722 3300042636 Bacteria 8351
71 Ga0466704_397345 3300042643 Bacteria 2960
72 Ga0466704_402220 3300042643 Bacteria 34496
73 Ga0466708_165208 3300042652 Bacteria 9729
74 Ga0466708_186117 3300042652 Bacteria 16033
75 Ga0466705_368263 3300042612 Bacteria 4400
76 Ga0466733_077962 3300042659 Bacteria 19342
77 Ga0562377_0004 3300056842 Bacteria 3525959
78 Ga0123356_10227701 3300010049 Bacteria 1926
79 Ga0123353_10051765 3300010167 Bacteria 6553
80 Ga0123353_10168830 3300010167 Bacteria 3475
81 Ga0466693_167667 3300042592 Bacteria 1362
82 Ga0466691_001050 3300042593 Bacteria 12292
83 Ga0466705_494640 3300042612 Bacteria 10023
84 Ga0466715_258463 3300042616 Bacteria 28150
85 Ga0466723_361650 3300042618 Bacteria 13087
86 Ga0466728_110625 3300042620 Bacteria 42471
87 Ga0466728_402272 3300042620 Bacteria 2534
88 Ga0466707_120195 3300042601 Bacteria 3230
89 Ga0466713_100201 3300042602 Bacteria 40435
90 Ga0466714_105719 3300042603 Bacteria 7975
91 Ga0466716_038572 3300042605 Bacteria 2132
92 Ga0466729_283886 3300042621 Bacteria 1561
93 Ga0466709_096263 3300042648 Bacteria 29719
94 Ga0466708_051848 3300042652 Bacteria 9573
95 Ga0466727_222909 3300042655 Bacteria 18189
96 Ga0466733_203604 3300042659 Bacteria 66833
97 Ga0466690_128007 3300042590 Bacteria 5721
98 Ga0466692_108066 3300042591 Bacteria 15222
99 Ga0466696_178693 3300042596 Bacteria 5946
100 Ga0466713_132300 3300042602 Bacteria 21951
101 Ga0466722_061395 3300042609 Bacteria 61869
102 Ga0466722_249159 3300042609 Bacteria 79748
103 Ga0466730_093731 3300042625 Bacteria 3664
104 Ga0466704_062640 3300042643 Bacteria 1920
105 Ga0466709_110604 3300042648 Bacteria 4690
106 Ga0466705_134942 3300042612 Bacteria 4595
107 Ga0466705_145242 3300042612 Bacteria 2651
108 Ga0466705_171667 3300042612 Bacteria 5295
109 Ga0466733_081995 3300042659 Bacteria 115844
110 Ga0466690_034791 3300042590 Bacteria 2749
111 Ga0466690_150232 3300042590 Bacteria 7827
112 Ga0466692_009647 3300042591 Bacteria 10786
113 Ga0466691_014224 3300042593 Bacteria 18492
114 Ga0466728_247210 3300042620 Bacteria 9254
115 Ga0466716_052540 3300042605 Bacteria 4072
116 Ga0466704_356361 3300042643 Bacteria 2603
117 Ga0466708_381523 3300042652 Bacteria 10432

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_062780 Ga0466713_062780_18729_19670 313
2 3300042602 Ga0466713_129443 Ga0466713_129443_1226_2167 313
3 3300042609 Ga0466722_249159 Ga0466722_249159_32489_33487 332
4 3300042605 Ga0466716_052540 Ga0466716_052540_860_1948 338
5 3300005083 Ga0068305_10047805 Ga0068305_100478053 341
6 3300042593 Ga0466691_001050 Ga0466691_001050_5124_6212 345
7 3300042652 Ga0466708_084406 Ga0466708_084406_1299_2387 350
8 3300042590 Ga0466690_143631 Ga0466690_143631_1318_2373 351
9 3300042618 Ga0466723_141613 Ga0466723_141613_2031_3119 352
10 3300042590 Ga0466690_430694 Ga0466690_430694_2246_3334 353
11 3300042620 Ga0466728_298211 Ga0466728_298211_1799_2887 353
12 3300042590 Ga0466690_128007 Ga0466690_128007_872_1960 354
13 3300042612 Ga0466705_200742 Ga0466705_200742_2269_3333 354
14 3300042616 Ga0466715_258463 Ga0466715_258463_6998_8086 354
15 3300042596 Ga0466696_354588 Ga0466696_354588_1487_2575 355
16 3300042612 Ga0466705_494640 Ga0466705_494640_7292_8383 355
17 3300042618 Ga0466723_348379 Ga0466723_348379_9393_10484 355
18 3300042618 Ga0466723_361650 Ga0466723_361650_9622_10710 355
19 3300042590 Ga0466690_163568 Ga0466690_163568_6249_7394 356
20 3300042602 Ga0466713_132300 Ga0466713_132300_16368_17477 356
21 3300042648 Ga0466709_087661 Ga0466709_087661_2478_3578 357
22 3300042648 Ga0466709_110604 Ga0466709_110604_318_1418 358
23 3300042590 Ga0466690_070479 Ga0466690_070479_1430_2545 362
24 3300042590 Ga0466690_189913 Ga0466690_189913_440_1528 362
25 3300042612 Ga0466705_401674 Ga0466705_401674_4800_5888 362
26 3300042620 Ga0466728_388918 Ga0466728_388918_1330_2418 362
27 3300042620 Ga0466728_402272 Ga0466728_402272_1236_2324 362
28 3300042636 Ga0466703_159722 Ga0466703_159722_6652_7740 362
29 3300042652 Ga0466708_051848 Ga0466708_051848_2568_3656 362
30 3300042603 Ga0466714_128036 Ga0466714_128036_3013_4122 363
31 3300042609 Ga0466722_061395 Ga0466722_061395_25387_26478 363
32 3300042609 Ga0466722_225310 Ga0466722_225310_537_1628 363
33 3300010882 Ga0123354_10244562 Ga0123354_102445621 364
34 3300042603 Ga0466714_105719 Ga0466714_105719_4491_5606 364
35 3300042643 Ga0466704_356361 Ga0466704_356361_1290_2408 364
36 iso_pr_bacteria 2923982719 2923983978 364
37 iso_pr_bacteria 2940371297 2940373677 364
38 3300042601 Ga0466707_120195 Ga0466707_120195_863_1960 365
39 3300042602 Ga0466713_026342 Ga0466713_026342_38645_39742 365
40 3300042602 Ga0466713_137657 Ga0466713_137657_453_1550 365
41 3300042609 Ga0466722_039197 Ga0466722_039197_3695_4816 365
42 3300042621 Ga0466729_057315 Ga0466729_057315_1657_2754 365
43 3300042652 Ga0466708_381523 Ga0466708_381523_5328_6425 365
44 3300042590 Ga0466690_150232 Ga0466690_150232_53_1153 366
45 3300042592 Ga0466693_167667 Ga0466693_167667_85_1185 366
46 3300042596 Ga0466696_178693 Ga0466696_178693_4344_5444 366
47 3300042605 Ga0466716_215719 Ga0466716_215719_10398_11498 366
48 3300042612 Ga0466705_325447 Ga0466705_325447_751_1851 366
49 3300042615 Ga0466711_299662 Ga0466711_299662_2505_3605 366
50 3300042616 Ga0466715_107240 Ga0466715_107240_33766_34866 366
51 3300042620 Ga0466728_247210 Ga0466728_247210_2894_3994 366
52 3300042643 Ga0466704_085637 Ga0466704_085637_4793_5893 366
53 3300042655 Ga0466727_167044 Ga0466727_167044_22800_23900 366
54 3300042659 Ga0466733_203604 Ga0466733_203604_11363_12463 366
55 3300010049 Ga0123356_10039058 Ga0123356_100390582 367
56 3300010167 Ga0123353_10168830 Ga0123353_101688302 367
57 3300010882 Ga0123354_10014914 Ga0123354_100149144 367
58 3300042591 Ga0466692_009647 Ga0466692_009647_7916_9019 367
59 3300042591 Ga0466692_116427 Ga0466692_116427_69204_70307 367
60 3300042593 Ga0466691_221216 Ga0466691_221216_2804_3907 367
61 3300042612 Ga0466705_378646 Ga0466705_378646_1011_2114 367
62 3300042636 Ga0466703_082228 Ga0466703_082228_200_1303 367
63 3300042652 Ga0466708_165208 Ga0466708_165208_779_1882 367
64 3300042659 Ga0466733_081995 Ga0466733_081995_40933_42036 367
65 iso_pr_bacteria 2940202316 2940202413 367
66 2225789004 2227562400 2228100150 368
67 3300042602 Ga0466713_100201 Ga0466713_100201_16869_17975 368
68 3300042605 Ga0466716_431468 Ga0466716_431468_1517_2623 368
69 3300042609 Ga0466722_060929 Ga0466722_060929_1206_2312 368
70 3300042612 Ga0466705_145242 Ga0466705_145242_929_2035 368
71 3300042612 Ga0466705_368263 Ga0466705_368263_932_2038 368
72 3300042618 Ga0466723_309462 Ga0466723_309462_461_1567 368
73 3300042618 Ga0466723_313763 Ga0466723_313763_440_1546 368
74 3300010049 Ga0123356_10227701 Ga0123356_102277012 369
75 3300042612 Ga0466705_134942 Ga0466705_134942_2641_3750 369
76 3300042620 Ga0466728_281316 Ga0466728_281316_1238_2347 369
77 3300042591 Ga0466692_108066 Ga0466692_108066_9142_10254 370
78 3300042615 Ga0466711_512929 Ga0466711_512929_19874_20986 370
79 3300010167 Ga0123353_10051765 Ga0123353_100517653 371
80 3300042605 Ga0466716_038572 Ga0466716_038572_513_1652 371
81 3300042606 Ga0466719_202584 Ga0466719_202584_621_1736 371
82 3300042655 Ga0466727_222909 Ga0466727_222909_12259_13374 371
83 3300042659 Ga0466733_077962 Ga0466733_077962_5329_6444 371
84 3300002504 JGI24705J35276_12236124 JGI24705J35276_122361242 372
85 3300042620 Ga0466728_110625 Ga0466728_110625_18047_19192 372
86 3300042643 Ga0466704_397345 Ga0466704_397345_791_1909 372
87 3300042590 Ga0466690_053103 Ga0466690_053103_828_1949 373
88 3300042643 Ga0466704_534771 Ga0466704_534771_4358_5479 373
89 3300042619 Ga0466726_120645 Ga0466726_120645_7225_8349 374
90 3300005071 Ga0068302_10128338 Ga0068302_101283381 375
91 3300042606 Ga0466719_400337 Ga0466719_400337_75_1202 375
92 3300042612 Ga0466705_171667 Ga0466705_171667_3363_4496 377
93 3300010049 Ga0123356_10184162 Ga0123356_101841622 378
94 3300042624 Ga0466735_004085 Ga0466735_004085_663_1799 378
95 3300042625 Ga0466730_093731 Ga0466730_093731_201_1337 378
96 3300042652 Ga0466708_024917 Ga0466708_024917_479_1618 379
97 3300042590 Ga0466690_261819 Ga0466690_261819_150_1292 380
98 3300042652 Ga0466708_053720 Ga0466708_053720_5425_6567 380
99 3300042643 Ga0466704_062640 Ga0466704_062640_400_1548 382
100 3300042620 Ga0466728_010141 Ga0466728_010141_2714_3868 384
101 3300042648 Ga0466709_096263 Ga0466709_096263_27711_28865 384
102 3300056842 Ga0562377_0004 Ga0562377_0004_2780758_2781915 385
103 3300002834 JGI24696J40584_12934350 JGI24696J40584_129343501 386
104 3300042590 Ga0466690_034791 Ga0466690_034791_1507_2667 386
105 3300042590 Ga0466690_278049 Ga0466690_278049_1504_2664 386
106 3300042643 Ga0466704_402220 Ga0466704_402220_4209_5369 386
107 iso_pr_bacteria 2873600114 2873602661 386
108 3300042609 Ga0466722_185555 Ga0466722_185555_1432_2619 387
109 3300042621 Ga0466729_283886 Ga0466729_283886_225_1421 388
110 3300042593 Ga0466691_014224 Ga0466691_014224_12859_14028 389
111 3300042602 Ga0466713_108972 Ga0466713_108972_2762_3934 390
112 3300042615 Ga0466711_137218 Ga0466711_137218_2534_3730 390
113 3300042618 Ga0466723_246901 Ga0466723_246901_45_1217 390
114 3300042643 Ga0466704_181630 Ga0466704_181630_7813_9051 390
115 3300042655 Ga0466727_295895 Ga0466727_295895_1493_2668 391
116 3300042652 Ga0466708_186117 Ga0466708_186117_11845_13254 393
117 3300024582 Ga0265387_1001222 Ga0265387_10012222 397
118 3300042609 Ga0466722_154349 Ga0466722_154349_333_1526 397
119 3300042655 Ga0466727_245563 Ga0466727_245563_1692_2921 409
120 3300010167 Ga0123353_10447870 Ga0123353_104478702 415
121 3300042616 Ga0466715_032997 Ga0466715_032997_8277_9536 419

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 32 364 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.