Protein Family IF10167

Metagenome Isolate
143 Members
45 Samples
139 Scaffolds
199.6 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_214822|Ga0466727_214822_343_1011
Length
222 aa
Sequence
MAIVVEHEKRRREILERALDVFVEEGFENATYQKIADRSGITRTTLYIYFHNKREIFNFSIKQLLSEFETDLNRVRKEDLPYPEKLKKTISFILKTLEINRRLLSVILDYLFYLARQESAKQLAGVPAKPRRDKASAEAPGTIDTRVRRRTIRLRHILSSMVIDGIKAGELKKLDVKTINDLLYGLIETAIFHMAVLKRPSAGDLREAVNLLVDQIAEQKER

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.6%
Kalotermitidae 31.8%
Unclassified 13.6%
Rhinotermitidae 9.1%
Termopsidae 6.8%

🌳 Taxonomy

Archaea 1
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
3 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
4 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
5 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
6 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
7 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
8 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
9 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
36 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_194058 3300042605 Bacteria 14870
2 Ga0466716_218754 3300042605 Bacteria 13081
3 Ga0466712_147952 3300042614 Bacteria 11335
4 Ga0466723_006520 3300042618 Bacteria 34438
5 Ga0466723_071252 3300042618 Bacteria 58514
6 Ga0466690_031567 3300042590 Bacteria 39446
7 Ga0466692_097037 3300042591 Bacteria 7204
8 Ga0466692_121742 3300042591 Bacteria 12345
9 Ga0466692_190645 3300042591 Bacteria 3323
10 Ga0466694_060748 3300042594 Bacteria 1822
11 Ga0466696_127760 3300042596 Bacteria 4912
12 Ga0466709_379747 3300042648 Bacteria 11033
13 Ga0466708_107418 3300042652 Bacteria 7720
14 Ga0123357_10128338 3300009784 Bacteria 3167
15 Ga0123353_10069987 3300010167 Bacteria 5636
16 JGI24698J34947_10031143 3300002449 Bacteria 2810
17 JGI24695J34938_10027417 3300002450 Bacteria 2693
18 JGI24695J34938_10035253 3300002450 Bacteria 2289
19 Ga0072941_1041319 3300005201 Unclassified 4258
20 Ga0466707_367166 3300042601 Bacteria 1250
21 Ga0466719_092423 3300042606 Unclassified 3079
22 Ga0466719_285951 3300042606 Bacteria 1736
23 Ga0466721_191339 3300042608 Bacteria 79638
24 Ga0466722_027035 3300042609 Bacteria 9083
25 Ga0466698_130509 3300042610 Bacteria 8047
26 Ga0466711_067069 3300042615 Bacteria 6276
27 Ga0466715_347823 3300042616 Bacteria 6769
28 Ga0466691_107904 3300042593 Bacteria 7442
29 Ga0466696_442882 3300042596 Bacteria 4580
30 Ga0466735_227067 3300042624 Bacteria 1269
31 Ga0466703_100612 3300042636 Bacteria 66039
32 Ga0466704_146832 3300042643 Unclassified 5847
33 Ga0466704_224550 3300042643 Bacteria 1791
34 Ga0466704_299238 3300042643 Bacteria 3887
35 Ga0466709_167604 3300042648 Bacteria 1214
36 Ga0466708_064447 3300042652 Bacteria 4468
37 Ga0123357_10215754 3300009784 Bacteria 2143
38 Ga0123356_10014911 3300010049 Archaea 7460
39 Ga0123356_10241472 3300010049 Bacteria 1878
40 Ga0123356_11642346 3300010049 Bacteria 796
41 Ga0123353_11976325 3300010167 Bacteria 716
42 Ga0072941_1116324 3300005201 Bacteria 2508
43 Ga0466705_160689 3300042612 Bacteria 2934
44 Ga0466712_113300 3300042614 Bacteria 2684
45 Ga0466712_239387 3300042614 Bacteria 10434
46 Ga0466715_148608 3300042616 Bacteria 20383
47 Ga0466728_097758 3300042620 Bacteria 24556
48 Ga0466691_063212 3300042593 Bacteria 1767
49 Ga0466729_230609 3300042621 Bacteria 3362
50 Ga0466703_093576 3300042636 Bacteria 8952
51 Ga0466708_245071 3300042652 Bacteria 13931
52 Ga0466727_201286 3300042655 Bacteria 2490
53 Ga0123355_10012757 3300009826 Bacteria 13031
54 Ga0123354_10356021 3300010882 Bacteria 1298
55 JGI24698J34947_10062356 3300002449 Bacteria 1831
56 Ga0466713_074952 3300042602 Bacteria 2322
57 Ga0466716_029968 3300042605 Bacteria 12259
58 Ga0466719_072003 3300042606 Bacteria 2449
59 Ga0466711_259608 3300042615 Bacteria 24557
60 Ga0466723_331842 3300042618 Bacteria 10387
61 Ga0466726_333312 3300042619 Bacteria 2020
62 Ga0456237_0000529 3300041968 Bacteria 5816
63 Ga0466692_186185 3300042591 Bacteria 2364
64 Ga0466693_110881 3300042592 Bacteria 3758
65 Ga0466693_140469 3300042592 Bacteria 1458
66 Ga0466694_181681 3300042594 Bacteria 2529
67 Ga0466703_082278 3300042636 Bacteria 15950
68 Ga0466704_068054 3300042643 Bacteria 10568
69 Ga0466704_110192 3300042643 Bacteria 29526
70 Ga0466704_117362 3300042643 Bacteria 4464
71 Ga0466709_148175 3300042648 Bacteria 5725
72 Ga0466708_008964 3300042652 Bacteria 1043
73 Ga0466708_061397 3300042652 Bacteria 3445
74 Ga0466727_130717 3300042655 Bacteria 2370
75 JGI24695J34938_10163398 3300002450 Bacteria 916
76 Ga0072941_1041318 3300005201 Bacteria 2154
77 Ga0466705_034622 3300042612 Bacteria 3073
78 Ga0466705_070798 3300042612 Bacteria 7405
79 Ga0466719_572501 3300042606 Bacteria 5204
80 Ga0466698_009270 3300042610 Bacteria 1011
81 Ga0466711_158478 3300042615 Bacteria 16488
82 Ga0466728_234115 3300042620 Bacteria 1731
83 Ga0466728_361378 3300042620 Bacteria 1164
84 Ga0466699_397590 3300042597 Bacteria 9455
85 Ga0466703_429046 3300042636 Bacteria 11698
86 Ga0072941_1041320 3300005201 Bacteria 6628
87 Ga0466705_038831 3300042612 Bacteria 1977
88 Ga0466719_373371 3300042606 Bacteria 2327
89 Ga0466712_112866 3300042614 Unclassified 5985
90 Ga0466711_472570 3300042615 Bacteria 1146
91 Ga0466715_155956 3300042616 Bacteria 3202
92 Ga0466723_227236 3300042618 Bacteria 5030
93 Ga0415639_011990 3300038395 Bacteria 15522
94 Ga0456237_0002614 3300041968 Bacteria 2907
95 Ga0466694_342486 3300042594 Bacteria 1753
96 Ga0466696_441242 3300042596 Bacteria 17147
97 Ga0466704_058460 3300042643 Unclassified 1126
98 Ga0466727_214822 3300042655 Bacteria 1273
99 Ga0123356_10073401 3300010049 Bacteria 3217
100 JGI24698J34947_10003434 3300002449 Bacteria 8600
101 JGI24695J34938_10006715 3300002450 Bacteria 6853
102 Ga0072941_1004963 3300005201 Bacteria 2315
103 Ga0466707_325893 3300042601 Bacteria 1602
104 Ga0466707_356508 3300042601 Bacteria 1192
105 Ga0466722_115375 3300042609 Bacteria 9951
106 Ga0466722_143103 3300042609 Bacteria 17036
107 Ga0466705_412095 3300042612 Bacteria 7608
108 Ga0466711_300254 3300042615 Bacteria 7469
109 Ga0466715_269665 3300042616 Bacteria 14613
110 Ga0466723_146638 3300042618 Unclassified 11023
111 Ga0466723_288324 3300042618 Bacteria 8465
112 Ga0466691_063795 3300042593 Bacteria 2087
113 Ga0466694_000504 3300042594 Bacteria 3674
114 Ga0466694_140171 3300042594 Bacteria 3398
115 Ga0466695_029002 3300042595 Bacteria 6606
116 Ga0466699_417095 3300042597 Bacteria 1615
117 Ga0466708_321737 3300042652 Bacteria 61371
118 Ga0123353_10347122 3300010167 Bacteria 2238
119 JGI24695J34938_10012348 3300002450 Bacteria 4531
120 JGI24695J34938_10017234 3300002450 Bacteria 3647
121 Ga0072940_1099341 3300005200 Bacteria 4230
122 Ga0466707_057707 3300042601 Bacteria 7597
123 Ga0466715_146553 3300042616 Bacteria 21620
124 Ga0466715_186421 3300042616 Bacteria 2931
125 Ga0466728_018717 3300042620 Bacteria 5732
126 Ga0415639_007546 3300038395 Unclassified 5221
127 Ga0466690_312359 3300042590 Bacteria 11963
128 Ga0466691_081253 3300042593 Bacteria 21841
129 Ga0466694_344780 3300042594 Bacteria 3571
130 Ga0466699_350840 3300042597 Bacteria 1242
131 Ga0466702_123394 3300042635 Bacteria 1996
132 Ga0466703_187674 3300042636 Bacteria 2738
133 Ga0466709_002003 3300042648 Bacteria 2083
134 Ga0466709_223489 3300042648 Bacteria 5208
135 Ga0466708_128755 3300042652 Bacteria 6941
136 Ga0123356_10001800 3300010049 Bacteria 23343
137 Ga0123356_10010655 3300010049 Bacteria 8999
138 Ga0123353_10012997 3300010167 Bacteria 11894
139 JGI24698J34947_10185176 3300002449 Unclassified 828

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_107904 Ga0466691_107904_3530_4126 178
2 3300042614 Ga0466712_239387 Ga0466712_239387_1093_1686 180
3 3300042593 Ga0466691_081253 Ga0466691_081253_17870_18466 181
4 3300042609 Ga0466722_115375 Ga0466722_115375_142_738 183
5 3300042596 Ga0466696_127760 Ga0466696_127760_2293_2895 184
6 3300042610 Ga0466698_130509 Ga0466698_130509_6806_7405 184
7 3300042605 Ga0466716_218754 Ga0466716_218754_4042_4644 185
8 3300042618 Ga0466723_146638 Ga0466723_146638_9493_10089 185
9 3300002449 JGI24698J34947_10031143 JGI24698J34947_100311434 187
10 3300005201 Ga0072941_1004963 Ga0072941_10049632 187
11 3300042648 Ga0466709_379747 Ga0466709_379747_14_577 187
12 3300002450 JGI24695J34938_10027417 JGI24695J34938_100274172 190
13 3300042591 Ga0466692_186185 Ga0466692_186185_371_973 190
14 3300042606 Ga0466719_373371 Ga0466719_373371_1670_2263 190
15 3300042614 Ga0466712_112866 Ga0466712_112866_3234_3836 190
16 3300002449 JGI24698J34947_10062356 JGI24698J34947_100623562 191
17 3300002449 JGI24698J34947_10185176 JGI24698J34947_101851761 191
18 3300042595 Ga0466695_029002 Ga0466695_029002_3913_4491 192
19 3300042616 Ga0466715_146553 Ga0466715_146553_97_711 192
20 3300042636 Ga0466703_187674 Ga0466703_187674_1470_2066 192
21 3300042618 Ga0466723_006520 Ga0466723_006520_6079_6693 193
22 3300042643 Ga0466704_058460 Ga0466704_058460_192_773 193
23 3300010049 Ga0123356_11642346 Ga0123356_116423461 194
24 3300041968 Ga0456237_0002614 Ga0456237_0002614_1782_2366 194
25 3300042591 Ga0466692_097037 Ga0466692_097037_606_1190 194
26 3300042594 Ga0466694_140171 Ga0466694_140171_130_714 194
27 3300042605 Ga0466716_029968 Ga0466716_029968_11349_11933 194
28 3300042616 Ga0466715_269665 Ga0466715_269665_13124_13708 194
29 3300042620 Ga0466728_361378 Ga0466728_361378_356_940 194
30 3300042606 Ga0466719_285951 Ga0466719_285951_528_1115 195
31 3300042619 Ga0466726_333312 Ga0466726_333312_148_735 195
32 3300042648 Ga0466709_148175 Ga0466709_148175_2825_3412 195
33 3300042609 Ga0466722_143103 Ga0466722_143103_6356_6949 197
34 3300042612 Ga0466705_160689 Ga0466705_160689_649_1242 197
35 3300042614 Ga0466712_147952 Ga0466712_147952_8552_9145 197
36 3300042635 Ga0466702_123394 Ga0466702_123394_20_613 197
37 3300042636 Ga0466703_093576 Ga0466703_093576_6949_7542 197
38 3300042643 Ga0466704_117362 Ga0466704_117362_2348_2941 197
39 3300042643 Ga0466704_224550 Ga0466704_224550_543_1136 197
40 3300042652 Ga0466708_008964 Ga0466708_008964_287_880 197
41 3300002449 JGI24698J34947_10003434 JGI24698J34947_100034345 198
42 3300005201 Ga0072941_1041318 Ga0072941_10413182 198
43 3300005201 Ga0072941_1041319 Ga0072941_10413194 198
44 3300005201 Ga0072941_1041320 Ga0072941_10413204 198
45 3300005201 Ga0072941_1116324 Ga0072941_11163243 198
46 3300010049 Ga0123356_10001800 Ga0123356_1000180019 198
47 3300038395 Ga0415639_011990 Ga0415639_011990_10837_11433 198
48 3300041968 Ga0456237_0000529 Ga0456237_0000529_2117_2713 198
49 3300042594 Ga0466694_060748 Ga0466694_060748_708_1304 198
50 3300042596 Ga0466696_442882 Ga0466696_442882_252_848 198
51 3300042597 Ga0466699_350840 Ga0466699_350840_365_961 198
52 3300042597 Ga0466699_397590 Ga0466699_397590_1330_1926 198
53 3300042597 Ga0466699_417095 Ga0466699_417095_852_1448 198
54 3300042601 Ga0466707_325893 Ga0466707_325893_292_888 198
55 3300042620 Ga0466728_018717 Ga0466728_018717_2393_2989 198
56 3300042636 Ga0466703_082278 Ga0466703_082278_9183_9779 198
57 3300042636 Ga0466703_429046 Ga0466703_429046_9444_10040 198
58 3300042655 Ga0466727_201286 Ga0466727_201286_1251_1847 198
59 3300010167 Ga0123353_10012997 Ga0123353_100129975 199
60 3300038395 Ga0415639_007546 Ga0415639_007546_1761_2360 199
61 3300042590 Ga0466690_312359 Ga0466690_312359_4150_4749 199
62 3300042592 Ga0466693_110881 Ga0466693_110881_2129_2728 199
63 3300042594 Ga0466694_344780 Ga0466694_344780_199_798 199
64 3300042602 Ga0466713_074952 Ga0466713_074952_1410_2009 199
65 3300042610 Ga0466698_009270 Ga0466698_009270_179_778 199
66 3300042615 Ga0466711_472570 Ga0466711_472570_403_1002 199
67 3300042616 Ga0466715_148608 Ga0466715_148608_9997_10596 199
68 3300042618 Ga0466723_071252 Ga0466723_071252_27419_28018 199
69 3300042621 Ga0466729_230609 Ga0466729_230609_1786_2385 199
70 iso_pr_bacteria 2781125640 2781288239 199
71 iso_pr_bacteria 2781125652 2781311347 199
72 3300002450 JGI24695J34938_10006715 JGI24695J34938_100067151 200
73 3300002450 JGI24695J34938_10012348 JGI24695J34938_100123487 200
74 3300002450 JGI24695J34938_10035253 JGI24695J34938_100352533 200
75 3300002450 JGI24695J34938_10163398 JGI24695J34938_101633981 200
76 3300009784 Ga0123357_10128338 Ga0123357_101283381 200
77 3300009784 Ga0123357_10215754 Ga0123357_102157542 200
78 3300010167 Ga0123353_10347122 Ga0123353_103471223 200
79 3300010167 Ga0123353_11976325 Ga0123353_119763251 200
80 3300042591 Ga0466692_121742 Ga0466692_121742_1577_2179 200
81 3300042594 Ga0466694_181681 Ga0466694_181681_470_1072 200
82 3300042594 Ga0466694_342486 Ga0466694_342486_198_800 200
83 3300042601 Ga0466707_367166 Ga0466707_367166_500_1102 200
84 3300042643 Ga0466704_110192 Ga0466704_110192_16292_16894 200
85 3300042590 Ga0466690_031567 Ga0466690_031567_8038_8643 201
86 3300042605 Ga0466716_194058 Ga0466716_194058_5595_6200 201
87 3300042606 Ga0466719_092423 Ga0466719_092423_1288_1893 201
88 3300042608 Ga0466721_191339 Ga0466721_191339_3775_4380 201
89 3300042615 Ga0466711_259608 Ga0466711_259608_23515_24120 201
90 3300042620 Ga0466728_097758 Ga0466728_097758_21910_22515 201
91 3300042652 Ga0466708_064447 Ga0466708_064447_3631_4236 201
92 3300042652 Ga0466708_245071 Ga0466708_245071_6305_6910 201
93 3300010882 Ga0123354_10356021 Ga0123354_103560212 202
94 3300042593 Ga0466691_063795 Ga0466691_063795_1361_1969 202
95 3300042594 Ga0466694_000504 Ga0466694_000504_1921_2529 202
96 3300042612 Ga0466705_070798 Ga0466705_070798_2106_2714 202
97 3300042616 Ga0466715_186421 Ga0466715_186421_1135_1743 202
98 3300042616 Ga0466715_347823 Ga0466715_347823_4580_5188 202
99 3300042618 Ga0466723_288324 Ga0466723_288324_7730_8338 202
100 3300042643 Ga0466704_146832 Ga0466704_146832_2992_3600 202
101 3300042652 Ga0466708_061397 Ga0466708_061397_1620_2228 202
102 3300042655 Ga0466727_130717 Ga0466727_130717_321_929 202
103 iso_pr_bacteria 2781125659 2781328481 202
104 iso_pr_bacteria 2781125682 2781409224 202
105 3300002450 JGI24695J34938_10017234 JGI24695J34938_100172342 203
106 3300010049 Ga0123356_10010655 Ga0123356_100106557 203
107 3300010049 Ga0123356_10073401 Ga0123356_100734012 203
108 3300010049 Ga0123356_10241472 Ga0123356_102414722 203
109 3300042593 Ga0466691_063212 Ga0466691_063212_198_809 203
110 3300042648 Ga0466709_002003 Ga0466709_002003_153_764 203
111 3300042601 Ga0466707_356508 Ga0466707_356508_446_1060 204
112 3300042606 Ga0466719_072003 Ga0466719_072003_1819_2433 204
113 3300042643 Ga0466704_299238 Ga0466704_299238_216_830 204
114 3300009826 Ga0123355_10012757 Ga0123355_100127573 205
115 3300010167 Ga0123353_10069987 Ga0123353_100699872 205
116 3300042592 Ga0466693_140469 Ga0466693_140469_772_1389 205
117 3300042612 Ga0466705_038831 Ga0466705_038831_437_1054 205
118 3300042614 Ga0466712_113300 Ga0466712_113300_1207_1824 205
119 3300042616 Ga0466715_155956 Ga0466715_155956_963_1580 205
120 3300042609 Ga0466722_027035 Ga0466722_027035_359_979 206
121 3300042612 Ga0466705_034622 Ga0466705_034622_1029_1649 206
122 3300042620 Ga0466728_234115 Ga0466728_234115_687_1307 206
123 3300042601 Ga0466707_057707 Ga0466707_057707_4225_4878 207
124 3300042612 Ga0466705_412095 Ga0466705_412095_4052_4702 207
125 3300042615 Ga0466711_158478 Ga0466711_158478_8476_9099 207
126 3300042618 Ga0466723_331842 Ga0466723_331842_6159_6785 208
127 3300042652 Ga0466708_107418 Ga0466708_107418_6478_7104 208
128 3300042591 Ga0466692_190645 Ga0466692_190645_2124_2753 209
129 3300042596 Ga0466696_441242 Ga0466696_441242_11433_12065 210
130 3300042636 Ga0466703_100612 Ga0466703_100612_30643_31275 210
131 3300042648 Ga0466709_167604 Ga0466709_167604_364_996 210
132 3300042606 Ga0466719_572501 Ga0466719_572501_3113_3763 211
133 3300042615 Ga0466711_300254 Ga0466711_300254_2103_2759 211
134 3300042643 Ga0466704_068054 Ga0466704_068054_4925_5587 211
135 3300042652 Ga0466708_321737 Ga0466708_321737_22591_23226 211
136 3300010049 Ga0123356_10014911 Ga0123356_100149117 212
137 3300042615 Ga0466711_067069 Ga0466711_067069_4914_5552 212
138 3300042618 Ga0466723_227236 Ga0466723_227236_225_863 212
139 3300042624 Ga0466735_227067 Ga0466735_227067_62_703 213
140 3300042648 Ga0466709_223489 Ga0466709_223489_152_793 213
141 3300005200 Ga0072940_1099341 Ga0072940_10993415 217
142 3300042652 Ga0466708_128755 Ga0466708_128755_1193_1846 217
143 3300042655 Ga0466727_214822 Ga0466727_214822_343_1011 222

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00440 TetR_N Bacterial regulatory proteins, tetR family 14 57 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.