Protein Family IF10164

Metagenome Isolate
287 Members
105 Samples
251 Scaffolds
253.19 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_201130|Ga0466727_201130_1195_2049
Length
284 aa
Sequence
MRIRELCSGEPSGNRNKKIHTFGRKKSKTMETACITGATSGIGKAVAFRLAKENMNLIITGRRKERLCLLKNEIETAFGVKVHVLSFDVRNYDEVCTAFDGLPDEWKVVDVLVNNAGLAVGLDPLHRGNVDDWERMIDTNVKGLLYVTRAVSPGMVARKSGHIVNIGSIAGKEVYPNGAVYCATKHAVDALSQGMRMDLLAYGVRVTQICPGAVETEFSLVRFKGDQHRADQVYDGFVPLSAGDIAEAVGYAVTRPAHVNIQDLLVMPAAQAAATRFRKTDDRE

📊 Sample Types

Isolate 12.5%
Metagenome 87.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 16.7%
Kalotermitidae 13.7%
Blattidae 9.8%
Rhinotermitidae 4.9%
Elmidae 3.9%
Termopsidae 3.9%
Drosophilidae 2.9%
Passalidae 2.0%
Apidae 2.0%
Hydrophilidae 2.0%
Hodotermitidae 1.0%
Armadillidiidae 1.0%
Culicidae 1.0%
Cambaridae 1.0%
Tenebrionidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 276
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
2 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
3 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
4 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
5 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
6 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
7 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
8 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
9 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 2832343623 Apibacter adventoris wkB180 Isolate Apidae
16 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
17 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
25 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
26 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
35 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
36 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
37 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
38 2904728850 Flavobacterium sp. xlx-214 Isolate
39 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
52 2832372155 Apibacter adventoris wkB301 Isolate Apidae
53 2864836148 Arcicella rosea S00070 Isolate Elmidae
54 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
56 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
57 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
58 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
59 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
60 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
61 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
62 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
63 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
64 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
65 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
66 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
67 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
68 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
69 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
70 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
71 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
72 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
73 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
76 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
77 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
83 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
84 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
85 3300007506 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut Metagenome Drosophilidae
86 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
87 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
88 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
89 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
90 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
91 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
92 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
93 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
94 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
95 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
96 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
97 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
98 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
99 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
100 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
101 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
102 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
103 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
104 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
105 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_165815 3300042611 Bacteria 1428
2 Ga0466705_008942 3300042612 Bacteria 28063
3 Ga0466705_056917 3300042612 Bacteria 2814
4 Ga0466733_184917 3300042659 Bacteria 3794
5 Ga0466735_030194 3300042624 Bacteria 2048
6 Ga0466735_222930 3300042624 Bacteria 1496
7 Ga0466730_042109 3300042625 Bacteria 1038
8 Ga0466703_263230 3300042636 Bacteria 2698
9 Ga0123356_10068551 3300010049 Unclassified 3323
10 Ga0123353_10110423 3300010167 Bacteria 4431
11 Ga0466711_092647 3300042615 Bacteria 4513
12 Ga0466715_035287 3300042616 Bacteria 39744
13 Ga0466715_351557 3300042616 Bacteria 1537
14 Ga0466715_544735 3300042616 Bacteria 2371
15 Ga0466715_618535 3300042616 Bacteria 4899
16 Ga0466723_194801 3300042618 Bacteria 6271
17 Ga0466726_208565 3300042619 Bacteria 1388
18 Ga0466701_036999 3300042598 Bacteria 203039
19 Ga0466706_031713 3300042599 Bacteria 8247
20 Ga0466706_242525 3300042599 Bacteria 1209
21 Ga0466707_102347 3300042601 Bacteria 20235
22 Ga0466713_094496 3300042602 Bacteria 333875
23 Ga0466713_097974 3300042602 Bacteria 40387
24 Ga0466713_141379 3300042602 Bacteria 226907
25 Ga0466716_281830 3300042605 Bacteria 3030
26 Ga0466719_035707 3300042606 Bacteria 1225
27 Ga0466719_290764 3300042606 Bacteria 1354
28 Ga0466722_103833 3300042609 Bacteria 2157
29 Ga0466698_253218 3300042610 Bacteria 1496
30 Ga0160448_101619 3300012854 Unclassified 7217
31 Ga0466656_372801 3300042550 Bacteria 1361
32 Ga0466694_403681 3300042594 Bacteria 3138
33 Ga0466695_240649 3300042595 Bacteria 1956
34 Ga0466696_222221 3300042596 Bacteria 29066
35 Ga0466696_376281 3300042596 Bacteria 1619
36 2227591272 2225789004 Bacteria 49846
37 IMNBL1DRAFT_c0002023 3300000062 Bacteria 14529
38 IMNBL1DRAFT_c0085849 3300000062 Bacteria 873
39 JGI24702J35022_10008532 3300002462 Bacteria 5796
40 JGI24699J35502_11133533 3300002509 Bacteria 11597
41 JGI24696J40584_12950505 3300002834 Bacteria 2155
42 Ga0072941_1085920 3300005201 Unclassified 2889
43 Ga0466705_208960 3300042612 Bacteria 2964
44 Ga0466732_439247 3300042656 Bacteria 2788
45 Ga0466733_008681 3300042659 Bacteria 65582
46 Ga0466704_405258 3300042643 Bacteria 14576
47 Ga0466704_541739 3300042643 Bacteria 8003
48 Ga0466709_124130 3300042648 Bacteria 272718
49 Ga0466727_010188 3300042655 Bacteria 8038
50 Ga0123356_10027594 3300010049 Bacteria 5320
51 Ga0123356_10952199 3300010049 Bacteria 1029
52 Ga0123353_10189023 3300010167 Bacteria 3253
53 Ga0466711_314979 3300042615 Bacteria 2867
54 Ga0466718_004552 3300042617 Bacteria 3028
55 Ga0466718_008016 3300042617 Bacteria 2904
56 Ga0466718_051448 3300042617 Bacteria 2407
57 Ga0466718_107223 3300042617 Bacteria 2830
58 Ga0466723_111552 3300042618 Bacteria 31046
59 Ga0466728_087347 3300042620 Bacteria 5073
60 Ga0466701_029124 3300042598 Bacteria 1171
61 Ga0466701_094519 3300042598 Bacteria 1506
62 Ga0466706_140021 3300042599 Bacteria 25645
63 Ga0466706_221149 3300042599 Bacteria 2143
64 Ga0466700_331546 3300042600 Bacteria 8869
65 Ga0466713_104700 3300042602 Bacteria 45952
66 Ga0466714_053131 3300042603 Bacteria 3853
67 Ga0466717_224220 3300042604 Bacteria 1021
68 Ga0466717_282468 3300042604 Bacteria 1255
69 Ga0466722_082515 3300042609 Bacteria 19321
70 Ga0466722_216227 3300042609 Bacteria 27341
71 Ga0466690_295946 3300042590 Bacteria 10455
72 Ga0466692_116208 3300042591 Unclassified 1396
73 Ga0466693_273261 3300042592 Bacteria 1150
74 Ga0466699_064523 3300042597 Bacteria 2123
75 Ga0466699_362178 3300042597 Bacteria 2276
76 IMNBL1DRAFT_c0003597 3300000062 Bacteria 9826
77 JGI24696J40584_12959243 3300002834 Bacteria 4874
78 Ga0072940_1207802 3300005200 Bacteria 1032
79 Ga0466732_124658 3300042656 Bacteria 1381
80 Ga0466732_160752 3300042656 Bacteria 7677
81 Ga0466733_150302 3300042659 Bacteria 45980
82 Ga0562377_0004 3300056842 Bacteria 3525959
83 Ga0466734_164259 3300042623 Bacteria 6089
84 Ga0466703_275691 3300042636 Bacteria 4182
85 Ga0466703_284468 3300042636 Bacteria 6607
86 Ga0466703_389982 3300042636 Bacteria 1221
87 Ga0466703_417830 3300042636 Bacteria 13066
88 Ga0466709_025289 3300042648 Bacteria 2392
89 Ga0466708_004540 3300042652 Bacteria 33290
90 Ga0466708_018399 3300042652 Bacteria 49081
91 Ga0466708_125096 3300042652 Bacteria 9675
92 Ga0466725_089078 3300042654 Bacteria 11624
93 Ga0466725_194480 3300042654 Bacteria 6695
94 Ga0466725_205968 3300042654 Bacteria 2939
95 Ga0123353_10001103 3300010167 Bacteria 32862
96 Ga0123354_10014550 3300010882 Bacteria 12257
97 Ga0466711_093965 3300042615 Bacteria 24756
98 Ga0466711_107915 3300042615 Bacteria 4821
99 Ga0466715_047096 3300042616 Bacteria 15770
100 Ga0466726_048132 3300042619 Bacteria 1076
101 Ga0466720_067607 3300042607 Bacteria 5593
102 Ga0466722_177586 3300042609 Bacteria 1807
103 Ga0466690_170288 3300042590 Bacteria 25098
104 Ga0466693_269671 3300042592 Bacteria 1407
105 JGI24702J35022_10061219 3300002462 Bacteria 2013
106 JGI24705J35276_12224784 3300002504 Bacteria 2648
107 Ga0068302_10266163 3300005071 Bacteria 1449
108 Ga0068302_10269826 3300005071 Unclassified 840
109 Ga0068305_10008662 3300005083 Bacteria 19701
110 Ga0068305_10060120 3300005083 Bacteria 9059
111 Ga0105006_1047261 3300007506 Unclassified 26576
112 Ga0466697_200358 3300042611 Bacteria 7852
113 Ga0466733_107820 3300042659 Bacteria 13928
114 Ga0466733_173013 3300042659 Bacteria 3957
115 Ga0466730_071786 3300042625 Bacteria 741189
116 Ga0466702_125686 3300042635 Bacteria 1184
117 Ga0466703_024385 3300042636 Bacteria 10391
118 Ga0123356_10649280 3300010049 Bacteria 1222
119 Ga0123353_10482084 3300010167 Bacteria 1814
120 Ga0466712_184637 3300042614 Bacteria 1947
121 Ga0466701_080453 3300042598 Bacteria 50311
122 Ga0466701_089949 3300042598 Bacteria 1476
123 Ga0466706_019239 3300042599 Bacteria 7993
124 Ga0466706_156931 3300042599 Bacteria 8948
125 Ga0466706_165084 3300042599 Bacteria 195712
126 Ga0466713_022356 3300042602 Bacteria 45305
127 Ga0466716_323311 3300042605 Bacteria 15345
128 Ga0466719_015020 3300042606 Bacteria 6294
129 Ga0466719_142197 3300042606 Bacteria 2348
130 Ga0466720_069115 3300042607 Bacteria 3724
131 Ga0466720_194799 3300042607 Bacteria 1520
132 Ga0466722_042812 3300042609 Bacteria 110303
133 Ga0160457_1005452 3300012858 Bacteria 1940
134 Ga0264413_142884 3300024493 Bacteria 2838
135 Ga0466694_407191 3300042594 Bacteria 1510
136 Ga0466696_176785 3300042596 Bacteria 19925
137 2227197466 2225789004 Bacteria 7826
138 2227477401 2225789004 Bacteria 22517
139 JGI24696J40584_12959697 3300002834 Bacteria 5491
140 Ga0104048_1004896 3300007143 Bacteria 4570
141 Ga0466705_252069 3300042612 Bacteria 4443
142 Ga0466705_323785 3300042612 Bacteria 10850
143 Ga0466729_268715 3300042621 Bacteria 1336
144 Ga0466704_270794 3300042643 Bacteria 3895
145 Ga0466704_285742 3300042643 Bacteria 10079
146 Ga0466708_254922 3300042652 Bacteria 84207
147 Ga0466727_110981 3300042655 Bacteria 13533
148 Ga0466727_175583 3300042655 Bacteria 9330
149 Ga0123356_10256571 3300010049 Bacteria 1829
150 Ga0123353_10870428 3300010167 Bacteria 1232
151 Ga0466715_337260 3300042616 Bacteria 33337
152 Ga0466715_529876 3300042616 Bacteria 14179
153 Ga0466728_324182 3300042620 Bacteria 12575
154 Ga0466729_125288 3300042621 Bacteria 15046
155 Ga0466706_199169 3300042599 Bacteria 2033
156 Ga0466700_298764 3300042600 Bacteria 1603
157 Ga0466719_007351 3300042606 Bacteria 4730
158 Ga0466722_180542 3300042609 Bacteria 3379
159 Ga0466699_020510 3300042597 Bacteria 1463
160 2227517417 2225789004 Bacteria 3414
161 JGI24702J35022_10133134 3300002462 Bacteria 1381
162 JGI24696J40584_12937502 3300002834 Bacteria 1604
163 Ga0072941_1257876 3300005201 Bacteria 2024
164 Ga0104048_1004310 3300007143 Bacteria 26436
165 Ga0466705_061109 3300042612 Bacteria 5762
166 Ga0466732_074525 3300042656 Bacteria 3372
167 Ga0466730_099794 3300042625 Bacteria 5228
168 Ga0466704_185226 3300042643 Bacteria 2628
169 Ga0466709_105464 3300042648 Bacteria 22179
170 Ga0466709_114487 3300042648 Bacteria 52942
171 Ga0466709_312765 3300042648 Bacteria 159709
172 Ga0466708_410829 3300042652 Bacteria 6801
173 Ga0466727_201130 3300042655 Bacteria 2973
174 Ga0123357_10197460 3300009784 Unclassified 2300
175 Ga0123353_10018575 3300010167 Bacteria 10286
176 Ga0466712_050713 3300042614 Bacteria 18789
177 Ga0466712_320519 3300042614 Bacteria 1102
178 Ga0466715_191298 3300042616 Bacteria 13666
179 Ga0466706_157184 3300042599 Bacteria 11339
180 Ga0466713_146465 3300042602 Bacteria 20927
181 Ga0466714_126488 3300042603 Bacteria 3379
182 Ga0466716_477735 3300042605 Bacteria 4061
183 Ga0466698_020118 3300042610 Bacteria 2338
184 Ga0466657_244615 3300042582 Bacteria 77081
185 Ga0466690_364720 3300042590 Bacteria 1343
186 Ga0466691_109620 3300042593 Bacteria 15230
187 2227566334 2225789004 Bacteria 2665
188 JGI24698J34947_10005397 3300002449 Bacteria 7012
189 JGI24702J35022_10105590 3300002462 Bacteria 1545
190 JGI24705J35276_12235739 3300002504 Bacteria 6915
191 Ga0072941_1085921 3300005201 Bacteria 6311
192 Ga0104048_1024903 3300007143 Bacteria 3119
193 Ga0105553_1001296 3300007767 Unclassified 5795
194 Ga0466733_188245 3300042659 Unclassified 4430
195 Ga0466731_271640 3300042622 Bacteria 4989
196 Ga0466731_428468 3300042622 Bacteria 1203
197 Ga0466702_348931 3300042635 Bacteria 2234
198 Ga0466704_456099 3300042643 Bacteria 19701
199 Ga0466704_612519 3300042643 Bacteria 2126
200 Ga0466708_294627 3300042652 Bacteria 11575
201 Ga0123353_10044792 3300010167 Bacteria 7016
202 Ga0123353_10845272 3300010167 Bacteria 1256
203 Ga0466710_244897 3300042613 Bacteria 1054
204 Ga0466711_174793 3300042615 Bacteria 9218
205 Ga0466715_523511 3300042616 Bacteria 5552
206 Ga0466723_096809 3300042618 Bacteria 1055
207 Ga0466706_288890 3300042599 Bacteria 2870
208 Ga0466700_136330 3300042600 Bacteria 2641
209 Ga0466719_260891 3300042606 Bacteria 8059
210 Ga0466698_373949 3300042610 Bacteria 1646
211 Ga0466694_382164 3300042594 Bacteria 2311
212 Ga0466695_103373 3300042595 Bacteria 3521
213 Ga0466695_152303 3300042595 Bacteria 14347
214 Ga0466696_125800 3300042596 Bacteria 19941
215 JGI24702J35022_10002590 3300002462 Bacteria 10992
216 Ga0466697_121233 3300042611 Bacteria 1116
217 Ga0466705_065314 3300042612 Bacteria 9161
218 Ga0466702_119213 3300042635 Bacteria 1163
219 Ga0466704_139986 3300042643 Bacteria 2341
220 Ga0466709_357287 3300042648 Bacteria 3006
221 Ga0466709_381563 3300042648 Bacteria 1317
222 Ga0123355_10120426 3300009826 Bacteria 4073
223 Ga0123353_10058102 3300010167 Bacteria 6197
224 Ga0466705_432608 3300042612 Bacteria 1889
225 Ga0466710_147835 3300042613 Bacteria 1272
226 Ga0466723_039464 3300042618 Bacteria 3055
227 Ga0466723_167946 3300042618 Unclassified 3463
228 Ga0466726_060107 3300042619 Bacteria 1721
229 Ga0466726_321610 3300042619 Bacteria 7482
230 Ga0466728_384531 3300042620 Bacteria 1480
231 Ga0466701_062333 3300042598 Bacteria 75358
232 Ga0466701_067087 3300042598 Bacteria 1738
233 Ga0466706_053329 3300042599 Bacteria 19896
234 Ga0466707_262205 3300042601 Bacteria 6853
235 Ga0466713_074381 3300042602 Bacteria 4005
236 Ga0466713_085907 3300042602 Bacteria 11127
237 Ga0466713_103592 3300042602 Bacteria 138334
238 Ga0466717_216263 3300042604 Bacteria 6467
239 Ga0466719_522880 3300042606 Bacteria 4705
240 Ga0466697_020000 3300042611 Bacteria 1642
241 Ga0264413_104140 3300024493 Bacteria 1513
242 Ga0466690_115556 3300042590 Bacteria 15437
243 Ga0466692_043458 3300042591 Bacteria 1614
244 Ga0466692_077395 3300042591 Bacteria 17046
245 Ga0466691_001057 3300042593 Bacteria 2027
246 Ga0466694_115749 3300042594 Bacteria 2098
247 Ga0466694_286929 3300042594 Bacteria 6464
248 JGI24702J35022_10057988 3300002462 Bacteria 2068
249 Ga0072941_1558307 3300005201 Bacteria 1959
250 Ga0104048_1022354 3300007143 Bacteria 4513
251 Ga0105006_1022682 3300007506 Unclassified 7842

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007767 Ga0105553_1001296 Ga0105553_10012962 216
2 3300042594 Ga0466694_286929 Ga0466694_286929_2660_3316 218
3 3300007506 Ga0105006_1047261 Ga0105006_104726120 223
4 3300042598 Ga0466701_067087 Ga0466701_067087_110_805 231
5 3300042635 Ga0466702_119213 Ga0466702_119213_337_1032 231
6 3300042612 Ga0466705_432608 Ga0466705_432608_823_1575 233
7 3300042618 Ga0466723_096809 Ga0466723_096809_330_1034 234
8 3300042654 Ga0466725_205968 Ga0466725_205968_45_797 237
9 3300005201 Ga0072941_1085920 Ga0072941_10859204 240
10 3300042605 Ga0466716_477735 Ga0466716_477735_2245_3003 244
11 iso_pr_bacteria 2904728850 2904730486 247
12 iso_pr_bacteria 2958471994 2958473296 247
13 3300005083 Ga0068305_10060120 Ga0068305_1006012012 249
14 3300007143 Ga0104048_1022354 Ga0104048_10223543 249
15 3300024493 Ga0264413_104140 Ga0264413_1041401 249
16 3300042598 Ga0466701_062333 Ga0466701_062333_51295_52044 249
17 3300042598 Ga0466701_080453 Ga0466701_080453_10836_11585 249
18 3300042616 Ga0466715_544735 Ga0466715_544735_204_953 249
19 3300042624 Ga0466735_222930 Ga0466735_222930_460_1209 249
20 3300042625 Ga0466730_071786 Ga0466730_071786_160393_161142 249
21 3300042643 Ga0466704_285742 Ga0466704_285742_6294_7043 249
22 iso_pr_bacteria 2864822740 2864825110 249
23 iso_pr_bacteria 2864882932 2864885301 249
24 iso_pr_bacteria 2864891731 2864893976 249
25 iso_pr_bacteria 2940193328 2940195479 249
26 iso_pr_bacteria 2940336608 2940338754 249
27 3300000062 IMNBL1DRAFT_c0085849 IMNBL1DRAFT_00858491 250
28 3300002834 JGI24696J40584_12937502 JGI24696J40584_129375021 250
29 3300012858 Ga0160457_1005452 Ga0160457_10054522 250
30 3300042550 Ga0466656_372801 Ga0466656_372801_337_1089 250
31 3300042595 Ga0466695_240649 Ga0466695_240649_1096_1848 250
32 3300042599 Ga0466706_165084 Ga0466706_165084_52436_53188 250
33 3300042601 Ga0466707_102347 Ga0466707_102347_3123_3875 250
34 3300042602 Ga0466713_097974 Ga0466713_097974_31303_32055 250
35 3300042604 Ga0466717_224220 Ga0466717_224220_93_845 250
36 3300042609 Ga0466722_177586 Ga0466722_177586_765_1517 250
37 3300042611 Ga0466697_121233 Ga0466697_121233_110_862 250
38 3300042611 Ga0466697_165815 Ga0466697_165815_198_950 250
39 3300042612 Ga0466705_252069 Ga0466705_252069_1370_2122 250
40 3300042613 Ga0466710_244897 Ga0466710_244897_186_938 250
41 3300042615 Ga0466711_107915 Ga0466711_107915_432_1184 250
42 3300042618 Ga0466723_111552 Ga0466723_111552_26464_27216 250
43 3300042619 Ga0466726_048132 Ga0466726_048132_92_844 250
44 3300042622 Ga0466731_428468 Ga0466731_428468_440_1192 250
45 3300042635 Ga0466702_125686 Ga0466702_125686_122_874 250
46 3300042654 Ga0466725_089078 Ga0466725_089078_366_1118 250
47 3300042656 Ga0466732_074525 Ga0466732_074525_999_1751 250
48 iso_pr_bacteria 2820767225 2820767833 250
49 iso_pr_bacteria 2820772500 2820773295 250
50 iso_pr_bacteria 2820783511 2820784968 250
51 iso_pr_bacteria 2820797595 2820799784 250
52 2225789004 2227591272 2228150117 251
53 3300002462 JGI24702J35022_10061219 JGI24702J35022_100612193 251
54 3300002462 JGI24702J35022_10105590 JGI24702J35022_101055902 251
55 3300002834 JGI24696J40584_12950505 JGI24696J40584_129505052 251
56 3300002834 JGI24696J40584_12959243 JGI24696J40584_129592433 251
57 3300002834 JGI24696J40584_12959697 JGI24696J40584_129596972 251
58 3300009784 Ga0123357_10197460 Ga0123357_101974602 251
59 3300010049 Ga0123356_10649280 Ga0123356_106492802 251
60 3300010167 Ga0123353_10001103 Ga0123353_1000110323 251
61 3300010167 Ga0123353_10058102 Ga0123353_100581025 251
62 3300042592 Ga0466693_269671 Ga0466693_269671_163_918 251
63 3300042594 Ga0466694_115749 Ga0466694_115749_206_961 251
64 3300042594 Ga0466694_407191 Ga0466694_407191_572_1327 251
65 3300042598 Ga0466701_029124 Ga0466701_029124_97_852 251
66 3300042598 Ga0466701_036999 Ga0466701_036999_34462_35217 251
67 3300042598 Ga0466701_089949 Ga0466701_089949_193_948 251
68 3300042598 Ga0466701_094519 Ga0466701_094519_374_1129 251
69 3300042602 Ga0466713_104700 Ga0466713_104700_20243_20998 251
70 3300042606 Ga0466719_015020 Ga0466719_015020_3952_4707 251
71 3300042607 Ga0466720_069115 Ga0466720_069115_758_1513 251
72 3300042607 Ga0466720_194799 Ga0466720_194799_224_979 251
73 3300042609 Ga0466722_180542 Ga0466722_180542_429_1184 251
74 3300042610 Ga0466698_020118 Ga0466698_020118_1221_1976 251
75 3300042612 Ga0466705_323785 Ga0466705_323785_5051_5806 251
76 3300042614 Ga0466712_184637 Ga0466712_184637_1148_1903 251
77 3300042618 Ga0466723_194801 Ga0466723_194801_4500_5255 251
78 3300042622 Ga0466731_271640 Ga0466731_271640_2836_3591 251
79 3300042636 Ga0466703_263230 Ga0466703_263230_310_1065 251
80 3300042643 Ga0466704_185226 Ga0466704_185226_1525_2280 251
81 3300042643 Ga0466704_270794 Ga0466704_270794_389_1144 251
82 3300042652 Ga0466708_254922 Ga0466708_254922_18252_19007 251
83 3300042659 Ga0466733_008681 Ga0466733_008681_49857_50612 251
84 3300042659 Ga0466733_150302 Ga0466733_150302_18428_19183 251
85 iso_pr_bacteria 2820748953 2820748987 251
86 iso_pr_bacteria 2820753519 2820753840 251
87 iso_pr_bacteria 2820755292 2820755437 251
88 iso_pr_bacteria 2820757377 2820757705 251
89 iso_pr_bacteria 2864836148 2864837191 251
90 2225789004 2227197466 2227621757 252
91 2225789004 2227477401 2227931328 252
92 2225789004 2227566334 2228108287 252
93 3300002504 JGI24705J35276_12224784 JGI24705J35276_122247843 252
94 3300002509 JGI24699J35502_11133533 JGI24699J35502_111335334 252
95 3300005200 Ga0072940_1207802 Ga0072940_12078022 252
96 3300007143 Ga0104048_1004310 Ga0104048_100431022 252
97 3300007143 Ga0104048_1004896 Ga0104048_10048962 252
98 3300007143 Ga0104048_1024903 Ga0104048_10249033 252
99 3300010167 Ga0123353_10189023 Ga0123353_101890234 252
100 3300012854 Ga0160448_101619 Ga0160448_1016195 252
101 3300042590 Ga0466690_115556 Ga0466690_115556_1757_2515 252
102 3300042590 Ga0466690_170288 Ga0466690_170288_19119_19877 252
103 3300042590 Ga0466690_295946 Ga0466690_295946_2346_3104 252
104 3300042590 Ga0466690_364720 Ga0466690_364720_157_915 252
105 3300042592 Ga0466693_273261 Ga0466693_273261_236_994 252
106 3300042594 Ga0466694_403681 Ga0466694_403681_27_785 252
107 3300042596 Ga0466696_176785 Ga0466696_176785_16320_17078 252
108 3300042596 Ga0466696_222221 Ga0466696_222221_19892_20650 252
109 3300042599 Ga0466706_019239 Ga0466706_019239_2441_3199 252
110 3300042599 Ga0466706_031713 Ga0466706_031713_5544_6302 252
111 3300042599 Ga0466706_156931 Ga0466706_156931_7561_8319 252
112 3300042599 Ga0466706_199169 Ga0466706_199169_183_941 252
113 3300042599 Ga0466706_242525 Ga0466706_242525_184_942 252
114 3300042599 Ga0466706_288890 Ga0466706_288890_1671_2429 252
115 3300042602 Ga0466713_085907 Ga0466713_085907_4325_5083 252
116 3300042603 Ga0466714_126488 Ga0466714_126488_2051_2809 252
117 3300042606 Ga0466719_290764 Ga0466719_290764_334_1092 252
118 3300042606 Ga0466719_522880 Ga0466719_522880_1202_1960 252
119 3300042610 Ga0466698_373949 Ga0466698_373949_292_1050 252
120 3300042611 Ga0466697_020000 Ga0466697_020000_813_1571 252
121 3300042612 Ga0466705_008942 Ga0466705_008942_6224_6982 252
122 3300042612 Ga0466705_056917 Ga0466705_056917_1015_1773 252
123 3300042613 Ga0466710_147835 Ga0466710_147835_320_1078 252
124 3300042616 Ga0466715_191298 Ga0466715_191298_5128_5886 252
125 3300042616 Ga0466715_337260 Ga0466715_337260_30715_31473 252
126 3300042616 Ga0466715_618535 Ga0466715_618535_2401_3159 252
127 3300042619 Ga0466726_060107 Ga0466726_060107_415_1173 252
128 3300042620 Ga0466728_087347 Ga0466728_087347_2116_2874 252
129 3300042620 Ga0466728_324182 Ga0466728_324182_7126_7884 252
130 3300042624 Ga0466735_030194 Ga0466735_030194_679_1437 252
131 3300042636 Ga0466703_284468 Ga0466703_284468_5129_5887 252
132 3300042636 Ga0466703_417830 Ga0466703_417830_10677_11435 252
133 3300042643 Ga0466704_139986 Ga0466704_139986_790_1548 252
134 3300042643 Ga0466704_405258 Ga0466704_405258_11921_12679 252
135 3300042648 Ga0466709_025289 Ga0466709_025289_1362_2120 252
136 3300042648 Ga0466709_105464 Ga0466709_105464_15227_15985 252
137 3300042648 Ga0466709_357287 Ga0466709_357287_544_1302 252
138 3300042652 Ga0466708_294627 Ga0466708_294627_5395_6153 252
139 3300042654 Ga0466725_194480 Ga0466725_194480_2033_2791 252
140 3300042655 Ga0466727_175583 Ga0466727_175583_3050_3808 252
141 3300042656 Ga0466732_160752 Ga0466732_160752_4387_5145 252
142 3300042659 Ga0466733_184917 Ga0466733_184917_480_1238 252
143 3300056842 Ga0562377_0004 Ga0562377_0004_813320_814078 252
144 iso_pr_bacteria 2695420317 2695485213 252
145 iso_pr_bacteria 2695420931 2698111921 252
146 iso_pr_bacteria 2873600114 2873602917 252
147 iso_pr_bacteria 2873610414 2873613281 252
148 iso_pr_bacteria 2910926975 2910928251 252
149 iso_pr_bacteria 8100157865 8100158493 252
150 2225789004 2227517417 2228017503 253
151 3300000062 IMNBL1DRAFT_c0002023 IMNBL1DRAFT_000202314 253
152 3300000062 IMNBL1DRAFT_c0003597 IMNBL1DRAFT_00035977 253
153 3300002462 JGI24702J35022_10008532 JGI24702J35022_100085322 253
154 3300002462 JGI24702J35022_10057988 JGI24702J35022_100579881 253
155 3300002462 JGI24702J35022_10133134 JGI24702J35022_101331342 253
156 3300005071 Ga0068302_10269826 Ga0068302_102698261 253
157 3300010167 Ga0123353_10044792 Ga0123353_100447926 253
158 3300010167 Ga0123353_10110423 Ga0123353_101104234 253
159 3300010167 Ga0123353_10870428 Ga0123353_108704281 253
160 3300010882 Ga0123354_10014550 Ga0123354_100145508 253
161 3300042582 Ga0466657_244615 Ga0466657_244615_43796_44557 253
162 3300042591 Ga0466692_116208 Ga0466692_116208_34_795 253
163 3300042594 Ga0466694_382164 Ga0466694_382164_1089_1850 253
164 3300042596 Ga0466696_125800 Ga0466696_125800_13000_13761 253
165 3300042596 Ga0466696_376281 Ga0466696_376281_204_965 253
166 3300042599 Ga0466706_157184 Ga0466706_157184_4439_5200 253
167 3300042600 Ga0466700_136330 Ga0466700_136330_811_1572 253
168 3300042600 Ga0466700_298764 Ga0466700_298764_753_1514 253
169 3300042600 Ga0466700_331546 Ga0466700_331546_388_1149 253
170 3300042601 Ga0466707_262205 Ga0466707_262205_2779_3540 253
171 3300042602 Ga0466713_074381 Ga0466713_074381_614_1375 253
172 3300042602 Ga0466713_103592 Ga0466713_103592_38461_39222 253
173 3300042603 Ga0466714_053131 Ga0466714_053131_1261_2022 253
174 3300042604 Ga0466717_216263 Ga0466717_216263_3563_4324 253
175 3300042604 Ga0466717_282468 Ga0466717_282468_470_1231 253
176 3300042606 Ga0466719_007351 Ga0466719_007351_2334_3095 253
177 3300042606 Ga0466719_142197 Ga0466719_142197_1112_1873 253
178 3300042610 Ga0466698_253218 Ga0466698_253218_225_986 253
179 3300042612 Ga0466705_061109 Ga0466705_061109_3700_4461 253
180 3300042614 Ga0466712_320519 Ga0466712_320519_282_1043 253
181 3300042615 Ga0466711_174793 Ga0466711_174793_2039_2800 253
182 3300042616 Ga0466715_047096 Ga0466715_047096_13817_14578 253
183 3300042616 Ga0466715_523511 Ga0466715_523511_476_1237 253
184 3300042619 Ga0466726_321610 Ga0466726_321610_3618_4379 253
185 3300042620 Ga0466728_384531 Ga0466728_384531_477_1238 253
186 3300042621 Ga0466729_268715 Ga0466729_268715_194_955 253
187 3300042636 Ga0466703_024385 Ga0466703_024385_9339_10100 253
188 3300042648 Ga0466709_124130 Ga0466709_124130_187141_187902 253
189 3300042648 Ga0466709_312765 Ga0466709_312765_120356_121117 253
190 3300042659 Ga0466733_107820 Ga0466733_107820_11841_12602 253
191 iso_pr_bacteria 2820750388 2820750777 253
192 iso_pr_bacteria 2910930387 2910930945 253
193 iso_pr_bacteria 2910949487 2910952213 253
194 3300002504 JGI24705J35276_12235739 JGI24705J35276_122357392 254
195 3300005071 Ga0068302_10266163 Ga0068302_102661631 254
196 3300005083 Ga0068305_10008662 Ga0068305_100086623 254
197 3300009826 Ga0123355_10120426 Ga0123355_101204263 254
198 3300010049 Ga0123356_10027594 Ga0123356_100275942 254
199 3300010049 Ga0123356_10256571 Ga0123356_102565714 254
200 3300010049 Ga0123356_10952199 Ga0123356_109521991 254
201 3300010167 Ga0123353_10018575 Ga0123353_100185754 254
202 3300042591 Ga0466692_077395 Ga0466692_077395_8547_9311 254
203 3300042599 Ga0466706_053329 Ga0466706_053329_212_976 254
204 3300042599 Ga0466706_140021 Ga0466706_140021_14159_14923 254
205 3300042602 Ga0466713_146465 Ga0466713_146465_4673_5437 254
206 3300042612 Ga0466705_208960 Ga0466705_208960_949_1713 254
207 3300042643 Ga0466704_456099 Ga0466704_456099_44_808 254
208 3300042655 Ga0466727_010188 Ga0466727_010188_5194_5958 254
209 3300042659 Ga0466733_173013 Ga0466733_173013_45_809 254
210 3300010049 Ga0123356_10068551 Ga0123356_100685514 255
211 3300024493 Ga0264413_142884 Ga0264413_1428843 255
212 3300042595 Ga0466695_103373 Ga0466695_103373_741_1508 255
213 3300042602 Ga0466713_022356 Ga0466713_022356_25506_26273 255
214 3300042609 Ga0466722_082515 Ga0466722_082515_17376_18143 255
215 3300042611 Ga0466697_200358 Ga0466697_200358_1945_2712 255
216 3300042615 Ga0466711_092647 Ga0466711_092647_2655_3422 255
217 3300042615 Ga0466711_093965 Ga0466711_093965_7880_8647 255
218 3300042616 Ga0466715_529876 Ga0466715_529876_5834_6601 255
219 3300042618 Ga0466723_039464 Ga0466723_039464_662_1429 255
220 3300042643 Ga0466704_612519 Ga0466704_612519_321_1088 255
221 3300042648 Ga0466709_114487 Ga0466709_114487_17646_18413 255
222 3300042652 Ga0466708_018399 Ga0466708_018399_15800_16567 255
223 3300042652 Ga0466708_410829 Ga0466708_410829_5863_6630 255
224 3300042655 Ga0466727_110981 Ga0466727_110981_6499_7266 255
225 3300042656 Ga0466732_439247 Ga0466732_439247_1393_2160 255
226 iso_pr_bacteria 2832343623 2832344446 255
227 iso_pr_bacteria 2832372155 2832373312 255
228 iso_pr_bacteria 2910942425 2910944930 255
229 iso_pr_bacteria 2940244548 2940245840 255
230 iso_pr_bacteria 2940248789 2940250008 255
231 iso_pr_bacteria 2940253009 2940254266 255
232 iso_pr_bacteria 2940257232 2940258250 255
233 iso_pr_bacteria 8100166142 8100166719 255
234 3300010167 Ga0123353_10845272 Ga0123353_108452721 256
235 3300042593 Ga0466691_001057 Ga0466691_001057_959_1729 256
236 3300042597 Ga0466699_020510 Ga0466699_020510_35_805 256
237 3300042602 Ga0466713_094496 Ga0466713_094496_187663_188433 256
238 3300042605 Ga0466716_323311 Ga0466716_323311_4135_4905 256
239 3300042607 Ga0466720_067607 Ga0466720_067607_868_1638 256
240 3300042616 Ga0466715_351557 Ga0466715_351557_578_1348 256
241 3300042617 Ga0466718_004552 Ga0466718_004552_1018_1788 256
242 3300042617 Ga0466718_008016 Ga0466718_008016_1266_2036 256
243 3300042617 Ga0466718_051448 Ga0466718_051448_874_1644 256
244 3300042617 Ga0466718_107223 Ga0466718_107223_1016_1786 256
245 3300042618 Ga0466723_167946 Ga0466723_167946_2303_3073 256
246 3300042621 Ga0466729_125288 Ga0466729_125288_4926_5696 256
247 3300042656 Ga0466732_124658 Ga0466732_124658_577_1347 256
248 iso_pr_bacteria 2820947865 2820949977 256
249 3300005201 Ga0072941_1085921 Ga0072941_10859215 257
250 3300005201 Ga0072941_1558307 Ga0072941_15583073 257
251 3300042612 Ga0466705_065314 Ga0466705_065314_3304_4077 257
252 3300042635 Ga0466702_348931 Ga0466702_348931_1378_2151 257
253 3300042652 Ga0466708_004540 Ga0466708_004540_29125_29898 257
254 3300042597 Ga0466699_064523 Ga0466699_064523_807_1583 258
255 3300042602 Ga0466713_141379 Ga0466713_141379_57017_57793 258
256 iso_pr_bacteria 2820737921 2820738462 258
257 iso_pr_bacteria 2820946191 2820947134 258
258 3300002462 JGI24702J35022_10002590 JGI24702J35022_100025903 259
259 3300042609 Ga0466722_103833 Ga0466722_103833_976_1755 259
260 3300042636 Ga0466703_389982 Ga0466703_389982_47_826 259
261 3300042595 Ga0466695_152303 Ga0466695_152303_9257_10039 260
262 3300042659 Ga0466733_188245 Ga0466733_188245_2474_3256 260
263 3300010167 Ga0123353_10482084 Ga0123353_104820842 261
264 3300042599 Ga0466706_221149 Ga0466706_221149_1289_2074 261
265 3300042625 Ga0466730_099794 Ga0466730_099794_927_1712 261
266 3300042648 Ga0466709_381563 Ga0466709_381563_357_1142 261
267 3300042609 Ga0466722_042812 Ga0466722_042812_61186_61974 262
268 3300042593 Ga0466691_109620 Ga0466691_109620_13419_14210 263
269 3300042606 Ga0466719_260891 Ga0466719_260891_4442_5233 263
270 3300042625 Ga0466730_042109 Ga0466730_042109_11_802 263
271 3300042643 Ga0466704_541739 Ga0466704_541739_744_1535 263
272 3300042606 Ga0466719_035707 Ga0466719_035707_170_964 264
273 3300042609 Ga0466722_216227 Ga0466722_216227_25572_26366 264
274 3300042652 Ga0466708_125096 Ga0466708_125096_1418_2215 265
275 3300042623 Ga0466734_164259 Ga0466734_164259_141_941 266
276 3300042597 Ga0466699_362178 Ga0466699_362178_108_911 267
277 3300007506 Ga0105006_1022682 Ga0105006_10226825 268
278 3300005201 Ga0072941_1257876 Ga0072941_12578762 269
279 3300042605 Ga0466716_281830 Ga0466716_281830_2130_2945 271
280 3300042614 Ga0466712_050713 Ga0466712_050713_339_1154 271
281 3300042619 Ga0466726_208565 Ga0466726_208565_192_1007 271
282 3300002449 JGI24698J34947_10005397 JGI24698J34947_100053976 272
283 3300042591 Ga0466692_043458 Ga0466692_043458_648_1466 272
284 3300042616 Ga0466715_035287 Ga0466715_035287_19820_20641 273
285 3300042615 Ga0466711_314979 Ga0466711_314979_1535_2386 283
286 3300042636 Ga0466703_275691 Ga0466703_275691_360_1211 283
287 3300042655 Ga0466727_201130 Ga0466727_201130_1195_2049 284

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 32 218 0.98
PF08659 KR KR domain 34 196 0.9
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 37 227 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.