Protein Family IF10142

Metagenome Isolate
159 Members
38 Samples
156 Scaffolds
338.47 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_114282|Ga0466727_114282_709_1848
Length
379 aa
Sequence
LTDERPGGTDISGFSDTRLEHIQKLLRDNTIPKLEGDLADDPLLNEIHDELKAIREVLFSFSAGDFSPAIKVRGIIPGCLKALQAHLRHLIWQVQMIEKGDFTQEVRFMGEFSSAFNSMVHQLNKTLSELKQKEETLLDLTNTLRNEVDRRNSAVEALQESEARFKYLASHDALTGAFSRRSFIEMAGVELENAMKSGIHCCMAIMDIDHFKLFNDTYGHVAGDEALRHVVRVVQDGLRKGDFLGRYGGEEFTIFFYGSDEQTGMAIAERLRSALASSPVKLETQNVTVTASFGITKAEMDPKEDGFIQVLVNNADIALYGAKHAGRNKVMLYTPGMDDFSEGSRYSAFENEKTPVAEVADRGSPEAPAGEELQKEGAL

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.5%
Kalotermitidae 37.8%
Unclassified 8.1%
Termopsidae 5.4%
Rhinotermitidae 5.4%
Blaberidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
9 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
10 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
11 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
12 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
13 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
14 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 2772190975 Treponema sp. RmG30 Isolate Blaberidae
27 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
28 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466696_266622 3300042596 Bacteria 28910
2 Ga0466699_037849 3300042597 Bacteria 7193
3 Ga0466704_294164 3300042643 Bacteria 18628
4 Ga0466709_058723 3300042648 Bacteria 26398
5 Ga0466709_142334 3300042648 Bacteria 9021
6 Ga0466708_324321 3300042652 Bacteria 2056
7 Ga0466719_539676 3300042606 Bacteria 1959
8 Ga0466721_232526 3300042608 Bacteria 21831
9 Ga0466722_081445 3300042609 Bacteria 2036
10 Ga0466711_433809 3300042615 Bacteria 2358
11 Ga0466711_441473 3300042615 Bacteria 41991
12 Ga0466711_489650 3300042615 Bacteria 2018
13 Ga0466715_046174 3300042616 Bacteria 30258
14 Ga0466715_455355 3300042616 Bacteria 3027
15 Ga0466718_158887 3300042617 Bacteria 2369
16 Ga0466723_062733 3300042618 Bacteria 35703
17 Ga0466723_095314 3300042618 Bacteria 1430
18 Ga0466723_184754 3300042618 Bacteria 4752
19 Ga0466726_363329 3300042619 Bacteria 2709
20 Ga0074263_110429 3300005485 Bacteria 4009
21 Ga0264413_106913 3300024493 Bacteria 3423
22 Ga0466699_230906 3300042597 Bacteria 2733
23 Ga0466699_440015 3300042597 Bacteria 32912
24 Ga0466699_443765 3300042597 Bacteria 1472
25 Ga0466705_378088 3300042612 Bacteria 2386
26 Ga0466703_061569 3300042636 Bacteria 36093
27 Ga0466703_293836 3300042636 Bacteria 4405
28 Ga0466704_425636 3300042643 Bacteria 27682
29 Ga0466709_229356 3300042648 Bacteria 10871
30 Ga0466708_270691 3300042652 Bacteria 1843
31 Ga0466727_108990 3300042655 Bacteria 4884
32 Ga0466727_192667 3300042655 Bacteria 2997
33 Ga0466717_108553 3300042604 Bacteria 1657
34 Ga0466719_118850 3300042606 Bacteria 22662
35 Ga0466719_337352 3300042606 Bacteria 57418
36 Ga0466722_063145 3300042609 Bacteria 10199
37 Ga0466711_138756 3300042615 Bacteria 5744
38 Ga0466715_101550 3300042616 Bacteria 22388
39 Ga0466715_262591 3300042616 Bacteria 13449
40 Ga0123356_10002624 3300010049 Bacteria 19133
41 Ga0466690_000805 3300042590 Bacteria 10725
42 Ga0466692_001629 3300042591 Bacteria 6740
43 Ga0466691_098179 3300042593 Bacteria 2407
44 Ga0466699_124294 3300042597 Bacteria 9843
45 Ga0466705_157947 3300042612 Bacteria 11546
46 Ga0466703_385211 3300042636 Bacteria 14194
47 Ga0466709_292802 3300042648 Bacteria 6041
48 Ga0466709_294203 3300042648 Bacteria 4723
49 Ga0466713_086108 3300042602 Bacteria 4367
50 Ga0466717_100560 3300042604 Bacteria 1594
51 Ga0466719_352877 3300042606 Bacteria 2580
52 Ga0466719_403421 3300042606 Bacteria 2677
53 Ga0466719_404013 3300042606 Bacteria 1708
54 Ga0466719_433578 3300042606 Bacteria 2363
55 Ga0466722_045927 3300042609 Bacteria 4273
56 Ga0466715_300901 3300042616 Bacteria 11889
57 Ga0466715_337072 3300042616 Bacteria 7297
58 Ga0466715_417230 3300042616 Bacteria 2914
59 Ga0466723_046033 3300042618 Bacteria 1534
60 Ga0466723_365662 3300042618 Bacteria 3570
61 Ga0466726_040348 3300042619 Bacteria 2747
62 Ga0123353_10342206 3300010167 Bacteria 2258
63 Ga0123353_10593496 3300010167 Bacteria 1585
64 Ga0466732_249100 3300042656 Bacteria 4755
65 Ga0264413_116706 3300024493 Bacteria 3757
66 Ga0466690_264197 3300042590 Bacteria 5270
67 Ga0466705_143282 3300042612 Bacteria 12501
68 Ga0466705_183004 3300042612 Bacteria 8660
69 Ga0466702_263846 3300042635 Bacteria 1261
70 Ga0466703_354742 3300042636 Bacteria 2477
71 Ga0466708_441406 3300042652 Bacteria 3338
72 Ga0466727_114282 3300042655 Bacteria 2429
73 Ga0466716_095913 3300042605 Bacteria 14967
74 Ga0466719_375318 3300042606 Bacteria 15596
75 Ga0466719_533396 3300042606 Bacteria 3814
76 Ga0466722_177742 3300042609 Bacteria 3848
77 Ga0466711_001692 3300042615 Bacteria 7510
78 Ga0466711_109643 3300042615 Bacteria 13469
79 Ga0466711_187823 3300042615 Bacteria 1806
80 Ga0466715_003331 3300042616 Bacteria 4259
81 Ga0466715_205003 3300042616 Bacteria 9057
82 Ga0466723_009818 3300042618 Bacteria 36345
83 Ga0466723_305681 3300042618 Bacteria 8089
84 Ga0466726_130749 3300042619 Bacteria 7613
85 JGI24702J35022_10017331 3300002462 Bacteria 3937
86 JGI24705J35276_12085623 3300002504 Bacteria 983
87 Ga0466732_346652 3300042656 Bacteria 2747
88 Ga0466696_335071 3300042596 Bacteria 17726
89 Ga0466705_056610 3300042612 Bacteria 3172
90 Ga0466704_126660 3300042643 Bacteria 17306
91 Ga0466704_288691 3300042643 Bacteria 25350
92 Ga0466708_035070 3300042652 Bacteria 8052
93 Ga0466708_366320 3300042652 Bacteria 2351
94 Ga0466716_493126 3300042605 Bacteria 2343
95 Ga0466698_033797 3300042610 Bacteria 2734
96 Ga0466711_165567 3300042615 Bacteria 4521
97 Ga0466715_029825 3300042616 Bacteria 5429
98 Ga0466715_393712 3300042616 Bacteria 7147
99 Ga0466715_406418 3300042616 Bacteria 7867
100 AustNasuHG_c1002019 3300000089 Bacteria 7305
101 JGI24696J40584_12957801 3300002834 Bacteria 3697
102 Ga0466691_137157 3300042593 Bacteria 1995
103 Ga0466699_097711 3300042597 Bacteria 3369
104 Ga0466705_044269 3300042612 Bacteria 14021
105 Ga0466704_145701 3300042643 Bacteria 9362
106 Ga0466709_207212 3300042648 Bacteria 1443
107 Ga0466709_409818 3300042648 Bacteria 2053
108 Ga0466700_007758 3300042600 Bacteria 4731
109 Ga0466719_151374 3300042606 Bacteria 12357
110 Ga0466722_009440 3300042609 Bacteria 5887
111 Ga0466728_136752 3300042620 Bacteria 8927
112 Ga0466728_191965 3300042620 Bacteria 2737
113 AustNasuHG_c1000531 3300000089 Bacteria 13377
114 AustNasuHG_c1007348 3300000089 Bacteria 3925
115 Ga0264413_126263 3300024493 Bacteria 3059
116 Ga0466691_048051 3300042593 Bacteria 6042
117 Ga0466691_059090 3300042593 Bacteria 3639
118 Ga0466691_106083 3300042593 Bacteria 2478
119 Ga0466696_025719 3300042596 Bacteria 1397
120 Ga0466699_130177 3300042597 Bacteria 1894
121 Ga0466699_152253 3300042597 Bacteria 3355
122 Ga0466702_269016 3300042635 Bacteria 3119
123 Ga0466703_177369 3300042636 Bacteria 10116
124 Ga0466708_041129 3300042652 Bacteria 7339
125 Ga0466708_146878 3300042652 Bacteria 4364
126 Ga0466708_248204 3300042652 Bacteria 39410
127 Ga0466727_160182 3300042655 Bacteria 2413
128 Ga0466717_201630 3300042604 Bacteria 1963
129 Ga0466716_346497 3300042605 Bacteria 2899
130 Ga0466716_361851 3300042605 Bacteria 3222
131 Ga0466722_215244 3300042609 Bacteria 8638
132 Ga0466711_050599 3300042615 Bacteria 2200
133 Ga0466715_078285 3300042616 Bacteria 2435
134 Ga0466692_124833 3300042591 Bacteria 6424
135 Ga0466691_150593 3300042593 Bacteria 8027
136 Ga0466696_335936 3300042596 Bacteria 3820
137 Ga0466699_087510 3300042597 Bacteria 3084
138 Ga0466699_145786 3300042597 Bacteria 5225
139 Ga0466699_162096 3300042597 Bacteria 4814
140 Ga0466699_177781 3300042597 Bacteria 3539
141 Ga0466699_370677 3300042597 Bacteria 6829
142 Ga0466702_230368 3300042635 Bacteria 2101
143 Ga0466703_016956 3300042636 Bacteria 4210
144 Ga0466703_071234 3300042636 Bacteria 32935
145 Ga0466709_238050 3300042648 Bacteria 17478
146 Ga0466708_072583 3300042652 Bacteria 12329
147 Ga0466708_144615 3300042652 Bacteria 2736
148 Ga0466708_345314 3300042652 Bacteria 12077
149 Ga0466727_151780 3300042655 Bacteria 2584
150 Ga0466719_336848 3300042606 Bacteria 2335
151 Ga0466711_497683 3300042615 Bacteria 21552
152 Ga0466715_503422 3300042616 Bacteria 2016
153 Ga0466718_114256 3300042617 Bacteria 20301
154 Ga0466718_169046 3300042617 Bacteria 8509
155 Ga0466723_016478 3300042618 Bacteria 8392
156 Ga0466723_086681 3300042618 Bacteria 9988

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10342206 Ga0123353_103422062 267
2 3300002462 JGI24702J35022_10017331 JGI24702J35022_100173311 277
3 3300042597 Ga0466699_037849 Ga0466699_037849_5951_6946 293
4 3300042597 Ga0466699_130177 Ga0466699_130177_535_1542 296
5 3300042597 Ga0466699_124294 Ga0466699_124294_6770_7771 302
6 3300042616 Ga0466715_300901 Ga0466715_300901_7499_8497 304
7 3300002504 JGI24705J35276_12085623 JGI24705J35276_120856231 306
8 3300042618 Ga0466723_009818 Ga0466723_009818_5137_6177 306
9 3300042635 Ga0466702_269016 Ga0466702_269016_408_1328 306
10 3300005485 Ga0074263_110429 Ga0074263_1104293 308
11 3300042597 Ga0466699_087510 Ga0466699_087510_1173_2102 309
12 3300042597 Ga0466699_152253 Ga0466699_152253_1171_2100 309
13 3300042600 Ga0466700_007758 Ga0466700_007758_1987_2934 309
14 3300042608 Ga0466721_232526 Ga0466721_232526_487_1416 309
15 3300042635 Ga0466702_230368 Ga0466702_230368_775_1704 309
16 3300010049 Ga0123356_10002624 Ga0123356_100026244 311
17 3300042597 Ga0466699_443765 Ga0466699_443765_472_1455 311
18 3300010167 Ga0123353_10593496 Ga0123353_105934962 313
19 3300042635 Ga0466702_263846 Ga0466702_263846_282_1223 313
20 3300042605 Ga0466716_493126 Ga0466716_493126_433_1425 316
21 3300002834 JGI24696J40584_12957801 JGI24696J40584_129578014 319
22 3300042618 Ga0466723_095314 Ga0466723_095314_262_1278 321
23 3300042655 Ga0466727_160182 Ga0466727_160182_612_1595 321
24 3300042615 Ga0466711_433809 Ga0466711_433809_249_1256 322
25 3300000089 AustNasuHG_c1002019 AustNasuHG_10020196 323
26 3300000089 AustNasuHG_c1007348 AustNasuHG_10073483 323
27 3300042615 Ga0466711_138756 Ga0466711_138756_254_1330 323
28 3300042616 Ga0466715_455355 Ga0466715_455355_290_1267 325
29 3300042618 Ga0466723_046033 Ga0466723_046033_409_1386 325
30 3300042652 Ga0466708_144615 Ga0466708_144615_1194_2249 325
31 3300042596 Ga0466696_335936 Ga0466696_335936_1422_2480 327
32 3300042596 Ga0466696_025719 Ga0466696_025719_381_1367 328
33 3300042648 Ga0466709_142334 Ga0466709_142334_5090_6076 328
34 3300024493 Ga0264413_126263 Ga0264413_1262632 329
35 3300042597 Ga0466699_370677 Ga0466699_370677_236_1225 329
36 3300042617 Ga0466718_169046 Ga0466718_169046_5009_5998 329
37 3300042593 Ga0466691_098179 Ga0466691_098179_984_1979 331
38 3300042597 Ga0466699_097711 Ga0466699_097711_337_1332 331
39 3300042597 Ga0466699_145786 Ga0466699_145786_2394_3389 331
40 3300042597 Ga0466699_162096 Ga0466699_162096_1778_2773 331
41 3300042597 Ga0466699_177781 Ga0466699_177781_1479_2474 331
42 3300042597 Ga0466699_230906 Ga0466699_230906_911_1906 331
43 3300042605 Ga0466716_095913 Ga0466716_095913_6661_7656 331
44 3300042606 Ga0466719_404013 Ga0466719_404013_327_1322 331
45 3300042606 Ga0466719_433578 Ga0466719_433578_624_1619 331
46 3300042616 Ga0466715_101550 Ga0466715_101550_15177_16172 331
47 3300042636 Ga0466703_061569 Ga0466703_061569_33299_34294 331
48 3300042648 Ga0466709_207212 Ga0466709_207212_368_1363 331
49 3300042652 Ga0466708_270691 Ga0466708_270691_90_1085 331
50 3300042606 Ga0466719_375318 Ga0466719_375318_2595_3593 332
51 3300042606 Ga0466719_403421 Ga0466719_403421_403_1401 332
52 3300042616 Ga0466715_406418 Ga0466715_406418_4918_5916 332
53 3300042617 Ga0466718_114256 Ga0466718_114256_5787_6785 332
54 3300042655 Ga0466727_108990 Ga0466727_108990_2307_3305 332
55 3300042590 Ga0466690_000805 Ga0466690_000805_9420_10421 333
56 3300042593 Ga0466691_150593 Ga0466691_150593_1565_2566 333
57 3300042605 Ga0466716_361851 Ga0466716_361851_1771_2772 333
58 3300042606 Ga0466719_151374 Ga0466719_151374_5117_6118 333
59 3300042618 Ga0466723_305681 Ga0466723_305681_2689_3690 333
60 3300042636 Ga0466703_177369 Ga0466703_177369_1888_2889 333
61 3300042648 Ga0466709_238050 Ga0466709_238050_4744_5745 333
62 3300042652 Ga0466708_072583 Ga0466708_072583_6354_7355 333
63 3300042652 Ga0466708_366320 Ga0466708_366320_339_1340 333
64 3300042605 Ga0466716_346497 Ga0466716_346497_1320_2324 334
65 3300042620 Ga0466728_191965 Ga0466728_191965_827_1879 334
66 3300042652 Ga0466708_035070 Ga0466708_035070_886_1890 334
67 iso_pr_bacteria 2772190975 2773723984 334
68 3300042604 Ga0466717_201630 Ga0466717_201630_580_1587 335
69 3300042609 Ga0466722_177742 Ga0466722_177742_1375_2382 335
70 iso_pr_bacteria 650716099 650880012 335
71 3300042652 Ga0466708_324321 Ga0466708_324321_338_1348 336
72 3300042593 Ga0466691_048051 Ga0466691_048051_1883_2926 337
73 3300042606 Ga0466719_118850 Ga0466719_118850_8135_9148 337
74 3300042616 Ga0466715_029825 Ga0466715_029825_1003_2112 337
75 3300042636 Ga0466703_385211 Ga0466703_385211_11587_12600 337
76 3300024493 Ga0264413_116706 Ga0264413_1167062 338
77 3300042615 Ga0466711_165567 Ga0466711_165567_235_1251 338
78 3300042612 Ga0466705_044269 Ga0466705_044269_6096_7115 339
79 3300042618 Ga0466723_016478 Ga0466723_016478_4704_5750 339
80 3300042636 Ga0466703_293836 Ga0466703_293836_908_1927 339
81 3300042655 Ga0466727_151780 Ga0466727_151780_1204_2292 339
82 3300042606 Ga0466719_336848 Ga0466719_336848_1186_2232 340
83 3300042617 Ga0466718_158887 Ga0466718_158887_403_1425 340
84 3300042652 Ga0466708_345314 Ga0466708_345314_10171_11253 340
85 3300042655 Ga0466727_192667 Ga0466727_192667_1578_2600 340
86 3300042597 Ga0466699_440015 Ga0466699_440015_22190_23215 341
87 3300042609 Ga0466722_045927 Ga0466722_045927_712_1737 341
88 3300042616 Ga0466715_417230 Ga0466715_417230_277_1329 341
89 3300042606 Ga0466719_337352 Ga0466719_337352_38393_39421 342
90 3300042619 Ga0466726_130749 Ga0466726_130749_3362_4390 342
91 3300042656 Ga0466732_249100 Ga0466732_249100_3604_4632 342
92 3300042615 Ga0466711_441473 Ga0466711_441473_6639_7670 343
93 3300042619 Ga0466726_363329 Ga0466726_363329_1205_2236 343
94 3300042636 Ga0466703_071234 Ga0466703_071234_21861_22892 343
95 3300042609 Ga0466722_215244 Ga0466722_215244_705_1739 344
96 3300042612 Ga0466705_056610 Ga0466705_056610_845_1879 344
97 3300042615 Ga0466711_050599 Ga0466711_050599_904_1938 344
98 3300042616 Ga0466715_078285 Ga0466715_078285_613_1647 344
99 3300042606 Ga0466719_539676 Ga0466719_539676_780_1817 345
100 3300042610 Ga0466698_033797 Ga0466698_033797_1635_2672 345
101 3300042643 Ga0466704_425636 Ga0466704_425636_19385_20422 345
102 3300042612 Ga0466705_378088 Ga0466705_378088_856_1896 346
103 3300042615 Ga0466711_109643 Ga0466711_109643_9007_10047 346
104 3300042618 Ga0466723_062733 Ga0466723_062733_5290_6330 346
105 3300042636 Ga0466703_354742 Ga0466703_354742_326_1366 346
106 3300042648 Ga0466709_058723 Ga0466709_058723_13175_14215 346
107 3300042652 Ga0466708_248204 Ga0466708_248204_27970_29010 346
108 3300042604 Ga0466717_108553 Ga0466717_108553_589_1632 347
109 3300042656 Ga0466732_346652 Ga0466732_346652_1565_2608 347
110 iso_pr_bacteria 2781125630 2781266388 347
111 3300000089 AustNasuHG_c1000531 AustNasuHG_10005318 348
112 3300042609 Ga0466722_009440 Ga0466722_009440_3916_4962 348
113 3300042615 Ga0466711_489650 Ga0466711_489650_153_1199 348
114 3300042616 Ga0466715_046174 Ga0466715_046174_16399_17448 349
115 3300042648 Ga0466709_292802 Ga0466709_292802_968_2047 349
116 3300042609 Ga0466722_063145 Ga0466722_063145_4422_5474 350
117 3300042609 Ga0466722_081445 Ga0466722_081445_122_1174 350
118 3300042636 Ga0466703_016956 Ga0466703_016956_305_1387 350
119 3300024493 Ga0264413_106913 Ga0264413_1069133 351
120 3300042596 Ga0466696_266622 Ga0466696_266622_2813_3868 351
121 3300042615 Ga0466711_001692 Ga0466711_001692_492_1547 351
122 3300042612 Ga0466705_183004 Ga0466705_183004_1134_2216 352
123 3300042616 Ga0466715_393712 Ga0466715_393712_2443_3501 352
124 3300042620 Ga0466728_136752 Ga0466728_136752_1277_2359 352
125 3300042643 Ga0466704_145701 Ga0466704_145701_1713_2774 353
126 3300042652 Ga0466708_441406 Ga0466708_441406_668_1732 354
127 3300042615 Ga0466711_497683 Ga0466711_497683_19033_20133 355
128 3300042652 Ga0466708_041129 Ga0466708_041129_1216_2286 356
129 3300042616 Ga0466715_503422 Ga0466715_503422_117_1190 357
130 3300042643 Ga0466704_126660 Ga0466704_126660_15695_16768 357
131 3300042593 Ga0466691_137157 Ga0466691_137157_51_1127 358
132 3300042606 Ga0466719_352877 Ga0466719_352877_443_1519 358
133 3300042619 Ga0466726_040348 Ga0466726_040348_1465_2541 358
134 3300042652 Ga0466708_146878 Ga0466708_146878_3198_4274 358
135 3300042618 Ga0466723_086681 Ga0466723_086681_4160_5239 359
136 3300042643 Ga0466704_288691 Ga0466704_288691_7316_8467 359
137 3300042606 Ga0466719_533396 Ga0466719_533396_375_1457 360
138 3300042616 Ga0466715_337072 Ga0466715_337072_964_2046 360
139 3300042602 Ga0466713_086108 Ga0466713_086108_569_1654 361
140 3300042615 Ga0466711_187823 Ga0466711_187823_661_1746 361
141 3300042648 Ga0466709_294203 Ga0466709_294203_2884_3969 361
142 3300042612 Ga0466705_143282 Ga0466705_143282_2062_3150 362
143 3300042616 Ga0466715_205003 Ga0466715_205003_2590_3678 362
144 3300042616 Ga0466715_262591 Ga0466715_262591_11344_12432 362
145 3300042643 Ga0466704_294164 Ga0466704_294164_3887_4975 362
146 3300042593 Ga0466691_106083 Ga0466691_106083_1044_2135 363
147 3300042596 Ga0466696_335071 Ga0466696_335071_9148_10239 363
148 3300042616 Ga0466715_003331 Ga0466715_003331_2131_3300 363
149 3300042593 Ga0466691_059090 Ga0466691_059090_1436_2530 364
150 3300042618 Ga0466723_184754 Ga0466723_184754_2118_3212 364
151 3300042618 Ga0466723_365662 Ga0466723_365662_617_1711 364
152 3300042590 Ga0466690_264197 Ga0466690_264197_2526_3623 365
153 3300042591 Ga0466692_001629 Ga0466692_001629_5120_6217 365
154 3300042612 Ga0466705_157947 Ga0466705_157947_6395_7492 365
155 3300042648 Ga0466709_409818 Ga0466709_409818_579_1679 366
156 3300042591 Ga0466692_124833 Ga0466692_124833_1313_2416 367
157 3300042604 Ga0466717_100560 Ga0466717_100560_384_1487 367
158 3300042648 Ga0466709_229356 Ga0466709_229356_5242_6390 373
159 3300042655 Ga0466727_114282 Ga0466727_114282_709_1848 379

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00990 GGDEF Diguanylate cyclase, GGDEF domain 169 329 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.