Protein Family IF10136

Metagenome Isolate
152 Members
63 Samples
142 Scaffolds
342.11 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_088699|Ga0466727_088699_2183_3301
Length
372 aa
Sequence
MKVLVTGAAGFIGFHTAKALAGFSEKDCEVIGMDNINAYYDVNLKLGRLLASGIDPEKVDFNKKVKSTLFDNYSFIKMDLCQKEDLQKFFEEEQFDSVIHLAAQAGVRYSLENPTAYADSNFLGFLNILEACRGGRIRHLVFASSSSVYGLNEKAPFAESDPADHPVSLYAASKKANELMAHSYACLFGLPVTGLRFFTVYGPWGRPDMAPFLFTKAVLKGDVIKVFNYGRMQRDFTYVDDVVDGVIKVLKKPPESQAQWDGKSWDPSVSSAPFKIYNIGGGRPVELLEFIKTIEKKLGLEARRELLPLQPGDVPFTWADTSRIERDFDWRPRTDLKTGLSEFIDWYTAFYAPLEDSEGLEAQSTEAVKTWI

📊 Sample Types

Isolate 6.6%
Metagenome 93.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.5%
Kalotermitidae 22.6%
Unclassified 17.7%
Termopsidae 6.5%
Passalidae 3.2%
Formicidae 3.2%
Rhinotermitidae 3.2%
Apidae 3.2%
Kiwaidae 1.6%
Muscidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
3 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
4 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
14 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 2785510743 Apibacter sp. ESL0404 Isolate Apidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
28 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
43 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
44 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
50 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
54 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
55 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
56 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
57 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
58 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
59 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
60 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
61 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
62 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
63 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_196131 3300042612 Bacteria 1916
2 Ga0466690_252648 3300042590 Bacteria 1792
3 Ga0466708_367275 3300042652 Bacteria 15661
4 Ga0466719_218678 3300042606 Bacteria 2975
5 Ga0466719_231538 3300042606 Bacteria 35850
6 Ga0466722_068756 3300042609 Bacteria 27473
7 Ga0466722_121474 3300042609 Bacteria 4851
8 Ga0466705_425873 3300042612 Bacteria 39314
9 Ga0466710_081963 3300042613 Bacteria 1239
10 Ga0466711_446106 3300042615 Bacteria 17745
11 Ga0466711_516720 3300042615 Bacteria 2330
12 Ga0466715_028816 3300042616 Bacteria 22566
13 Ga0466728_388189 3300042620 Bacteria 5809
14 JGI24705J35276_12236745 3300002504 Bacteria 8818
15 Ga0074278_125296 3300005721 Bacteria 23808
16 Ga0415639_063668 3300038395 Unclassified 4774
17 Ga0466693_307765 3300042592 Bacteria 1333
18 Ga0466709_371268 3300042648 Bacteria 3713
19 Ga0466727_318784 3300042655 Bacteria 5945
20 Ga0466707_251173 3300042601 Bacteria 2335
21 Ga0466721_046468 3300042608 Bacteria 1929
22 Ga0466718_145546 3300042617 Bacteria 12566
23 Ga0123356_10000833 3300010049 Bacteria 34368
24 Ga0123353_10501456 3300010167 Unclassified 1768
25 JGI24698J34947_10013530 3300002449 Bacteria 4453
26 JGI24699J35502_11133967 3300002509 Bacteria 21911
27 Ga0068302_10258098 3300005071 Unclassified 2643
28 Ga0068305_10184543 3300005083 Bacteria 4382
29 Ga0072941_1009359 3300005201 Bacteria 34397
30 Ga0255572_1000005 3300026175 Bacteria 243479
31 Ga0466694_078220 3300042594 Bacteria 10198
32 Ga0466696_206335 3300042596 Bacteria 1776
33 Ga0466735_173441 3300042624 Bacteria 1411
34 Ga0466717_184596 3300042604 Unclassified 2873
35 Ga0466719_400088 3300042606 Bacteria 3069
36 Ga0466715_409189 3300042616 Bacteria 1680
37 Ga0466715_459409 3300042616 Bacteria 15814
38 Ga0466723_051289 3300042618 Bacteria 1056
39 Ga0466723_176670 3300042618 Bacteria 6692
40 Ga0466723_303454 3300042618 Bacteria 32258
41 Ga0466726_053834 3300042619 Bacteria 8619
42 IMNBGM34_c000129 3300000036 Bacteria 21840
43 AustNasuHG_c1034504 3300000089 Unclassified 1353
44 JGI24698J34947_10111407 3300002449 Bacteria 1207
45 JGI24699J35502_11033756 3300002509 Bacteria 1527
46 Ga0072941_1069272 3300005201 Bacteria 4594
47 Ga0466705_383304 3300042612 Bacteria 2764
48 Ga0157631_102589 3300013007 Bacteria 2932
49 Ga0466690_249857 3300042590 Bacteria 4997
50 Ga0466690_433862 3300042590 Bacteria 2590
51 Ga0466696_350030 3300042596 Bacteria 7403
52 Ga0466703_350329 3300042636 Bacteria 2961
53 Ga0466704_327262 3300042643 Bacteria 9813
54 Ga0466704_394120 3300042643 Bacteria 1509
55 Ga0466708_007812 3300042652 Bacteria 5701
56 Ga0466727_088699 3300042655 Bacteria 5503
57 Ga0466706_281835 3300042599 Bacteria 1545
58 Ga0466711_124600 3300042615 Bacteria 33924
59 Ga0466715_003157 3300042616 Bacteria 16477
60 Ga0466718_011774 3300042617 Bacteria 7547
61 Ga0123357_10177822 3300009784 Bacteria 2496
62 JGI24695J34938_10000104 3300002450 Bacteria 74204
63 Ga0466705_022584 3300042612 Bacteria 11422
64 Ga0466691_016610 3300042593 Bacteria 1648
65 Ga0466694_123440 3300042594 Bacteria 50310
66 Ga0466709_161177 3300042648 Bacteria 17803
67 Ga0466709_175443 3300042648 Bacteria 7310
68 Ga0466708_363688 3300042652 Bacteria 7281
69 Ga0466706_195572 3300042599 Bacteria 16070
70 Ga0466713_130099 3300042602 Bacteria 42965
71 Ga0466716_433928 3300042605 Bacteria 1384
72 Ga0466719_192540 3300042606 Bacteria 2707
73 Ga0466722_045953 3300042609 Bacteria 33741
74 Ga0466712_131789 3300042614 Bacteria 31060
75 Ga0466715_110372 3300042616 Bacteria 2905
76 Ga0466715_235758 3300042616 Bacteria 7960
77 Ga0466723_129762 3300042618 Bacteria 6447
78 Ga0466723_187876 3300042618 Bacteria 4771
79 Ga0466728_395804 3300042620 Bacteria 8688
80 Ga0123355_10000161 3300009826 Bacteria 81946
81 Ga0123355_10288920 3300009826 Bacteria 2253
82 Ga0123356_10009277 3300010049 Unclassified 9722
83 Ga0123353_10050643 3300010167 Bacteria 6624
84 Ga0123353_10287768 3300010167 Bacteria 2518
85 Ga0123353_10625004 3300010167 Bacteria 1532
86 AustNasuHG_c1011425 3300000089 Bacteria 3078
87 Ga0072941_1060464 3300005201 Bacteria 1937
88 Ga0103261_1000032 3300007083 Bacteria 52061
89 Ga0123357_10000139 3300009784 Bacteria 63911
90 Ga0466705_188622 3300042612 Bacteria 11435
91 Ga0466657_326545 3300042582 Bacteria 1224
92 Ga0466696_165769 3300042596 Bacteria 4551
93 Ga0466696_196970 3300042596 Bacteria 17534
94 Ga0466709_101800 3300042648 Bacteria 5548
95 Ga0466709_196442 3300042648 Bacteria 8897
96 Ga0466727_046756 3300042655 Bacteria 1901
97 Ga0466707_017377 3300042601 Bacteria 3845
98 Ga0466714_058174 3300042603 Bacteria 1072
99 Ga0466716_025845 3300042605 Bacteria 7845
100 Ga0466716_218815 3300042605 Bacteria 1459
101 Ga0466722_139610 3300042609 Bacteria 7075
102 Ga0466711_422109 3300042615 Bacteria 5423
103 Ga0466718_059344 3300042617 Bacteria 21726
104 Ga0466718_089049 3300042617 Bacteria 13689
105 2227177210 2225789004 Bacteria 1504
106 JGI24698J34947_10007820 3300002449 Bacteria 5873
107 Ga0068305_10003714 3300005083 Bacteria 240854
108 Ga0466705_246027 3300042612 Bacteria 50897
109 Ga0466692_080511 3300042591 Bacteria 13597
110 Ga0466703_060786 3300042636 Bacteria 15061
111 Ga0466703_320400 3300042636 Bacteria 47272
112 Ga0466703_427045 3300042636 Bacteria 11638
113 Ga0466704_181838 3300042643 Bacteria 6174
114 Ga0466708_105643 3300042652 Bacteria 28198
115 Ga0466708_220177 3300042652 Bacteria 9390
116 Ga0466706_154939 3300042599 Bacteria 5015
117 Ga0466714_034775 3300042603 Bacteria 7480
118 Ga0466716_075703 3300042605 Bacteria 4928
119 Ga0466716_495570 3300042605 Bacteria 4837
120 Ga0466716_500725 3300042605 Bacteria 24017
121 Ga0466722_156519 3300042609 Bacteria 6897
122 Ga0466698_042183 3300042610 Bacteria 1922
123 Ga0466712_113634 3300042614 Bacteria 19500
124 Ga0466712_114188 3300042614 Bacteria 5747
125 Ga0466718_062871 3300042617 Bacteria 6066
126 Ga0466723_101284 3300042618 Bacteria 48253
127 Ga0466726_494182 3300042619 Bacteria 17264
128 Ga0072940_1020901 3300005200 Bacteria 18403
129 Ga0466705_159906 3300042612 Archaea 12410
130 Ga0466735_036957 3300042624 Bacteria 5983
131 Ga0466709_260482 3300042648 Bacteria 11945
132 Ga0466727_213664 3300042655 Bacteria 5876
133 Ga0466727_278278 3300042655 Bacteria 12440
134 Ga0466707_079700 3300042601 Bacteria 5544
135 Ga0466716_529165 3300042605 Bacteria 3160
136 Ga0466711_164860 3300042615 Bacteria 2222
137 Ga0466715_430485 3300042616 Bacteria 2621
138 Ga0466726_490648 3300042619 Bacteria 40552
139 Ga0466728_401063 3300042620 Bacteria 1518
140 Ga0123354_10048162 3300010882 Bacteria 6485
141 JGI24698J34947_10012516 3300002449 Bacteria 4649
142 JGI24705J35276_12237236 3300002504 Bacteria 10300

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10501456 Ga0123353_105014562 303
2 3300005721 Ga0074278_125296 Ga0074278_12529610 314
3 3300042603 Ga0466714_058174 Ga0466714_058174_13_1032 316
4 3300042612 Ga0466705_196131 Ga0466705_196131_82_1095 319
5 3300042615 Ga0466711_446106 Ga0466711_446106_15168_16130 320
6 3300042618 Ga0466723_101284 Ga0466723_101284_23430_24392 320
7 3300042593 Ga0466691_016610 Ga0466691_016610_539_1504 321
8 3300026175 Ga0255572_1000005 Ga0255572_100000540 324
9 iso_pr_bacteria 2820010479 2820010829 324
10 3300042652 Ga0466708_363688 Ga0466708_363688_3565_4587 325
11 iso_pr_bacteria 8067483258 8067484820 325
12 3300042612 Ga0466705_383304 Ga0466705_383304_1511_2614 327
13 3300042643 Ga0466704_181838 Ga0466704_181838_3830_4864 327
14 3300005201 Ga0072941_1009359 Ga0072941_10093597 328
15 3300042605 Ga0466716_495570 Ga0466716_495570_2163_3149 328
16 3300042610 Ga0466698_042183 Ga0466698_042183_46_1032 328
17 3300042616 Ga0466715_409189 Ga0466715_409189_119_1111 330
18 3300000036 IMNBGM34_c000129 IMNBGM34_00012914 334
19 3300010049 Ga0123356_10000833 Ga0123356_1000083315 334
20 3300042615 Ga0466711_516720 Ga0466711_516720_1151_2155 334
21 3300042616 Ga0466715_003157 Ga0466715_003157_14420_15424 334
22 3300042618 Ga0466723_051289 Ga0466723_051289_22_1026 334
23 3300042643 Ga0466704_394120 Ga0466704_394120_103_1215 334
24 3300000089 AustNasuHG_c1034504 AustNasuHG_10345042 335
25 3300038395 Ga0415639_063668 Ga0415639_063668_3366_4391 335
26 3300042605 Ga0466716_075703 Ga0466716_075703_2363_3370 335
27 3300042605 Ga0466716_433928 Ga0466716_433928_194_1201 335
28 3300042609 Ga0466722_121474 Ga0466722_121474_3368_4375 335
29 3300042617 Ga0466718_011774 Ga0466718_011774_4301_5308 335
30 3300042617 Ga0466718_062871 Ga0466718_062871_1410_2417 335
31 3300042617 Ga0466718_089049 Ga0466718_089049_4496_5503 335
32 3300042617 Ga0466718_145546 Ga0466718_145546_8692_9699 335
33 3300000089 AustNasuHG_c1011425 AustNasuHG_10114252 336
34 3300005200 Ga0072940_1020901 Ga0072940_10209019 336
35 3300010167 Ga0123353_10050643 Ga0123353_100506438 336
36 3300010167 Ga0123353_10287768 Ga0123353_102877684 336
37 3300042599 Ga0466706_154939 Ga0466706_154939_3203_4213 336
38 3300042605 Ga0466716_500725 Ga0466716_500725_5329_6339 336
39 3300042606 Ga0466719_192540 Ga0466719_192540_1620_2630 336
40 3300042606 Ga0466719_400088 Ga0466719_400088_1582_2592 336
41 3300042612 Ga0466705_246027 Ga0466705_246027_38805_39815 336
42 3300042615 Ga0466711_422109 Ga0466711_422109_905_1915 336
43 3300042620 Ga0466728_395804 Ga0466728_395804_5639_6649 336
44 3300042636 Ga0466703_427045 Ga0466703_427045_4819_5829 336
45 3300042648 Ga0466709_175443 Ga0466709_175443_1308_2318 336
46 3300042648 Ga0466709_196442 Ga0466709_196442_3122_4132 336
47 3300042652 Ga0466708_007812 Ga0466708_007812_4367_5377 336
48 2225789004 2227177210 2227593614 337
49 3300002450 JGI24695J34938_10000104 JGI24695J34938_1000010424 337
50 3300002504 JGI24705J35276_12236745 JGI24705J35276_122367455 337
51 3300005083 Ga0068305_10184543 Ga0068305_101845431 337
52 3300042590 Ga0466690_249857 Ga0466690_249857_670_1683 337
53 3300042603 Ga0466714_034775 Ga0466714_034775_4653_5666 337
54 3300042609 Ga0466722_045953 Ga0466722_045953_32483_33496 337
55 3300042616 Ga0466715_430485 Ga0466715_430485_674_1687 337
56 3300042619 Ga0466726_053834 Ga0466726_053834_1764_2777 337
57 3300042652 Ga0466708_367275 Ga0466708_367275_13661_14674 337
58 3300009826 Ga0123355_10288920 Ga0123355_102889201 338
59 3300010167 Ga0123353_10625004 Ga0123353_106250042 338
60 3300010882 Ga0123354_10048162 Ga0123354_100481623 338
61 3300042605 Ga0466716_025845 Ga0466716_025845_505_1521 338
62 3300042609 Ga0466722_068756 Ga0466722_068756_20132_21148 338
63 3300042612 Ga0466705_425873 Ga0466705_425873_35215_36231 338
64 3300042616 Ga0466715_028816 Ga0466715_028816_1612_2628 338
65 3300042616 Ga0466715_459409 Ga0466715_459409_9541_10557 338
66 3300042619 Ga0466726_490648 Ga0466726_490648_13908_14924 338
67 iso_pr_bacteria 2681813507 2684382445 338
68 iso_pr_bacteria 2861449170 2861451324 338
69 3300002449 JGI24698J34947_10012516 JGI24698J34947_100125164 339
70 3300005071 Ga0068302_10258098 Ga0068302_102580982 339
71 3300005201 Ga0072941_1060464 Ga0072941_10604642 339
72 3300042613 Ga0466710_081963 Ga0466710_081963_138_1190 339
73 3300042616 Ga0466715_235758 Ga0466715_235758_602_1621 339
74 3300042648 Ga0466709_371268 Ga0466709_371268_2323_3342 339
75 3300002449 JGI24698J34947_10111407 JGI24698J34947_101114071 340
76 3300002504 JGI24705J35276_12237236 JGI24705J35276_122372367 340
77 3300002509 JGI24699J35502_11033756 JGI24699J35502_110337562 340
78 3300042605 Ga0466716_218815 Ga0466716_218815_208_1230 340
79 3300042618 Ga0466723_187876 Ga0466723_187876_2112_3134 340
80 3300042652 Ga0466708_220177 Ga0466708_220177_4209_5231 340
81 iso_pr_bacteria 2695420931 2698112173 340
82 3300042614 Ga0466712_114188 Ga0466712_114188_3227_4252 341
83 3300042618 Ga0466723_129762 Ga0466723_129762_1404_2429 341
84 3300042636 Ga0466703_350329 Ga0466703_350329_1034_2059 341
85 iso_pr_bacteria 2820131053 2820131275 341
86 3300002509 JGI24699J35502_11133967 JGI24699J35502_111339672 342
87 3300005201 Ga0072941_1069272 Ga0072941_10692722 342
88 3300010049 Ga0123356_10009277 Ga0123356_100092773 342
89 3300042612 Ga0466705_022584 Ga0466705_022584_1097_2125 342
90 3300042636 Ga0466703_060786 Ga0466703_060786_13594_14622 342
91 3300042596 Ga0466696_165769 Ga0466696_165769_279_1310 343
92 3300042601 Ga0466707_251173 Ga0466707_251173_1015_2046 343
93 3300042618 Ga0466723_303454 Ga0466723_303454_15715_16746 343
94 3300042648 Ga0466709_260482 Ga0466709_260482_2406_3437 343
95 3300042596 Ga0466696_350030 Ga0466696_350030_4594_5628 344
96 3300042590 Ga0466690_433862 Ga0466690_433862_988_2025 345
97 3300042606 Ga0466719_231538 Ga0466719_231538_4439_5476 345
98 3300042620 Ga0466728_388189 Ga0466728_388189_590_1627 345
99 3300042624 Ga0466735_036957 Ga0466735_036957_1163_2200 345
100 3300042594 Ga0466694_078220 Ga0466694_078220_1533_2576 347
101 3300042596 Ga0466696_196970 Ga0466696_196970_8060_9103 347
102 3300042615 Ga0466711_124600 Ga0466711_124600_2721_3764 347
103 3300042617 Ga0466718_059344 Ga0466718_059344_2854_3897 347
104 3300042636 Ga0466703_320400 Ga0466703_320400_8166_9209 347
105 3300042594 Ga0466694_123440 Ga0466694_123440_7212_8258 348
106 3300042608 Ga0466721_046468 Ga0466721_046468_489_1535 348
107 3300042655 Ga0466727_213664 Ga0466727_213664_2896_3945 349
108 3300042582 Ga0466657_326545 Ga0466657_326545_146_1198 350
109 3300042592 Ga0466693_307765 Ga0466693_307765_19_1071 350
110 3300042605 Ga0466716_529165 Ga0466716_529165_698_1750 350
111 3300042655 Ga0466727_278278 Ga0466727_278278_1584_2636 350
112 iso_pr_bacteria 2785510743 2785735173 350
113 iso_pr_bacteria 2820115951 2820116262 350
114 3300005083 Ga0068305_10003714 Ga0068305_1000371449 351
115 3300009784 Ga0123357_10000139 Ga0123357_1000013943 351
116 3300009784 Ga0123357_10177822 Ga0123357_101778222 351
117 3300042599 Ga0466706_281835 Ga0466706_281835_221_1276 351
118 3300042604 Ga0466717_184596 Ga0466717_184596_1298_2353 351
119 3300042648 Ga0466709_101800 Ga0466709_101800_4029_5084 351
120 iso_pr_bacteria 2820014844 2820015164 351
121 3300042596 Ga0466696_206335 Ga0466696_206335_132_1190 352
122 3300042601 Ga0466707_017377 Ga0466707_017377_1162_2220 352
123 3300042599 Ga0466706_195572 Ga0466706_195572_8552_9613 353
124 3300042601 Ga0466707_079700 Ga0466707_079700_3418_4479 353
125 3300042614 Ga0466712_113634 Ga0466712_113634_5357_6418 353
126 3300042614 Ga0466712_131789 Ga0466712_131789_25385_26446 353
127 3300002449 JGI24698J34947_10013530 JGI24698J34947_100135302 354
128 3300042602 Ga0466713_130099 Ga0466713_130099_2574_3638 354
129 3300042609 Ga0466722_156519 Ga0466722_156519_4054_5118 354
130 3300042612 Ga0466705_159906 Ga0466705_159906_11083_12147 354
131 3300042612 Ga0466705_188622 Ga0466705_188622_1922_2986 354
132 3300042616 Ga0466715_110372 Ga0466715_110372_1298_2362 354
133 3300042620 Ga0466728_401063 Ga0466728_401063_282_1346 354
134 3300042624 Ga0466735_173441 Ga0466735_173441_23_1087 354
135 iso_pr_bacteria 2820788205 2820788640 354
136 3300002449 JGI24698J34947_10007820 JGI24698J34947_100078202 355
137 3300009826 Ga0123355_10000161 Ga0123355_1000016121 355
138 3300042590 Ga0466690_252648 Ga0466690_252648_520_1587 355
139 3300042591 Ga0466692_080511 Ga0466692_080511_3739_4806 355
140 3300042618 Ga0466723_176670 Ga0466723_176670_3249_4316 355
141 3300042655 Ga0466727_318784 Ga0466727_318784_3192_4259 355
142 3300013007 Ga0157631_102589 Ga0157631_1025893 356
143 3300042648 Ga0466709_161177 Ga0466709_161177_3500_4570 356
144 3300042619 Ga0466726_494182 Ga0466726_494182_8231_9307 358
145 3300042643 Ga0466704_327262 Ga0466704_327262_6319_7395 358
146 3300042655 Ga0466727_046756 Ga0466727_046756_84_1160 358
147 3300042606 Ga0466719_218678 Ga0466719_218678_596_1681 361
148 3300007083 Ga0103261_1000032 Ga0103261_100003225 364
149 3300042609 Ga0466722_139610 Ga0466722_139610_895_1992 365
150 3300042615 Ga0466711_164860 Ga0466711_164860_825_1928 367
151 3300042655 Ga0466727_088699 Ga0466727_088699_2183_3301 372
152 3300042652 Ga0466708_105643 Ga0466708_105643_11062_12282 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3 257 0.91
PF04321 RmlD_sub_bind RmlD substrate binding domain 1 259 0.88
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 4 342 0.82
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 4 305 0.78
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 3 249 0.76
PF07993 NAD_binding_4 Male sterility protein 84 243 0.73

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.