Protein Family IF10124
Metagenome
Isolate
157
Members
63
Samples
146
Scaffolds
168.39
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_042000|Ga0466727_042000_7461_8030
- Length
- 189 aa
- Sequence
- MNNMVAYQVIFSLLAALMVVSAVLAVTTRKIMRAATYLLFVLVGTAGLYLLLNYHFLAAVQLSVYAGGILILFIFAILLVNPKGDPIAKTDRRKSLAGLAAALCGLAVVGVVVLKRYYLYPLNPTVMGDQELDMQLIGETLMGTQKYQYLLPFEVLSVLLLACIIGGILIARKSRVEENNFVEPTEKTT
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Kalotermitidae
23.0%
Unclassified
13.1%
Rhinotermitidae
6.6%
Termopsidae
6.6%
Blattidae
4.9%
Hydrophilidae
3.3%
Passalidae
3.3%
Hodotermitidae
1.6%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 7 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 28 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 37 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 57 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 58 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 61 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 62 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_301679 | 3300042612 | Bacteria | 30952 |
| 2 | Ga0466715_456601 | 3300042616 | Bacteria | 5089 |
| 3 | Ga0466718_126288 | 3300042617 | Bacteria | 1554 |
| 4 | Ga0466723_084166 | 3300042618 | Bacteria | 1933 |
| 5 | Ga0466723_128058 | 3300042618 | Bacteria | 4335 |
| 6 | Ga0466726_429212 | 3300042619 | Bacteria | 4521 |
| 7 | Ga0123356_10884583 | 3300010049 | Bacteria | 1064 |
| 8 | Ga0123354_10226407 | 3300010882 | Unclassified | 1969 |
| 9 | Ga0466691_068618 | 3300042593 | Bacteria | 28516 |
| 10 | Ga0068305_10043939 | 3300005083 | Bacteria | 3099 |
| 11 | Ga0072941_1113935 | 3300005201 | Bacteria | 2449 |
| 12 | Ga0466703_406289 | 3300042636 | Bacteria | 1846 |
| 13 | Ga0466709_245110 | 3300042648 | Bacteria | 22256 |
| 14 | Ga0466727_066432 | 3300042655 | Bacteria | 36886 |
| 15 | Ga0466706_276356 | 3300042599 | Bacteria | 20327 |
| 16 | Ga0466700_269271 | 3300042600 | Bacteria | 1298 |
| 17 | Ga0466707_364600 | 3300042601 | Bacteria | 8981 |
| 18 | Ga0466713_133321 | 3300042602 | Bacteria | 8944 |
| 19 | Ga0466722_131066 | 3300042609 | Bacteria | 10030 |
| 20 | Ga0466722_175146 | 3300042609 | Bacteria | 2287 |
| 21 | Ga0466705_350955 | 3300042612 | Bacteria | 6058 |
| 22 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 23 | Ga0466733_086622 | 3300042659 | Bacteria | 4394 |
| 24 | Ga0466710_193786 | 3300042613 | Bacteria | 2165 |
| 25 | Ga0466712_102177 | 3300042614 | Unclassified | 2068 |
| 26 | Ga0466711_247006 | 3300042615 | Bacteria | 9768 |
| 27 | Ga0466723_018466 | 3300042618 | Bacteria | 2341 |
| 28 | Ga0466726_064602 | 3300042619 | Bacteria | 18009 |
| 29 | Ga0466726_441649 | 3300042619 | Bacteria | 1366 |
| 30 | Ga0466692_192614 | 3300042591 | Bacteria | 3161 |
| 31 | Ga0466693_083612 | 3300042592 | Bacteria | 2679 |
| 32 | 2227591289 | 2225789004 | Bacteria | 12992 |
| 33 | IMNBL1DRAFT_c0001921 | 3300000062 | Bacteria | 15041 |
| 34 | JGI24699J35502_11133745 | 3300002509 | Bacteria | 14684 |
| 35 | Ga0466708_049839 | 3300042652 | Bacteria | 17940 |
| 36 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 37 | Ga0466701_099952 | 3300042598 | Bacteria | 1346 |
| 38 | Ga0466713_074755 | 3300042602 | Bacteria | 27009 |
| 39 | Ga0466714_117320 | 3300042603 | Bacteria | 1058 |
| 40 | Ga0466697_142368 | 3300042611 | Bacteria | 1274 |
| 41 | Ga0466705_108475 | 3300042612 | Bacteria | 3982 |
| 42 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 43 | Ga0466715_156320 | 3300042616 | Bacteria | 9972 |
| 44 | Ga0123354_10000201 | 3300010882 | Bacteria | 51540 |
| 45 | Ga0466692_102850 | 3300042591 | Bacteria | 14012 |
| 46 | Ga0466692_191366 | 3300042591 | Bacteria | 14423 |
| 47 | Ga0466691_113343 | 3300042593 | Bacteria | 3967 |
| 48 | Ga0466691_150759 | 3300042593 | Bacteria | 1927 |
| 49 | 2227326065 | 2225789004 | Bacteria | 1180 |
| 50 | IMNBL1DRAFT_c0011152 | 3300000062 | Bacteria | 4223 |
| 51 | JGI24702J35022_10168436 | 3300002462 | Bacteria | 1238 |
| 52 | JGI24705J35276_12215707 | 3300002504 | Bacteria | 2014 |
| 53 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 54 | Ga0072941_1128709 | 3300005201 | Bacteria | 2458 |
| 55 | Ga0466703_145020 | 3300042636 | Bacteria | 5403 |
| 56 | Ga0466704_175885 | 3300042643 | Bacteria | 1952 |
| 57 | Ga0466724_30875 | 3300042649 | Bacteria | 2587 |
| 58 | Ga0466701_098207 | 3300042598 | Bacteria | 13365 |
| 59 | Ga0466697_073642 | 3300042611 | Bacteria | 2859 |
| 60 | Ga0123356_10297783 | 3300010049 | Bacteria | 1717 |
| 61 | Ga0123356_11032326 | 3300010049 | Bacteria | 992 |
| 62 | Ga0123353_10311785 | 3300010167 | Bacteria | 2394 |
| 63 | Ga0123353_11637219 | 3300010167 | Bacteria | 810 |
| 64 | Ga0466656_064781 | 3300042550 | Bacteria | 21643 |
| 65 | Ga0466692_104877 | 3300042591 | Bacteria | 8727 |
| 66 | Ga0466693_262443 | 3300042592 | Bacteria | 2898 |
| 67 | Ga0466699_335849 | 3300042597 | Bacteria | 1927 |
| 68 | IMNBL1DRAFT_c0007464 | 3300000062 | Bacteria | 5747 |
| 69 | Ga0466735_214643 | 3300042624 | Bacteria | 3221 |
| 70 | Ga0466735_224691 | 3300042624 | Bacteria | 2413 |
| 71 | Ga0466730_037689 | 3300042625 | Bacteria | 2495 |
| 72 | Ga0466730_054317 | 3300042625 | Unclassified | 1057 |
| 73 | Ga0466701_076225 | 3300042598 | Bacteria | 3962 |
| 74 | Ga0466700_026256 | 3300042600 | Bacteria | 21450 |
| 75 | Ga0466707_323672 | 3300042601 | Bacteria | 13232 |
| 76 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 77 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 78 | Ga0466710_196691 | 3300042613 | Bacteria | 1133 |
| 79 | Ga0466711_008482 | 3300042615 | Bacteria | 9471 |
| 80 | Ga0466711_086510 | 3300042615 | Bacteria | 2815 |
| 81 | Ga0466711_172329 | 3300042615 | Bacteria | 9572 |
| 82 | Ga0466726_423139 | 3300042619 | Bacteria | 3489 |
| 83 | Ga0466728_387089 | 3300042620 | Bacteria | 3837 |
| 84 | Ga0466729_190575 | 3300042621 | Bacteria | 3889 |
| 85 | Ga0123354_10002580 | 3300010882 | Bacteria | 24135 |
| 86 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 87 | Ga0466691_033214 | 3300042593 | Bacteria | 7487 |
| 88 | Ga0466696_260927 | 3300042596 | Bacteria | 2924 |
| 89 | 2227230251 | 2225789004 | Bacteria | 1366 |
| 90 | JGI24702J35022_10093606 | 3300002462 | Bacteria | 1638 |
| 91 | JGI24699J35502_11134228 | 3300002509 | Bacteria | 91082 |
| 92 | Ga0072941_1069328 | 3300005201 | Archaea | 3504 |
| 93 | Ga0466702_054506 | 3300042635 | Bacteria | 1520 |
| 94 | Ga0466703_167618 | 3300042636 | Bacteria | 10138 |
| 95 | Ga0466704_525029 | 3300042643 | Bacteria | 1457 |
| 96 | Ga0466724_56730 | 3300042649 | Bacteria | 1326 |
| 97 | Ga0466708_235601 | 3300042652 | Bacteria | 5059 |
| 98 | Ga0466725_181337 | 3300042654 | Bacteria | 11124 |
| 99 | Ga0466713_145465 | 3300042602 | Bacteria | 2717 |
| 100 | Ga0466714_028648 | 3300042603 | Bacteria | 1677 |
| 101 | Ga0466714_160086 | 3300042603 | Bacteria | 3385 |
| 102 | Ga0466714_165395 | 3300042603 | Bacteria | 9090 |
| 103 | Ga0466697_176553 | 3300042611 | Bacteria | 1912 |
| 104 | Ga0466711_007001 | 3300042615 | Bacteria | 3808 |
| 105 | Ga0466728_076226 | 3300042620 | Bacteria | 6456 |
| 106 | Ga0123357_10027236 | 3300009784 | Bacteria | 7724 |
| 107 | Ga0123356_11168235 | 3300010049 | Unclassified | 936 |
| 108 | Ga0123353_10323175 | 3300010167 | Bacteria | 2340 |
| 109 | Ga0123353_10379836 | 3300010167 | Bacteria | 2113 |
| 110 | Ga0123353_10483354 | 3300010167 | Bacteria | 1811 |
| 111 | Ga0466690_053036 | 3300042590 | Bacteria | 3839 |
| 112 | Ga0466692_139021 | 3300042591 | Bacteria | 3654 |
| 113 | Ga0466696_242764 | 3300042596 | Bacteria | 17289 |
| 114 | Ga0466696_305629 | 3300042596 | Bacteria | 12685 |
| 115 | 2227319675 | 2225789004 | Unclassified | 6436 |
| 116 | Ga0068302_10068284 | 3300005071 | Bacteria | 5071 |
| 117 | Ga0466703_270775 | 3300042636 | Bacteria | 4104 |
| 118 | Ga0466703_370803 | 3300042636 | Bacteria | 2050 |
| 119 | Ga0466704_200101 | 3300042643 | Bacteria | 33375 |
| 120 | Ga0466709_302784 | 3300042648 | Bacteria | 1572 |
| 121 | Ga0466719_388414 | 3300042606 | Bacteria | 11249 |
| 122 | Ga0466698_291547 | 3300042610 | Bacteria | 1239 |
| 123 | Ga0466705_061319 | 3300042612 | Bacteria | 5992 |
| 124 | Ga0466693_177898 | 3300042592 | Bacteria | 1378 |
| 125 | 2227083318 | 2225789004 | Bacteria | 1869 |
| 126 | IMNBL1DRAFT_c0001104 | 3300000062 | Bacteria | 20698 |
| 127 | Ga0466735_012272 | 3300042624 | Bacteria | 13363 |
| 128 | Ga0466735_158117 | 3300042624 | Bacteria | 1865 |
| 129 | Ga0466704_193235 | 3300042643 | Bacteria | 11221 |
| 130 | Ga0466708_052037 | 3300042652 | Bacteria | 24057 |
| 131 | Ga0466727_042000 | 3300042655 | Bacteria | 10321 |
| 132 | Ga0466716_050030 | 3300042605 | Bacteria | 9027 |
| 133 | Ga0466716_539568 | 3300042605 | Bacteria | 9234 |
| 134 | Ga0466719_547111 | 3300042606 | Bacteria | 8384 |
| 135 | Ga0466705_357702 | 3300042612 | Bacteria | 27661 |
| 136 | Ga0466715_056629 | 3300042616 | Bacteria | 2605 |
| 137 | Ga0466726_152297 | 3300042619 | Unclassified | 9072 |
| 138 | Ga0123356_10015974 | 3300010049 | Bacteria | 7177 |
| 139 | Ga0265387_1007842 | 3300024582 | Bacteria | 1433 |
| 140 | Ga0466690_003078 | 3300042590 | Bacteria | 25930 |
| 141 | Ga0466696_324863 | 3300042596 | Bacteria | 2199 |
| 142 | 2227414171 | 2225789004 | Unclassified | 1056 |
| 143 | Ga0466729_219593 | 3300042621 | Bacteria | 2429 |
| 144 | Ga0466704_016352 | 3300042643 | Bacteria | 60527 |
| 145 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
| 146 | Ga0466727_228556 | 3300042655 | Bacteria | 1806 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042602 | Ga0466713_145465 | Ga0466713_145465_471_971 | 140 |
| 2 | 3300010167 | Ga0123353_11637219 | Ga0123353_116372192 | 146 |
| 3 | 3300042596 | Ga0466696_260927 | Ga0466696_260927_1325_1774 | 149 |
| 4 | 3300042603 | Ga0466714_028648 | Ga0466714_028648_1123_1578 | 151 |
| 5 | 3300010049 | Ga0123356_11168235 | Ga0123356_111682351 | 152 |
| 6 | 3300010882 | Ga0123354_10000201 | Ga0123354_1000020130 | 152 |
| 7 | 3300042606 | Ga0466719_547111 | Ga0466719_547111_5745_6254 | 152 |
| 8 | 3300042613 | Ga0466710_196691 | Ga0466710_196691_48_557 | 153 |
| 9 | 3300042654 | Ga0466725_210063 | Ga0466725_210063_6778_7242 | 154 |
| 10 | 3300010049 | Ga0123356_10297783 | Ga0123356_102977833 | 155 |
| 11 | 3300042619 | Ga0466726_441649 | Ga0466726_441649_97_648 | 156 |
| 12 | 3300042621 | Ga0466729_219593 | Ga0466729_219593_1638_2162 | 156 |
| 13 | 3300010049 | Ga0123356_11032326 | Ga0123356_110323261 | 157 |
| 14 | 3300042612 | Ga0466705_357702 | Ga0466705_357702_2064_2537 | 157 |
| 15 | 3300042615 | Ga0466711_086510 | Ga0466711_086510_2286_2759 | 157 |
| 16 | 3300042636 | Ga0466703_270775 | Ga0466703_270775_1513_1986 | 157 |
| 17 | 3300042643 | Ga0466704_016352 | Ga0466704_016352_42837_43310 | 157 |
| 18 | 3300005201 | Ga0072941_1128709 | Ga0072941_11287094 | 161 |
| 19 | 3300042591 | Ga0466692_192614 | Ga0466692_192614_229_738 | 161 |
| 20 | 3300042601 | Ga0466707_364600 | Ga0466707_364600_7592_8077 | 161 |
| 21 | 3300042635 | Ga0466702_054506 | Ga0466702_054506_345_854 | 161 |
| 22 | 3300042592 | Ga0466693_177898 | Ga0466693_177898_651_1160 | 163 |
| 23 | 3300042609 | Ga0466722_113613 | Ga0466722_113613_98249_98770 | 163 |
| 24 | 3300042619 | Ga0466726_429212 | Ga0466726_429212_2201_2725 | 163 |
| 25 | 3300042652 | Ga0466708_049839 | Ga0466708_049839_12184_12705 | 163 |
| 26 | 3300005201 | Ga0072941_1113935 | Ga0072941_11139353 | 164 |
| 27 | 3300042603 | Ga0466714_160086 | Ga0466714_160086_983_1492 | 164 |
| 28 | 3300042593 | Ga0466691_033214 | Ga0466691_033214_5646_6143 | 165 |
| 29 | 3300042612 | Ga0466705_108475 | Ga0466705_108475_2698_3195 | 165 |
| 30 | 3300042616 | Ga0466715_056629 | Ga0466715_056629_1978_2475 | 165 |
| 31 | 3300042618 | Ga0466723_018466 | Ga0466723_018466_272_769 | 165 |
| 32 | 3300042619 | Ga0466726_423139 | Ga0466726_423139_2115_2612 | 165 |
| 33 | 3300042620 | Ga0466728_076226 | Ga0466728_076226_1688_2185 | 165 |
| 34 | 3300042624 | Ga0466735_214643 | Ga0466735_214643_377_874 | 165 |
| 35 | 3300042648 | Ga0466709_302784 | Ga0466709_302784_1060_1557 | 165 |
| 36 | 3300042652 | Ga0466708_235601 | Ga0466708_235601_2149_2646 | 165 |
| 37 | 3300042655 | Ga0466727_066432 | Ga0466727_066432_6516_7013 | 165 |
| 38 | 3300005071 | Ga0068302_10068284 | Ga0068302_100682843 | 166 |
| 39 | 3300042605 | Ga0466716_050030 | Ga0466716_050030_5395_5916 | 166 |
| 40 | 3300042612 | Ga0466705_350955 | Ga0466705_350955_3031_3531 | 166 |
| 41 | 3300042643 | Ga0466704_525029 | Ga0466704_525029_160_660 | 166 |
| 42 | 3300042659 | Ga0466733_086622 | Ga0466733_086622_1742_2242 | 166 |
| 43 | iso_pr_bacteria | 2695420317 | 2695483567 | 166 |
| 44 | iso_pr_bacteria | 2695420931 | 2698111064 | 166 |
| 45 | iso_pr_bacteria | 2873600114 | 2873601764 | 166 |
| 46 | iso_pr_bacteria | 2873610414 | 2873612145 | 166 |
| 47 | iso_pr_bacteria | 8100157865 | 8100159134 | 166 |
| 48 | 3300042596 | Ga0466696_324863 | Ga0466696_324863_911_1414 | 167 |
| 49 | 3300042602 | Ga0466713_133321 | Ga0466713_133321_51_554 | 167 |
| 50 | 3300042603 | Ga0466714_051125 | Ga0466714_051125_16901_17404 | 167 |
| 51 | 3300042615 | Ga0466711_172329 | Ga0466711_172329_6529_7032 | 167 |
| 52 | 3300042659 | Ga0466733_054986 | Ga0466733_054986_83714_84217 | 167 |
| 53 | 3300042659 | Ga0466733_203605 | Ga0466733_203605_63942_64445 | 167 |
| 54 | iso_pr_bacteria | 2910930387 | 2910930860 | 167 |
| 55 | iso_pr_bacteria | 2910949487 | 2910951833 | 167 |
| 56 | 2225789004 | 2227591289 | 2228150866 | 168 |
| 57 | 3300002462 | JGI24702J35022_10168436 | JGI24702J35022_101684362 | 168 |
| 58 | 3300042593 | Ga0466691_113343 | Ga0466691_113343_2294_2821 | 168 |
| 59 | 2225789004 | 2227326065 | 2227773967 | 169 |
| 60 | 3300000062 | IMNBL1DRAFT_c0001921 | IMNBL1DRAFT_000192111 | 169 |
| 61 | 3300042550 | Ga0466656_064781 | Ga0466656_064781_9758_10267 | 169 |
| 62 | 3300042592 | Ga0466693_083612 | Ga0466693_083612_402_911 | 169 |
| 63 | 3300042597 | Ga0466699_335849 | Ga0466699_335849_367_876 | 169 |
| 64 | 3300042598 | Ga0466701_099952 | Ga0466701_099952_420_929 | 169 |
| 65 | 3300042601 | Ga0466707_323672 | Ga0466707_323672_6781_7290 | 169 |
| 66 | 3300042609 | Ga0466722_131066 | Ga0466722_131066_7626_8135 | 169 |
| 67 | 3300042612 | Ga0466705_301679 | Ga0466705_301679_17245_17754 | 169 |
| 68 | 3300042617 | Ga0466718_126288 | Ga0466718_126288_652_1161 | 169 |
| 69 | 3300042624 | Ga0466735_224691 | Ga0466735_224691_759_1268 | 169 |
| 70 | 3300042636 | Ga0466703_167618 | Ga0466703_167618_5338_5847 | 169 |
| 71 | 3300042636 | Ga0466703_406289 | Ga0466703_406289_181_690 | 169 |
| 72 | 3300042643 | Ga0466704_193235 | Ga0466704_193235_5173_5682 | 169 |
| 73 | 3300042643 | Ga0466704_200101 | Ga0466704_200101_12739_13248 | 169 |
| 74 | 3300042652 | Ga0466708_052037 | Ga0466708_052037_10040_10549 | 169 |
| 75 | 3300042654 | Ga0466725_181337 | Ga0466725_181337_6839_7348 | 169 |
| 76 | 3300042655 | Ga0466727_000612 | Ga0466727_000612_5633_6142 | 169 |
| 77 | 3300002504 | JGI24705J35276_12215707 | JGI24705J35276_122157071 | 170 |
| 78 | 3300010167 | Ga0123353_10323175 | Ga0123353_103231753 | 170 |
| 79 | 3300010167 | Ga0123353_10483354 | Ga0123353_104833543 | 170 |
| 80 | 3300042602 | Ga0466713_074755 | Ga0466713_074755_17271_17783 | 170 |
| 81 | 3300042614 | Ga0466712_102177 | Ga0466712_102177_540_1052 | 170 |
| 82 | 3300042636 | Ga0466703_370803 | Ga0466703_370803_696_1208 | 170 |
| 83 | iso_pr_bacteria | 2820757377 | 2820759761 | 170 |
| 84 | 3300002509 | JGI24699J35502_11134228 | JGI24699J35502_1113422819 | 171 |
| 85 | 3300010049 | Ga0123356_10884583 | Ga0123356_108845833 | 171 |
| 86 | 3300010167 | Ga0123353_10379836 | Ga0123353_103798362 | 171 |
| 87 | 3300010882 | Ga0123354_10226407 | Ga0123354_102264072 | 171 |
| 88 | 3300042591 | Ga0466692_191366 | Ga0466692_191366_7201_7716 | 171 |
| 89 | 3300042598 | Ga0466701_076225 | Ga0466701_076225_3080_3595 | 171 |
| 90 | 3300042603 | Ga0466714_165395 | Ga0466714_165395_8274_8789 | 171 |
| 91 | 3300042611 | Ga0466697_073642 | Ga0466697_073642_296_811 | 171 |
| 92 | 3300042611 | Ga0466697_176553 | Ga0466697_176553_304_819 | 171 |
| 93 | 3300042613 | Ga0466710_193786 | Ga0466710_193786_147_662 | 171 |
| 94 | 3300042649 | Ga0466724_30875 | Ga0466724_30875_1657_2172 | 171 |
| 95 | 3300042649 | Ga0466724_56730 | Ga0466724_56730_416_931 | 171 |
| 96 | 3300010049 | Ga0123356_10015974 | Ga0123356_100159744 | 172 |
| 97 | 3300042590 | Ga0466690_149899 | Ga0466690_149899_4317_4835 | 172 |
| 98 | 3300042591 | Ga0466692_102850 | Ga0466692_102850_13162_13680 | 172 |
| 99 | 3300042615 | Ga0466711_247006 | Ga0466711_247006_5789_6307 | 172 |
| 100 | 2225789004 | 2227083318 | 2227458660 | 173 |
| 101 | 2225789004 | 2227230251 | 2227666147 | 173 |
| 102 | 2225789004 | 2227319675 | 2227768275 | 173 |
| 103 | 2225789004 | 2227414171 | 2227856391 | 173 |
| 104 | 3300024582 | Ga0265387_1007842 | Ga0265387_10078422 | 173 |
| 105 | 3300042590 | Ga0466690_003078 | Ga0466690_003078_6607_7128 | 173 |
| 106 | 3300042590 | Ga0466690_053036 | Ga0466690_053036_2680_3201 | 173 |
| 107 | 3300042591 | Ga0466692_104877 | Ga0466692_104877_763_1284 | 173 |
| 108 | 3300042591 | Ga0466692_139021 | Ga0466692_139021_2505_3026 | 173 |
| 109 | 3300042592 | Ga0466693_262443 | Ga0466693_262443_777_1298 | 173 |
| 110 | 3300042593 | Ga0466691_068618 | Ga0466691_068618_27522_28043 | 173 |
| 111 | 3300042593 | Ga0466691_150759 | Ga0466691_150759_988_1509 | 173 |
| 112 | 3300042596 | Ga0466696_242764 | Ga0466696_242764_13794_14315 | 173 |
| 113 | 3300042596 | Ga0466696_305629 | Ga0466696_305629_1658_2179 | 173 |
| 114 | 3300042598 | Ga0466701_098207 | Ga0466701_098207_11521_12042 | 173 |
| 115 | 3300042599 | Ga0466706_276356 | Ga0466706_276356_8290_8811 | 173 |
| 116 | 3300042600 | Ga0466700_026256 | Ga0466700_026256_8842_9363 | 173 |
| 117 | 3300042600 | Ga0466700_269271 | Ga0466700_269271_717_1238 | 173 |
| 118 | 3300042603 | Ga0466714_117320 | Ga0466714_117320_172_693 | 173 |
| 119 | 3300042605 | Ga0466716_539568 | Ga0466716_539568_2625_3146 | 173 |
| 120 | 3300042606 | Ga0466719_388414 | Ga0466719_388414_5493_6014 | 173 |
| 121 | 3300042611 | Ga0466697_142368 | Ga0466697_142368_640_1161 | 173 |
| 122 | 3300042612 | Ga0466705_061319 | Ga0466705_061319_3309_3830 | 173 |
| 123 | 3300042615 | Ga0466711_007001 | Ga0466711_007001_813_1334 | 173 |
| 124 | 3300042615 | Ga0466711_008482 | Ga0466711_008482_568_1089 | 173 |
| 125 | 3300042616 | Ga0466715_156320 | Ga0466715_156320_8255_8776 | 173 |
| 126 | 3300042616 | Ga0466715_456601 | Ga0466715_456601_2755_3276 | 173 |
| 127 | 3300042618 | Ga0466723_084166 | Ga0466723_084166_848_1369 | 173 |
| 128 | 3300042618 | Ga0466723_128058 | Ga0466723_128058_3594_4115 | 173 |
| 129 | 3300042620 | Ga0466728_387089 | Ga0466728_387089_1617_2138 | 173 |
| 130 | 3300042621 | Ga0466729_190575 | Ga0466729_190575_1929_2450 | 173 |
| 131 | 3300042624 | Ga0466735_012272 | Ga0466735_012272_127_648 | 173 |
| 132 | 3300042624 | Ga0466735_158117 | Ga0466735_158117_1253_1774 | 173 |
| 133 | 3300042625 | Ga0466730_037689 | Ga0466730_037689_1045_1566 | 173 |
| 134 | 3300042625 | Ga0466730_054317 | Ga0466730_054317_435_956 | 173 |
| 135 | 3300042636 | Ga0466703_145020 | Ga0466703_145020_4344_4865 | 173 |
| 136 | 3300042648 | Ga0466709_245110 | Ga0466709_245110_21234_21755 | 173 |
| 137 | 3300042655 | Ga0466727_228556 | Ga0466727_228556_885_1406 | 173 |
| 138 | iso_pr_bacteria | 2820759988 | 2820762540 | 173 |
| 139 | iso_pr_bacteria | 2820762746 | 2820763178 | 173 |
| 140 | iso_pr_bacteria | 2940216256 | 2940217632 | 173 |
| 141 | 3300000062 | IMNBL1DRAFT_c0001104 | IMNBL1DRAFT_000110411 | 174 |
| 142 | 3300000062 | IMNBL1DRAFT_c0007464 | IMNBL1DRAFT_00074641 | 174 |
| 143 | 3300000062 | IMNBL1DRAFT_c0011152 | IMNBL1DRAFT_00111523 | 174 |
| 144 | 3300002462 | JGI24702J35022_10093606 | JGI24702J35022_100936062 | 174 |
| 145 | 3300002509 | JGI24699J35502_11133745 | JGI24699J35502_111337454 | 174 |
| 146 | 3300002509 | JGI24699J35502_11134224 | JGI24699J35502_1113422436 | 174 |
| 147 | 3300005083 | Ga0068305_10043939 | Ga0068305_100439394 | 174 |
| 148 | 3300005201 | Ga0072941_1069328 | Ga0072941_10693285 | 174 |
| 149 | 3300009784 | Ga0123357_10027236 | Ga0123357_100272364 | 174 |
| 150 | 3300010167 | Ga0123353_10311785 | Ga0123353_103117853 | 174 |
| 151 | 3300010882 | Ga0123354_10002580 | Ga0123354_100025807 | 174 |
| 152 | 3300042610 | Ga0466698_291547 | Ga0466698_291547_614_1138 | 174 |
| 153 | 3300042619 | Ga0466726_152297 | Ga0466726_152297_5417_5947 | 176 |
| 154 | 3300042609 | Ga0466722_175146 | Ga0466722_175146_67_600 | 177 |
| 155 | 3300042619 | Ga0466726_064602 | Ga0466726_064602_10855_11400 | 181 |
| 156 | 3300042643 | Ga0466704_175885 | Ga0466704_175885_821_1402 | 186 |
| 157 | 3300042655 | Ga0466727_042000 | Ga0466727_042000_7461_8030 | 189 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00499 | Oxidored_q3 | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 | 21 | 170 | 0.81 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00499 | GO:0008137 | NADH dehydrogenase (ubiquinone) activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.