Protein Family IF10124

Metagenome Isolate
157 Members
63 Samples
146 Scaffolds
168.39 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_042000|Ga0466727_042000_7461_8030
Length
189 aa
Sequence
MNNMVAYQVIFSLLAALMVVSAVLAVTTRKIMRAATYLLFVLVGTAGLYLLLNYHFLAAVQLSVYAGGILILFIFAILLVNPKGDPIAKTDRRKSLAGLAAALCGLAVVGVVVLKRYYLYPLNPTVMGDQELDMQLIGETLMGTQKYQYLLPFEVLSVLLLACIIGGILIARKSRVEENNFVEPTEKTT

πŸ“Š Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 37.7%
Kalotermitidae 23.0%
Unclassified 13.1%
Rhinotermitidae 6.6%
Termopsidae 6.6%
Blattidae 4.9%
Hydrophilidae 3.3%
Passalidae 3.3%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
7 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
28 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
36 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
37 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
57 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
58 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
59 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
60 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
61 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
62 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_301679 3300042612 Bacteria 30952
2 Ga0466715_456601 3300042616 Bacteria 5089
3 Ga0466718_126288 3300042617 Bacteria 1554
4 Ga0466723_084166 3300042618 Bacteria 1933
5 Ga0466723_128058 3300042618 Bacteria 4335
6 Ga0466726_429212 3300042619 Bacteria 4521
7 Ga0123356_10884583 3300010049 Bacteria 1064
8 Ga0123354_10226407 3300010882 Unclassified 1969
9 Ga0466691_068618 3300042593 Bacteria 28516
10 Ga0068305_10043939 3300005083 Bacteria 3099
11 Ga0072941_1113935 3300005201 Bacteria 2449
12 Ga0466703_406289 3300042636 Bacteria 1846
13 Ga0466709_245110 3300042648 Bacteria 22256
14 Ga0466727_066432 3300042655 Bacteria 36886
15 Ga0466706_276356 3300042599 Bacteria 20327
16 Ga0466700_269271 3300042600 Bacteria 1298
17 Ga0466707_364600 3300042601 Bacteria 8981
18 Ga0466713_133321 3300042602 Bacteria 8944
19 Ga0466722_131066 3300042609 Bacteria 10030
20 Ga0466722_175146 3300042609 Bacteria 2287
21 Ga0466705_350955 3300042612 Bacteria 6058
22 Ga0466733_054986 3300042659 Bacteria 147644
23 Ga0466733_086622 3300042659 Bacteria 4394
24 Ga0466710_193786 3300042613 Bacteria 2165
25 Ga0466712_102177 3300042614 Unclassified 2068
26 Ga0466711_247006 3300042615 Bacteria 9768
27 Ga0466723_018466 3300042618 Bacteria 2341
28 Ga0466726_064602 3300042619 Bacteria 18009
29 Ga0466726_441649 3300042619 Bacteria 1366
30 Ga0466692_192614 3300042591 Bacteria 3161
31 Ga0466693_083612 3300042592 Bacteria 2679
32 2227591289 2225789004 Bacteria 12992
33 IMNBL1DRAFT_c0001921 3300000062 Bacteria 15041
34 JGI24699J35502_11133745 3300002509 Bacteria 14684
35 Ga0466708_049839 3300042652 Bacteria 17940
36 Ga0466725_210063 3300042654 Bacteria 11666
37 Ga0466701_099952 3300042598 Bacteria 1346
38 Ga0466713_074755 3300042602 Bacteria 27009
39 Ga0466714_117320 3300042603 Bacteria 1058
40 Ga0466697_142368 3300042611 Bacteria 1274
41 Ga0466705_108475 3300042612 Bacteria 3982
42 Ga0466733_203605 3300042659 Bacteria 93930
43 Ga0466715_156320 3300042616 Bacteria 9972
44 Ga0123354_10000201 3300010882 Bacteria 51540
45 Ga0466692_102850 3300042591 Bacteria 14012
46 Ga0466692_191366 3300042591 Bacteria 14423
47 Ga0466691_113343 3300042593 Bacteria 3967
48 Ga0466691_150759 3300042593 Bacteria 1927
49 2227326065 2225789004 Bacteria 1180
50 IMNBL1DRAFT_c0011152 3300000062 Bacteria 4223
51 JGI24702J35022_10168436 3300002462 Bacteria 1238
52 JGI24705J35276_12215707 3300002504 Bacteria 2014
53 JGI24699J35502_11134224 3300002509 Bacteria 74083
54 Ga0072941_1128709 3300005201 Bacteria 2458
55 Ga0466703_145020 3300042636 Bacteria 5403
56 Ga0466704_175885 3300042643 Bacteria 1952
57 Ga0466724_30875 3300042649 Bacteria 2587
58 Ga0466701_098207 3300042598 Bacteria 13365
59 Ga0466697_073642 3300042611 Bacteria 2859
60 Ga0123356_10297783 3300010049 Bacteria 1717
61 Ga0123356_11032326 3300010049 Bacteria 992
62 Ga0123353_10311785 3300010167 Bacteria 2394
63 Ga0123353_11637219 3300010167 Bacteria 810
64 Ga0466656_064781 3300042550 Bacteria 21643
65 Ga0466692_104877 3300042591 Bacteria 8727
66 Ga0466693_262443 3300042592 Bacteria 2898
67 Ga0466699_335849 3300042597 Bacteria 1927
68 IMNBL1DRAFT_c0007464 3300000062 Bacteria 5747
69 Ga0466735_214643 3300042624 Bacteria 3221
70 Ga0466735_224691 3300042624 Bacteria 2413
71 Ga0466730_037689 3300042625 Bacteria 2495
72 Ga0466730_054317 3300042625 Unclassified 1057
73 Ga0466701_076225 3300042598 Bacteria 3962
74 Ga0466700_026256 3300042600 Bacteria 21450
75 Ga0466707_323672 3300042601 Bacteria 13232
76 Ga0466714_051125 3300042603 Bacteria 52861
77 Ga0466722_113613 3300042609 Bacteria 129604
78 Ga0466710_196691 3300042613 Bacteria 1133
79 Ga0466711_008482 3300042615 Bacteria 9471
80 Ga0466711_086510 3300042615 Bacteria 2815
81 Ga0466711_172329 3300042615 Bacteria 9572
82 Ga0466726_423139 3300042619 Bacteria 3489
83 Ga0466728_387089 3300042620 Bacteria 3837
84 Ga0466729_190575 3300042621 Bacteria 3889
85 Ga0123354_10002580 3300010882 Bacteria 24135
86 Ga0466690_149899 3300042590 Bacteria 20818
87 Ga0466691_033214 3300042593 Bacteria 7487
88 Ga0466696_260927 3300042596 Bacteria 2924
89 2227230251 2225789004 Bacteria 1366
90 JGI24702J35022_10093606 3300002462 Bacteria 1638
91 JGI24699J35502_11134228 3300002509 Bacteria 91082
92 Ga0072941_1069328 3300005201 Archaea 3504
93 Ga0466702_054506 3300042635 Bacteria 1520
94 Ga0466703_167618 3300042636 Bacteria 10138
95 Ga0466704_525029 3300042643 Bacteria 1457
96 Ga0466724_56730 3300042649 Bacteria 1326
97 Ga0466708_235601 3300042652 Bacteria 5059
98 Ga0466725_181337 3300042654 Bacteria 11124
99 Ga0466713_145465 3300042602 Bacteria 2717
100 Ga0466714_028648 3300042603 Bacteria 1677
101 Ga0466714_160086 3300042603 Bacteria 3385
102 Ga0466714_165395 3300042603 Bacteria 9090
103 Ga0466697_176553 3300042611 Bacteria 1912
104 Ga0466711_007001 3300042615 Bacteria 3808
105 Ga0466728_076226 3300042620 Bacteria 6456
106 Ga0123357_10027236 3300009784 Bacteria 7724
107 Ga0123356_11168235 3300010049 Unclassified 936
108 Ga0123353_10323175 3300010167 Bacteria 2340
109 Ga0123353_10379836 3300010167 Bacteria 2113
110 Ga0123353_10483354 3300010167 Bacteria 1811
111 Ga0466690_053036 3300042590 Bacteria 3839
112 Ga0466692_139021 3300042591 Bacteria 3654
113 Ga0466696_242764 3300042596 Bacteria 17289
114 Ga0466696_305629 3300042596 Bacteria 12685
115 2227319675 2225789004 Unclassified 6436
116 Ga0068302_10068284 3300005071 Bacteria 5071
117 Ga0466703_270775 3300042636 Bacteria 4104
118 Ga0466703_370803 3300042636 Bacteria 2050
119 Ga0466704_200101 3300042643 Bacteria 33375
120 Ga0466709_302784 3300042648 Bacteria 1572
121 Ga0466719_388414 3300042606 Bacteria 11249
122 Ga0466698_291547 3300042610 Bacteria 1239
123 Ga0466705_061319 3300042612 Bacteria 5992
124 Ga0466693_177898 3300042592 Bacteria 1378
125 2227083318 2225789004 Bacteria 1869
126 IMNBL1DRAFT_c0001104 3300000062 Bacteria 20698
127 Ga0466735_012272 3300042624 Bacteria 13363
128 Ga0466735_158117 3300042624 Bacteria 1865
129 Ga0466704_193235 3300042643 Bacteria 11221
130 Ga0466708_052037 3300042652 Bacteria 24057
131 Ga0466727_042000 3300042655 Bacteria 10321
132 Ga0466716_050030 3300042605 Bacteria 9027
133 Ga0466716_539568 3300042605 Bacteria 9234
134 Ga0466719_547111 3300042606 Bacteria 8384
135 Ga0466705_357702 3300042612 Bacteria 27661
136 Ga0466715_056629 3300042616 Bacteria 2605
137 Ga0466726_152297 3300042619 Unclassified 9072
138 Ga0123356_10015974 3300010049 Bacteria 7177
139 Ga0265387_1007842 3300024582 Bacteria 1433
140 Ga0466690_003078 3300042590 Bacteria 25930
141 Ga0466696_324863 3300042596 Bacteria 2199
142 2227414171 2225789004 Unclassified 1056
143 Ga0466729_219593 3300042621 Bacteria 2429
144 Ga0466704_016352 3300042643 Bacteria 60527
145 Ga0466727_000612 3300042655 Bacteria 11085
146 Ga0466727_228556 3300042655 Bacteria 1806

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_145465 Ga0466713_145465_471_971 140
2 3300010167 Ga0123353_11637219 Ga0123353_116372192 146
3 3300042596 Ga0466696_260927 Ga0466696_260927_1325_1774 149
4 3300042603 Ga0466714_028648 Ga0466714_028648_1123_1578 151
5 3300010049 Ga0123356_11168235 Ga0123356_111682351 152
6 3300010882 Ga0123354_10000201 Ga0123354_1000020130 152
7 3300042606 Ga0466719_547111 Ga0466719_547111_5745_6254 152
8 3300042613 Ga0466710_196691 Ga0466710_196691_48_557 153
9 3300042654 Ga0466725_210063 Ga0466725_210063_6778_7242 154
10 3300010049 Ga0123356_10297783 Ga0123356_102977833 155
11 3300042619 Ga0466726_441649 Ga0466726_441649_97_648 156
12 3300042621 Ga0466729_219593 Ga0466729_219593_1638_2162 156
13 3300010049 Ga0123356_11032326 Ga0123356_110323261 157
14 3300042612 Ga0466705_357702 Ga0466705_357702_2064_2537 157
15 3300042615 Ga0466711_086510 Ga0466711_086510_2286_2759 157
16 3300042636 Ga0466703_270775 Ga0466703_270775_1513_1986 157
17 3300042643 Ga0466704_016352 Ga0466704_016352_42837_43310 157
18 3300005201 Ga0072941_1128709 Ga0072941_11287094 161
19 3300042591 Ga0466692_192614 Ga0466692_192614_229_738 161
20 3300042601 Ga0466707_364600 Ga0466707_364600_7592_8077 161
21 3300042635 Ga0466702_054506 Ga0466702_054506_345_854 161
22 3300042592 Ga0466693_177898 Ga0466693_177898_651_1160 163
23 3300042609 Ga0466722_113613 Ga0466722_113613_98249_98770 163
24 3300042619 Ga0466726_429212 Ga0466726_429212_2201_2725 163
25 3300042652 Ga0466708_049839 Ga0466708_049839_12184_12705 163
26 3300005201 Ga0072941_1113935 Ga0072941_11139353 164
27 3300042603 Ga0466714_160086 Ga0466714_160086_983_1492 164
28 3300042593 Ga0466691_033214 Ga0466691_033214_5646_6143 165
29 3300042612 Ga0466705_108475 Ga0466705_108475_2698_3195 165
30 3300042616 Ga0466715_056629 Ga0466715_056629_1978_2475 165
31 3300042618 Ga0466723_018466 Ga0466723_018466_272_769 165
32 3300042619 Ga0466726_423139 Ga0466726_423139_2115_2612 165
33 3300042620 Ga0466728_076226 Ga0466728_076226_1688_2185 165
34 3300042624 Ga0466735_214643 Ga0466735_214643_377_874 165
35 3300042648 Ga0466709_302784 Ga0466709_302784_1060_1557 165
36 3300042652 Ga0466708_235601 Ga0466708_235601_2149_2646 165
37 3300042655 Ga0466727_066432 Ga0466727_066432_6516_7013 165
38 3300005071 Ga0068302_10068284 Ga0068302_100682843 166
39 3300042605 Ga0466716_050030 Ga0466716_050030_5395_5916 166
40 3300042612 Ga0466705_350955 Ga0466705_350955_3031_3531 166
41 3300042643 Ga0466704_525029 Ga0466704_525029_160_660 166
42 3300042659 Ga0466733_086622 Ga0466733_086622_1742_2242 166
43 iso_pr_bacteria 2695420317 2695483567 166
44 iso_pr_bacteria 2695420931 2698111064 166
45 iso_pr_bacteria 2873600114 2873601764 166
46 iso_pr_bacteria 2873610414 2873612145 166
47 iso_pr_bacteria 8100157865 8100159134 166
48 3300042596 Ga0466696_324863 Ga0466696_324863_911_1414 167
49 3300042602 Ga0466713_133321 Ga0466713_133321_51_554 167
50 3300042603 Ga0466714_051125 Ga0466714_051125_16901_17404 167
51 3300042615 Ga0466711_172329 Ga0466711_172329_6529_7032 167
52 3300042659 Ga0466733_054986 Ga0466733_054986_83714_84217 167
53 3300042659 Ga0466733_203605 Ga0466733_203605_63942_64445 167
54 iso_pr_bacteria 2910930387 2910930860 167
55 iso_pr_bacteria 2910949487 2910951833 167
56 2225789004 2227591289 2228150866 168
57 3300002462 JGI24702J35022_10168436 JGI24702J35022_101684362 168
58 3300042593 Ga0466691_113343 Ga0466691_113343_2294_2821 168
59 2225789004 2227326065 2227773967 169
60 3300000062 IMNBL1DRAFT_c0001921 IMNBL1DRAFT_000192111 169
61 3300042550 Ga0466656_064781 Ga0466656_064781_9758_10267 169
62 3300042592 Ga0466693_083612 Ga0466693_083612_402_911 169
63 3300042597 Ga0466699_335849 Ga0466699_335849_367_876 169
64 3300042598 Ga0466701_099952 Ga0466701_099952_420_929 169
65 3300042601 Ga0466707_323672 Ga0466707_323672_6781_7290 169
66 3300042609 Ga0466722_131066 Ga0466722_131066_7626_8135 169
67 3300042612 Ga0466705_301679 Ga0466705_301679_17245_17754 169
68 3300042617 Ga0466718_126288 Ga0466718_126288_652_1161 169
69 3300042624 Ga0466735_224691 Ga0466735_224691_759_1268 169
70 3300042636 Ga0466703_167618 Ga0466703_167618_5338_5847 169
71 3300042636 Ga0466703_406289 Ga0466703_406289_181_690 169
72 3300042643 Ga0466704_193235 Ga0466704_193235_5173_5682 169
73 3300042643 Ga0466704_200101 Ga0466704_200101_12739_13248 169
74 3300042652 Ga0466708_052037 Ga0466708_052037_10040_10549 169
75 3300042654 Ga0466725_181337 Ga0466725_181337_6839_7348 169
76 3300042655 Ga0466727_000612 Ga0466727_000612_5633_6142 169
77 3300002504 JGI24705J35276_12215707 JGI24705J35276_122157071 170
78 3300010167 Ga0123353_10323175 Ga0123353_103231753 170
79 3300010167 Ga0123353_10483354 Ga0123353_104833543 170
80 3300042602 Ga0466713_074755 Ga0466713_074755_17271_17783 170
81 3300042614 Ga0466712_102177 Ga0466712_102177_540_1052 170
82 3300042636 Ga0466703_370803 Ga0466703_370803_696_1208 170
83 iso_pr_bacteria 2820757377 2820759761 170
84 3300002509 JGI24699J35502_11134228 JGI24699J35502_1113422819 171
85 3300010049 Ga0123356_10884583 Ga0123356_108845833 171
86 3300010167 Ga0123353_10379836 Ga0123353_103798362 171
87 3300010882 Ga0123354_10226407 Ga0123354_102264072 171
88 3300042591 Ga0466692_191366 Ga0466692_191366_7201_7716 171
89 3300042598 Ga0466701_076225 Ga0466701_076225_3080_3595 171
90 3300042603 Ga0466714_165395 Ga0466714_165395_8274_8789 171
91 3300042611 Ga0466697_073642 Ga0466697_073642_296_811 171
92 3300042611 Ga0466697_176553 Ga0466697_176553_304_819 171
93 3300042613 Ga0466710_193786 Ga0466710_193786_147_662 171
94 3300042649 Ga0466724_30875 Ga0466724_30875_1657_2172 171
95 3300042649 Ga0466724_56730 Ga0466724_56730_416_931 171
96 3300010049 Ga0123356_10015974 Ga0123356_100159744 172
97 3300042590 Ga0466690_149899 Ga0466690_149899_4317_4835 172
98 3300042591 Ga0466692_102850 Ga0466692_102850_13162_13680 172
99 3300042615 Ga0466711_247006 Ga0466711_247006_5789_6307 172
100 2225789004 2227083318 2227458660 173
101 2225789004 2227230251 2227666147 173
102 2225789004 2227319675 2227768275 173
103 2225789004 2227414171 2227856391 173
104 3300024582 Ga0265387_1007842 Ga0265387_10078422 173
105 3300042590 Ga0466690_003078 Ga0466690_003078_6607_7128 173
106 3300042590 Ga0466690_053036 Ga0466690_053036_2680_3201 173
107 3300042591 Ga0466692_104877 Ga0466692_104877_763_1284 173
108 3300042591 Ga0466692_139021 Ga0466692_139021_2505_3026 173
109 3300042592 Ga0466693_262443 Ga0466693_262443_777_1298 173
110 3300042593 Ga0466691_068618 Ga0466691_068618_27522_28043 173
111 3300042593 Ga0466691_150759 Ga0466691_150759_988_1509 173
112 3300042596 Ga0466696_242764 Ga0466696_242764_13794_14315 173
113 3300042596 Ga0466696_305629 Ga0466696_305629_1658_2179 173
114 3300042598 Ga0466701_098207 Ga0466701_098207_11521_12042 173
115 3300042599 Ga0466706_276356 Ga0466706_276356_8290_8811 173
116 3300042600 Ga0466700_026256 Ga0466700_026256_8842_9363 173
117 3300042600 Ga0466700_269271 Ga0466700_269271_717_1238 173
118 3300042603 Ga0466714_117320 Ga0466714_117320_172_693 173
119 3300042605 Ga0466716_539568 Ga0466716_539568_2625_3146 173
120 3300042606 Ga0466719_388414 Ga0466719_388414_5493_6014 173
121 3300042611 Ga0466697_142368 Ga0466697_142368_640_1161 173
122 3300042612 Ga0466705_061319 Ga0466705_061319_3309_3830 173
123 3300042615 Ga0466711_007001 Ga0466711_007001_813_1334 173
124 3300042615 Ga0466711_008482 Ga0466711_008482_568_1089 173
125 3300042616 Ga0466715_156320 Ga0466715_156320_8255_8776 173
126 3300042616 Ga0466715_456601 Ga0466715_456601_2755_3276 173
127 3300042618 Ga0466723_084166 Ga0466723_084166_848_1369 173
128 3300042618 Ga0466723_128058 Ga0466723_128058_3594_4115 173
129 3300042620 Ga0466728_387089 Ga0466728_387089_1617_2138 173
130 3300042621 Ga0466729_190575 Ga0466729_190575_1929_2450 173
131 3300042624 Ga0466735_012272 Ga0466735_012272_127_648 173
132 3300042624 Ga0466735_158117 Ga0466735_158117_1253_1774 173
133 3300042625 Ga0466730_037689 Ga0466730_037689_1045_1566 173
134 3300042625 Ga0466730_054317 Ga0466730_054317_435_956 173
135 3300042636 Ga0466703_145020 Ga0466703_145020_4344_4865 173
136 3300042648 Ga0466709_245110 Ga0466709_245110_21234_21755 173
137 3300042655 Ga0466727_228556 Ga0466727_228556_885_1406 173
138 iso_pr_bacteria 2820759988 2820762540 173
139 iso_pr_bacteria 2820762746 2820763178 173
140 iso_pr_bacteria 2940216256 2940217632 173
141 3300000062 IMNBL1DRAFT_c0001104 IMNBL1DRAFT_000110411 174
142 3300000062 IMNBL1DRAFT_c0007464 IMNBL1DRAFT_00074641 174
143 3300000062 IMNBL1DRAFT_c0011152 IMNBL1DRAFT_00111523 174
144 3300002462 JGI24702J35022_10093606 JGI24702J35022_100936062 174
145 3300002509 JGI24699J35502_11133745 JGI24699J35502_111337454 174
146 3300002509 JGI24699J35502_11134224 JGI24699J35502_1113422436 174
147 3300005083 Ga0068305_10043939 Ga0068305_100439394 174
148 3300005201 Ga0072941_1069328 Ga0072941_10693285 174
149 3300009784 Ga0123357_10027236 Ga0123357_100272364 174
150 3300010167 Ga0123353_10311785 Ga0123353_103117853 174
151 3300010882 Ga0123354_10002580 Ga0123354_100025807 174
152 3300042610 Ga0466698_291547 Ga0466698_291547_614_1138 174
153 3300042619 Ga0466726_152297 Ga0466726_152297_5417_5947 176
154 3300042609 Ga0466722_175146 Ga0466722_175146_67_600 177
155 3300042619 Ga0466726_064602 Ga0466726_064602_10855_11400 181
156 3300042643 Ga0466704_175885 Ga0466704_175885_821_1402 186
157 3300042655 Ga0466727_042000 Ga0466727_042000_7461_8030 189

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6 21 170 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00499 GO:0008137 NADH dehydrogenase (ubiquinone) activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.51 0.77 High

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.