Protein Family IF10113
Metagenome
Isolate
111
Members
33
Samples
107
Scaffolds
155.65
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_007910|Ga0466727_007910_344_820
- Length
- 153 aa
- Sequence
- VRCPHCGNSDDKVNESRTLANGEAIRRRRECNVCGYRFTSYERIEDKQFMVIKRDGRREPFDRRKIERGVKRPVSQMDIERLVNEIEDTAAIKGIGHEIKASVIGDLVLAKLAELDQVAYVRFASVYRHFENLEEFINEVQKIGGMSRDQECS
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
42.4%
Termitidae
18.2%
Unclassified
18.2%
Rhinotermitidae
9.1%
Termopsidae
9.1%
Hodotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 23 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 24 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_094428 | 3300042659 | Bacteria | 2117 |
| 2 | Ga0466691_009693 | 3300042593 | Bacteria | 32026 |
| 3 | Ga0466705_452953 | 3300042612 | Unclassified | 2712 |
| 4 | Ga0466711_180881 | 3300042615 | Bacteria | 23762 |
| 5 | Ga0466715_109576 | 3300042616 | Bacteria | 15299 |
| 6 | Ga0466723_220241 | 3300042618 | Bacteria | 11283 |
| 7 | Ga0466726_290835 | 3300042619 | Bacteria | 1499 |
| 8 | Ga0466726_367509 | 3300042619 | Bacteria | 1120 |
| 9 | Ga0466728_298865 | 3300042620 | Bacteria | 2345 |
| 10 | Ga0466709_258735 | 3300042648 | Bacteria | 25998 |
| 11 | Ga0466709_269194 | 3300042648 | Bacteria | 1161 |
| 12 | Ga0466727_060684 | 3300042655 | Bacteria | 3499 |
| 13 | Ga0466727_153494 | 3300042655 | Bacteria | 5023 |
| 14 | Ga0466719_049857 | 3300042606 | Bacteria | 16576 |
| 15 | Ga0466722_197540 | 3300042609 | Bacteria | 1694 |
| 16 | Ga0466696_354566 | 3300042596 | Bacteria | 6874 |
| 17 | Ga0466711_030757 | 3300042615 | Bacteria | 1369 |
| 18 | Ga0466711_495405 | 3300042615 | Bacteria | 11619 |
| 19 | Ga0466715_278134 | 3300042616 | Bacteria | 18382 |
| 20 | Ga0466723_166870 | 3300042618 | Bacteria | 2380 |
| 21 | Ga0466728_071074 | 3300042620 | Bacteria | 6525 |
| 22 | Ga0466709_025940 | 3300042648 | Bacteria | 1227 |
| 23 | Ga0466709_174671 | 3300042648 | Bacteria | 9141 |
| 24 | Ga0466708_011900 | 3300042652 | Bacteria | 1250 |
| 25 | Ga0466708_264477 | 3300042652 | Bacteria | 23930 |
| 26 | Ga0466727_083020 | 3300042655 | Bacteria | 3207 |
| 27 | Ga0466705_042905 | 3300042612 | Bacteria | 5529 |
| 28 | Ga0466715_539536 | 3300042616 | Bacteria | 2416 |
| 29 | Ga0466728_284876 | 3300042620 | Bacteria | 1786 |
| 30 | Ga0466729_255657 | 3300042621 | Bacteria | 1679 |
| 31 | Ga0466708_419509 | 3300042652 | Bacteria | 2656 |
| 32 | Ga0466727_274206 | 3300042655 | Bacteria | 1205 |
| 33 | Ga0466707_127897 | 3300042601 | Bacteria | 2153 |
| 34 | Ga0466716_245539 | 3300042605 | Bacteria | 8430 |
| 35 | Ga0466716_285125 | 3300042605 | Bacteria | 30119 |
| 36 | Ga0466698_399473 | 3300042610 | Bacteria | 1411 |
| 37 | JGI24698J34947_10016223 | 3300002449 | Bacteria | 4045 |
| 38 | Ga0466705_023186 | 3300042612 | Bacteria | 2649 |
| 39 | Ga0466705_130392 | 3300042612 | Bacteria | 8400 |
| 40 | Ga0466690_379884 | 3300042590 | Bacteria | 1569 |
| 41 | Ga0466694_090955 | 3300042594 | Bacteria | 1391 |
| 42 | Ga0466696_396821 | 3300042596 | Bacteria | 23354 |
| 43 | Ga0466723_332810 | 3300042618 | Bacteria | 10274 |
| 44 | Ga0466728_238710 | 3300042620 | Bacteria | 2339 |
| 45 | Ga0466729_128761 | 3300042621 | Bacteria | 1958 |
| 46 | Ga0466703_189779 | 3300042636 | Bacteria | 4198 |
| 47 | Ga0466704_047104 | 3300042643 | Bacteria | 2117 |
| 48 | Ga0466709_369493 | 3300042648 | Bacteria | 19878 |
| 49 | Ga0466727_007910 | 3300042655 | Bacteria | 2084 |
| 50 | Ga0466719_442433 | 3300042606 | Bacteria | 2361 |
| 51 | JGI24695J34938_10033740 | 3300002450 | Bacteria | 2353 |
| 52 | Ga0466690_258574 | 3300042590 | Bacteria | 5583 |
| 53 | Ga0466691_207813 | 3300042593 | Bacteria | 1493 |
| 54 | Ga0466696_004232 | 3300042596 | Bacteria | 21177 |
| 55 | Ga0466696_297367 | 3300042596 | Bacteria | 3848 |
| 56 | Ga0466696_480915 | 3300042596 | Bacteria | 2407 |
| 57 | Ga0466711_453795 | 3300042615 | Bacteria | 1577 |
| 58 | Ga0466715_248207 | 3300042616 | Bacteria | 11785 |
| 59 | Ga0466723_369581 | 3300042618 | Bacteria | 64268 |
| 60 | Ga0466728_300288 | 3300042620 | Bacteria | 2721 |
| 61 | Ga0123353_11796405 | 3300010167 | Bacteria | 762 |
| 62 | Ga0466729_312914 | 3300042621 | Bacteria | 1315 |
| 63 | Ga0466704_177650 | 3300042643 | Bacteria | 16434 |
| 64 | Ga0466704_278894 | 3300042643 | Unclassified | 4317 |
| 65 | Ga0466708_038494 | 3300042652 | Unclassified | 2003 |
| 66 | Ga0466708_050202 | 3300042652 | Bacteria | 9191 |
| 67 | Ga0466713_071471 | 3300042602 | Bacteria | 4087 |
| 68 | Ga0466716_046023 | 3300042605 | Bacteria | 22215 |
| 69 | Ga0466705_111806 | 3300042612 | Bacteria | 4000 |
| 70 | Ga0466690_255124 | 3300042590 | Bacteria | 2402 |
| 71 | Ga0466715_050491 | 3300042616 | Bacteria | 10423 |
| 72 | Ga0466723_209542 | 3300042618 | Bacteria | 11213 |
| 73 | Ga0466723_330413 | 3300042618 | Bacteria | 34326 |
| 74 | Ga0466729_189133 | 3300042621 | Bacteria | 4977 |
| 75 | Ga0466703_050010 | 3300042636 | Bacteria | 1045 |
| 76 | Ga0466704_075735 | 3300042643 | Bacteria | 1980 |
| 77 | Ga0466708_035701 | 3300042652 | Bacteria | 3012 |
| 78 | Ga0466727_299065 | 3300042655 | Bacteria | 3249 |
| 79 | Ga0466716_067566 | 3300042605 | Bacteria | 7326 |
| 80 | Ga0466719_246600 | 3300042606 | Bacteria | 2507 |
| 81 | Ga0466722_079776 | 3300042609 | Bacteria | 6762 |
| 82 | Ga0466715_096917 | 3300042616 | Bacteria | 1954 |
| 83 | Ga0466726_038840 | 3300042619 | Bacteria | 16960 |
| 84 | Ga0123353_10870261 | 3300010167 | Bacteria | 1232 |
| 85 | Ga0466703_074587 | 3300042636 | Bacteria | 16579 |
| 86 | Ga0466703_134408 | 3300042636 | Bacteria | 38500 |
| 87 | Ga0466703_225853 | 3300042636 | Bacteria | 41639 |
| 88 | Ga0466703_242637 | 3300042636 | Bacteria | 1800 |
| 89 | Ga0466704_034604 | 3300042643 | Unclassified | 1403 |
| 90 | Ga0466704_039928 | 3300042643 | Bacteria | 8913 |
| 91 | Ga0466706_222829 | 3300042599 | Bacteria | 2327 |
| 92 | Ga0466707_064247 | 3300042601 | Bacteria | 6611 |
| 93 | Ga0466716_251399 | 3300042605 | Bacteria | 22558 |
| 94 | Ga0466719_198559 | 3300042606 | Bacteria | 41330 |
| 95 | JGI24698J34947_10042603 | 3300002449 | Bacteria | 2332 |
| 96 | Ga0466690_312623 | 3300042590 | Bacteria | 5017 |
| 97 | Ga0466692_012646 | 3300042591 | Bacteria | 1169 |
| 98 | Ga0466692_105300 | 3300042591 | Bacteria | 4865 |
| 99 | Ga0466705_456149 | 3300042612 | Bacteria | 12924 |
| 100 | Ga0466728_018030 | 3300042620 | Bacteria | 3245 |
| 101 | Ga0466728_264878 | 3300042620 | Bacteria | 6451 |
| 102 | Ga0466735_193528 | 3300042624 | Bacteria | 1195 |
| 103 | Ga0466704_074257 | 3300042643 | Bacteria | 4569 |
| 104 | Ga0466708_080537 | 3300042652 | Bacteria | 1403 |
| 105 | Ga0466707_040030 | 3300042601 | Bacteria | 2036 |
| 106 | Ga0466707_258880 | 3300042601 | Bacteria | 1190 |
| 107 | Ga0466719_283750 | 3300042606 | Unclassified | 3229 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042610 | Ga0466698_399473 | Ga0466698_399473_567_1046 | 149 |
| 2 | 3300042602 | Ga0466713_071471 | Ga0466713_071471_2471_2923 | 150 |
| 3 | 3300002449 | JGI24698J34947_10042603 | JGI24698J34947_100426033 | 151 |
| 4 | 3300042609 | Ga0466722_079776 | Ga0466722_079776_266_724 | 152 |
| 5 | 3300042612 | Ga0466705_111806 | Ga0466705_111806_1256_1714 | 152 |
| 6 | 3300042616 | Ga0466715_109576 | Ga0466715_109576_1994_2452 | 152 |
| 7 | 3300042621 | Ga0466729_312914 | Ga0466729_312914_256_714 | 152 |
| 8 | 3300042624 | Ga0466735_193528 | Ga0466735_193528_276_734 | 152 |
| 9 | 3300042643 | Ga0466704_177650 | Ga0466704_177650_1271_1729 | 152 |
| 10 | 3300042643 | Ga0466704_278894 | Ga0466704_278894_1943_2401 | 152 |
| 11 | 3300042648 | Ga0466709_174671 | Ga0466709_174671_2466_2924 | 152 |
| 12 | 3300042648 | Ga0466709_369493 | Ga0466709_369493_16688_17146 | 152 |
| 13 | 3300042655 | Ga0466727_274206 | Ga0466727_274206_579_1037 | 152 |
| 14 | iso_pr_bacteria | 650716099 | 650878749 | 152 |
| 15 | 3300042590 | Ga0466690_255124 | Ga0466690_255124_1739_2200 | 153 |
| 16 | 3300042590 | Ga0466690_258574 | Ga0466690_258574_3018_3479 | 153 |
| 17 | 3300042590 | Ga0466690_312623 | Ga0466690_312623_2552_3013 | 153 |
| 18 | 3300042591 | Ga0466692_105300 | Ga0466692_105300_309_770 | 153 |
| 19 | 3300042593 | Ga0466691_009693 | Ga0466691_009693_2035_2496 | 153 |
| 20 | 3300042593 | Ga0466691_207813 | Ga0466691_207813_308_769 | 153 |
| 21 | 3300042596 | Ga0466696_297367 | Ga0466696_297367_2178_2639 | 153 |
| 22 | 3300042596 | Ga0466696_354566 | Ga0466696_354566_2074_2535 | 153 |
| 23 | 3300042596 | Ga0466696_396821 | Ga0466696_396821_2745_3206 | 153 |
| 24 | 3300042596 | Ga0466696_480915 | Ga0466696_480915_1580_2041 | 153 |
| 25 | 3300042605 | Ga0466716_046023 | Ga0466716_046023_7613_8074 | 153 |
| 26 | 3300042605 | Ga0466716_067566 | Ga0466716_067566_3404_3865 | 153 |
| 27 | 3300042605 | Ga0466716_245539 | Ga0466716_245539_1424_1885 | 153 |
| 28 | 3300042605 | Ga0466716_285125 | Ga0466716_285125_25052_25513 | 153 |
| 29 | 3300042606 | Ga0466719_198559 | Ga0466719_198559_4666_5127 | 153 |
| 30 | 3300042606 | Ga0466719_246600 | Ga0466719_246600_1390_1851 | 153 |
| 31 | 3300042606 | Ga0466719_442433 | Ga0466719_442433_54_515 | 153 |
| 32 | 3300042609 | Ga0466722_197540 | Ga0466722_197540_1189_1650 | 153 |
| 33 | 3300042612 | Ga0466705_023186 | Ga0466705_023186_261_722 | 153 |
| 34 | 3300042615 | Ga0466711_180881 | Ga0466711_180881_16667_17128 | 153 |
| 35 | 3300042616 | Ga0466715_050491 | Ga0466715_050491_9710_10171 | 153 |
| 36 | 3300042616 | Ga0466715_278134 | Ga0466715_278134_1286_1747 | 153 |
| 37 | 3300042618 | Ga0466723_166870 | Ga0466723_166870_1406_1867 | 153 |
| 38 | 3300042618 | Ga0466723_220241 | Ga0466723_220241_10002_10463 | 153 |
| 39 | 3300042620 | Ga0466728_018030 | Ga0466728_018030_508_969 | 153 |
| 40 | 3300042620 | Ga0466728_071074 | Ga0466728_071074_4663_5124 | 153 |
| 41 | 3300042620 | Ga0466728_238710 | Ga0466728_238710_1588_2049 | 153 |
| 42 | 3300042620 | Ga0466728_284876 | Ga0466728_284876_410_871 | 153 |
| 43 | 3300042620 | Ga0466728_298865 | Ga0466728_298865_1181_1642 | 153 |
| 44 | 3300042620 | Ga0466728_300288 | Ga0466728_300288_1557_2018 | 153 |
| 45 | 3300042636 | Ga0466703_050010 | Ga0466703_050010_353_814 | 153 |
| 46 | 3300042636 | Ga0466703_134408 | Ga0466703_134408_56_517 | 153 |
| 47 | 3300042636 | Ga0466703_189779 | Ga0466703_189779_1409_1870 | 153 |
| 48 | 3300042636 | Ga0466703_242637 | Ga0466703_242637_935_1396 | 153 |
| 49 | 3300042648 | Ga0466709_258735 | Ga0466709_258735_8433_8894 | 153 |
| 50 | 3300042652 | Ga0466708_035701 | Ga0466708_035701_1977_2438 | 153 |
| 51 | 3300042652 | Ga0466708_038494 | Ga0466708_038494_968_1429 | 153 |
| 52 | 3300042652 | Ga0466708_419509 | Ga0466708_419509_595_1056 | 153 |
| 53 | 3300042655 | Ga0466727_007910 | Ga0466727_007910_344_820 | 153 |
| 54 | 3300042655 | Ga0466727_083020 | Ga0466727_083020_539_1000 | 153 |
| 55 | 3300042659 | Ga0466733_094428 | Ga0466733_094428_830_1291 | 153 |
| 56 | iso_pr_bacteria | 2781125685 | 2781417415 | 153 |
| 57 | iso_pr_bacteria | 2781125691 | 2781429076 | 153 |
| 58 | 3300042612 | Ga0466705_042905 | Ga0466705_042905_1022_1486 | 154 |
| 59 | 3300042612 | Ga0466705_456149 | Ga0466705_456149_6764_7228 | 154 |
| 60 | 3300042618 | Ga0466723_209542 | Ga0466723_209542_4399_4863 | 154 |
| 61 | 3300042618 | Ga0466723_369581 | Ga0466723_369581_49374_49838 | 154 |
| 62 | 3300042619 | Ga0466726_038840 | Ga0466726_038840_13194_13658 | 154 |
| 63 | 3300042619 | Ga0466726_290835 | Ga0466726_290835_163_627 | 154 |
| 64 | 3300042620 | Ga0466728_264878 | Ga0466728_264878_341_805 | 154 |
| 65 | 3300042643 | Ga0466704_034604 | Ga0466704_034604_596_1060 | 154 |
| 66 | 3300042643 | Ga0466704_074257 | Ga0466704_074257_2142_2606 | 154 |
| 67 | 3300042643 | Ga0466704_075735 | Ga0466704_075735_176_640 | 154 |
| 68 | 3300042655 | Ga0466727_060684 | Ga0466727_060684_2619_3083 | 154 |
| 69 | 3300042606 | Ga0466719_049857 | Ga0466719_049857_11918_12385 | 155 |
| 70 | 3300042636 | Ga0466703_074587 | Ga0466703_074587_9174_9641 | 155 |
| 71 | 3300042643 | Ga0466704_039928 | Ga0466704_039928_526_993 | 155 |
| 72 | 3300042652 | Ga0466708_011900 | Ga0466708_011900_629_1096 | 155 |
| 73 | iso_pr_bacteria | 650716102 | 650882184 | 155 |
| 74 | 3300042601 | Ga0466707_040030 | Ga0466707_040030_480_950 | 156 |
| 75 | 3300042601 | Ga0466707_258880 | Ga0466707_258880_420_890 | 156 |
| 76 | 3300042605 | Ga0466716_251399 | Ga0466716_251399_12566_13036 | 156 |
| 77 | 3300042606 | Ga0466719_283750 | Ga0466719_283750_1295_1765 | 156 |
| 78 | 3300042612 | Ga0466705_452953 | Ga0466705_452953_1029_1499 | 156 |
| 79 | 3300042616 | Ga0466715_248207 | Ga0466715_248207_9415_9885 | 156 |
| 80 | 3300042618 | Ga0466723_332810 | Ga0466723_332810_7084_7554 | 156 |
| 81 | 3300042619 | Ga0466726_367509 | Ga0466726_367509_533_1003 | 156 |
| 82 | 3300042652 | Ga0466708_050202 | Ga0466708_050202_3587_4057 | 156 |
| 83 | 3300042655 | Ga0466727_153494 | Ga0466727_153494_3544_4014 | 156 |
| 84 | 3300042612 | Ga0466705_130392 | Ga0466705_130392_7327_7800 | 157 |
| 85 | 3300042652 | Ga0466708_080537 | Ga0466708_080537_473_946 | 157 |
| 86 | 3300042594 | Ga0466694_090955 | Ga0466694_090955_310_786 | 158 |
| 87 | 3300042615 | Ga0466711_030757 | Ga0466711_030757_512_988 | 158 |
| 88 | 3300042616 | Ga0466715_096917 | Ga0466715_096917_849_1325 | 158 |
| 89 | 3300042590 | Ga0466690_379884 | Ga0466690_379884_172_651 | 159 |
| 90 | 3300042616 | Ga0466715_539536 | Ga0466715_539536_1432_1911 | 159 |
| 91 | 3300042636 | Ga0466703_225853 | Ga0466703_225853_40848_41327 | 159 |
| 92 | 3300042643 | Ga0466704_047104 | Ga0466704_047104_424_903 | 159 |
| 93 | 3300042648 | Ga0466709_269194 | Ga0466709_269194_603_1082 | 159 |
| 94 | 3300042655 | Ga0466727_299065 | Ga0466727_299065_575_1138 | 159 |
| 95 | 3300042596 | Ga0466696_004232 | Ga0466696_004232_8853_9335 | 160 |
| 96 | 3300042601 | Ga0466707_064247 | Ga0466707_064247_4133_4615 | 160 |
| 97 | 3300042615 | Ga0466711_495405 | Ga0466711_495405_8303_8785 | 160 |
| 98 | 3300042621 | Ga0466729_128761 | Ga0466729_128761_433_915 | 160 |
| 99 | 3300042621 | Ga0466729_189133 | Ga0466729_189133_3388_3873 | 161 |
| 100 | 3300002449 | JGI24698J34947_10016223 | JGI24698J34947_100162233 | 162 |
| 101 | 3300042601 | Ga0466707_127897 | Ga0466707_127897_295_783 | 162 |
| 102 | 3300042621 | Ga0466729_255657 | Ga0466729_255657_196_684 | 162 |
| 103 | 3300042591 | Ga0466692_012646 | Ga0466692_012646_42_536 | 164 |
| 104 | 3300042599 | Ga0466706_222829 | Ga0466706_222829_1341_1835 | 164 |
| 105 | 3300042648 | Ga0466709_025940 | Ga0466709_025940_75_569 | 164 |
| 106 | 3300010167 | Ga0123353_10870261 | Ga0123353_108702612 | 165 |
| 107 | 3300002450 | JGI24695J34938_10033740 | JGI24695J34938_100337402 | 166 |
| 108 | 3300042615 | Ga0466711_453795 | Ga0466711_453795_371_871 | 166 |
| 109 | 3300010167 | Ga0123353_11796405 | Ga0123353_117964052 | 173 |
| 110 | 3300042618 | Ga0466723_330413 | Ga0466723_330413_12269_12793 | 174 |
| 111 | 3300042652 | Ga0466708_264477 | Ga0466708_264477_12595_13143 | 182 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.63 | 0.66 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.