Protein Family IF10105

Metagenome Isolate
256 Members
161 Samples
155 Scaffolds
311.6 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_432863|Ga0466725_432863_6875_7969
Length
364 aa
Sequence
MATVHKVLTQFFSLNAFGDFSQKPRKFACRFNFCFAKDAQELVRTMLCTVTKYANGGKIMSKIVVALGGNALGDNVTQQLANAKLAAASXXDLAAAGHSVVVAHGNGPQVGAIKMALDAGGFVVPMPECTAMSQGYIGFHLQQSLGNELAARGVKRQVATVLTQVVVDKNDPAFANPTKPIGAYYDETAAKELMAQTGKTYVEDAGRGWRWVVPSPLPVDIREAASIKFLSDNDFMVIACGGGGMPVVAEDGGFAGIDAVIDKDFASAKMAELIDADVLVILTAVDRVKINFNKPDEKSLDTLTVAQAQKYADEGHFAKGSMLPKVQAAIKFARGGGGRKAIIGSLEQAAAAIAGQSGTTIVKE

📊 Sample Types

Isolate 39.5%
Metagenome 60.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.0%
Termitidae 15.3%
Formicidae 10.0%
Kalotermitidae 7.3%
Tenebrionidae 5.3%
Apidae 4.7%
Blattidae 4.0%
Argasidae 2.7%
Rhinotermitidae 2.0%
Scarabaeidae 1.3%
Hydrophilidae 1.3%
Ixodidae 1.3%
Passalidae 1.3%
Termopsidae 1.3%
Ceratopogonidae 0.7%
Gomphidae 0.7%
Culicidae 0.7%
Drosophilidae 0.7%
Elmidae 0.7%
Vespidae 0.7%
Stratiomyidae 0.7%
Hodotermitidae 0.7%
Rhaphidophoridae 0.7%

🌳 Taxonomy

Archaea 1
Bacteria 239
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114010755 Borrelia coriaceae Co53 Isolate Argasidae
2 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
3 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
4 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
5 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
6 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
7 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
8 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
9 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
10 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
11 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
12 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
18 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
23 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
24 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
25 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
26 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
27 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
28 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
29 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
30 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
33 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
34 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
43 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
44 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
45 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
46 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
47 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
48 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
49 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
50 8064008355 Heyndrickxia oleronia Isolate Unclassified
51 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
54 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
55 2848878685 Borrelia miyamotoi CA17-2241 Isolate Ixodidae
56 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
57 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
58 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
59 2718218422 Borrelia miyamotoi CT13-2396 Isolate Ixodidae
60 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
61 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
62 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
63 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
64 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
65 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
66 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
71 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
72 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
73 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
74 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
75 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
76 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
77 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
78 2916858470 Heyndrickxia oleronia Isolate Unclassified
79 2931425734 Nocardioides sp. J2M5 Isolate
80 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
81 2565956565 Borrelia coriaceae Co53 Isolate Argasidae
82 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
83 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
84 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
85 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
86 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
87 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
88 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
89 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
90 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
91 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
92 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
93 2545555866 Borrelia coriaceae ATCC 43381 Isolate Argasidae
94 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
95 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
96 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
97 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
98 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
99 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
100 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
101 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
102 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
103 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
104 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
105 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
106 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
107 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
108 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
109 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
110 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
111 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
112 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
113 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
114 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
115 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
116 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
117 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
118 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
119 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
120 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
121 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
122 2775507261 Borrelia turicatae 91E135 Isolate Argasidae
123 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
124 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
125 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
126 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
127 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
128 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
129 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
130 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
131 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
132 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
133 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
134 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
135 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
136 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
137 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
138 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
139 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
140 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
141 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
142 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
143 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
144 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
145 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
146 2836714267 Shimwellia blattae NCTC10965 Isolate
147 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
148 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
149 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
150 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
151 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
152 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
153 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
154 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
155 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
156 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
157 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
158 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
159 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
160 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
161 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_306364 3300042612 Bacteria 36565
2 Ga0562379_0560 3300056790 Bacteria 69212
3 Ga0562379_4608 3300056790 Bacteria 6614
4 Ga0562377_0006 3300056842 Bacteria 3350072
5 Ga0562374_0519 3300057007 Bacteria 62999
6 Ga0123355_10059866 3300009826 Bacteria 6150
7 Ga0123355_10202518 3300009826 Bacteria 2896
8 Ga0123356_10010367 3300010049 Bacteria 9147
9 Ga0123356_10060380 3300010049 Bacteria 3538
10 Ga0123353_10041755 3300010167 Bacteria 7250
11 Ga0123354_10066153 3300010882 Bacteria 5282
12 Ga0466706_208127 3300042599 Bacteria 7179
13 Ga0466707_251168 3300042601 Bacteria 17407
14 Ga0466714_129882 3300042603 Bacteria 1125
15 Ga0415639_093781 3300038395 Bacteria 3843
16 Ga0466656_310114 3300042550 Bacteria 1534
17 Ga0466693_147310 3300042592 Bacteria 3277
18 Ga0466695_107371 3300042595 Bacteria 3154
19 Ga0466696_464787 3300042596 Bacteria 3312
20 Ga0466699_424928 3300042597 Bacteria 1951
21 Ga0466735_101764 3300042624 Bacteria 14847
22 Ga0466715_181865 3300042616 Bacteria 5988
23 Ga0466718_153000 3300042617 Unclassified 51850
24 Ga0466728_076506 3300042620 Bacteria 1537
25 JGI24695J34938_10038923 3300002450 Bacteria 2151
26 CVPL010L_1000321 3300002932 Bacteria 11855
27 Ga0068305_10287311 3300005083 Bacteria 8475
28 Ga0123357_10000327 3300009784 Bacteria 45136
29 Ga0466733_087809 3300042659 Bacteria 3244
30 Ga0562379_0092 3300056790 Bacteria 317609
31 Ga0562379_1345 3300056790 Bacteria 29065
32 Ga0562377_0040 3300056842 Bacteria 613468
33 Ga0562374_0022 3300057007 Bacteria 1083986
34 Ga0562374_3302 3300057007 Unclassified 9687
35 Ga0123355_10550161 3300009826 Bacteria 1396
36 Ga0123356_10002098 3300010049 Bacteria 21502
37 Ga0123356_10752006 3300010049 Bacteria 1145
38 Ga0123353_10042794 3300010167 Unclassified 7168
39 Ga0466700_470039 3300042600 Bacteria 7471
40 Ga0466707_277810 3300042601 Bacteria 20537
41 Ga0466713_107250 3300042602 Bacteria 117772
42 Ga0466714_052888 3300042603 Unclassified 1748
43 Ga0466696_493622 3300042596 Bacteria 5002
44 Ga0466708_301966 3300042652 Bacteria 4736
45 Ga0466715_395694 3300042616 Bacteria 34108
46 Ga0530661_000784 3300056564 Unclassified 20266
47 Ga0562378_0427 3300056814 Unclassified 75062
48 Ga0562377_0237 3300056842 Bacteria 130479
49 Ga0562374_0196 3300057007 Unclassified 130686
50 Ga0123357_10070001 3300009784 Bacteria 4662
51 Ga0123355_10000238 3300009826 Bacteria 70491
52 Ga0123355_10100101 3300009826 Bacteria 4566
53 Ga0123354_10073455 3300010882 Unclassified 4911
54 Ga0466717_026851 3300042604 Bacteria 1392
55 Ga0415639_072992 3300038395 Unclassified 1784
56 Ga0466656_080481 3300042550 Bacteria 1218
57 Ga0466725_432863 3300042654 Bacteria 12232
58 JGI24702J35022_10007200 3300002462 Bacteria 6396
59 Meta3P_1000869 3300002464 Bacteria 44072
60 Ga0103264_1000026 3300007188 Bacteria 92644
61 Ga0562378_0008 3300056814 Bacteria 1370151
62 Ga0562378_2893 3300056814 Bacteria 12258
63 Ga0562376_0650 3300056857 Bacteria 58388
64 Ga0123357_10033746 3300009784 Bacteria 6956
65 Ga0123355_10366371 3300009826 Bacteria 1893
66 Ga0123356_10105820 3300010049 Unclassified 2707
67 Ga0466700_051752 3300042600 Bacteria 4290
68 Ga0466716_144776 3300042605 Bacteria 68361
69 Ga0466722_229508 3300042609 Bacteria 1181
70 Ga0466692_066220 3300042591 Bacteria 18291
71 Ga0466725_367631 3300042654 Bacteria 3218
72 Ga0466729_184814 3300042621 Bacteria 7054
73 2226980395 2225789003 Bacteria 9188
74 JGI24695J34938_10000214 3300002450 Bacteria 55263
75 Ga0072941_1000968 3300005201 Bacteria 33336
76 Ga0072941_1024023 3300005201 Bacteria 23668
77 Ga0072941_1644704 3300005201 Bacteria 1119
78 Ga0103268_1000007 3300007192 Bacteria 70891
79 Ga0562379_0102 3300056790 Bacteria 287611
80 Ga0562379_1386 3300056790 Bacteria 28271
81 Ga0123356_10168768 3300010049 Bacteria 2196
82 Ga0123353_10029881 3300010167 Unclassified 8409
83 Ga0123353_10150988 3300010167 Bacteria 3709
84 Ga0123353_10222023 3300010167 Bacteria 2953
85 Ga0466713_037610 3300042602 Bacteria 9597
86 Ga0466714_000341 3300042603 Bacteria 4527
87 Ga0466717_213602 3300042604 Bacteria 11864
88 Ga0466722_126302 3300042609 Bacteria 1004
89 Ga0466694_055152 3300042594 Bacteria 6714
90 Ga0466703_124313 3300042636 Bacteria 6509
91 Ga0466708_456516 3300042652 Unclassified 1301
92 JGI24702J35022_10007430 3300002462 Bacteria 6284
93 Ga0072941_1022085 3300005201 Bacteria 12064
94 Ga0072941_1034873 3300005201 Bacteria 7319
95 Ga0562377_0078 3300056842 Bacteria 380003
96 Ga0562377_2383 3300056842 Unclassified 14301
97 Ga0562374_0014 3300057007 Bacteria 1241908
98 Ga0123356_10046008 3300010049 Bacteria 4060
99 Ga0123356_10423529 3300010049 Bacteria 1474
100 Ga0123356_10436075 3300010049 Bacteria 1455
101 Ga0123353_10032510 3300010167 Bacteria 8102
102 Ga0466700_396789 3300042600 Archaea 1572
103 Ga0466707_155385 3300042601 Bacteria 5079
104 Ga0466707_226981 3300042601 Bacteria 3113
105 Ga0466714_128448 3300042603 Bacteria 3169
106 Ga0466719_208724 3300042606 Bacteria 4073
107 Ga0415639_000550 3300038395 Bacteria 24503
108 Ga0415639_062336 3300038395 Bacteria 2539
109 Ga0466730_057632 3300042625 Bacteria 43996
110 Ga0466708_109046 3300042652 Bacteria 1468
111 Ga0466711_063441 3300042615 Bacteria 2012
112 Ga0466711_196720 3300042615 Unclassified 3352
113 Ga0466726_125067 3300042619 Bacteria 44907
114 Ga0102735_1000253 3300007080 Bacteria 23452
115 Ga0466697_142896 3300042611 Bacteria 2659
116 Ga0562375_0013 3300056856 Bacteria 1229523
117 Ga0562375_0025 3300056856 Bacteria 749171
118 Ga0562375_0326 3300056856 Bacteria 113604
119 Ga0123355_10008290 3300009826 Bacteria 15701
120 Ga0123355_10302785 3300009826 Bacteria 2177
121 Ga0123356_10072782 3300010049 Bacteria 3230
122 Ga0466713_027650 3300042602 Bacteria 2022
123 Ga0466713_138385 3300042602 Bacteria 336961
124 Ga0466714_064008 3300042603 Bacteria 5142
125 Ga0255572_1000024 3300026175 Bacteria 128087
126 Ga0415639_070025 3300038395 Bacteria 11171
127 Ga0415639_121359 3300038395 Bacteria 3754
128 Ga0466696_419013 3300042596 Bacteria 1295
129 Ga0466731_057572 3300042622 Bacteria 1770
130 Ga0466730_000615 3300042625 Bacteria 2907
131 Ga0466730_088179 3300042625 Bacteria 3070
132 IMNBL1DRAFT_c0000020 3300000062 Bacteria 157199
133 JGI24695J34938_10000106 3300002450 Bacteria 73679
134 JGI24702J35022_10003238 3300002462 Bacteria 9850
135 Ga0072941_1223254 3300005201 Bacteria 6886
136 Ga0102734_1003853 3300007129 Bacteria 3389
137 Ga0103267_1000150 3300007190 Bacteria 27389
138 Ga0466705_254122 3300042612 Bacteria 5912
139 Ga0562378_0019 3300056814 Bacteria 857275
140 Ga0123357_10293246 3300009784 Bacteria 1657
141 Ga0123355_10001266 3300009826 Bacteria 35305
142 Ga0123355_10165360 3300009826 Bacteria 3322
143 Ga0123355_10279377 3300009826 Bacteria 2308
144 Ga0123356_10122173 3300010049 Bacteria 2535
145 Ga0123353_10163117 3300010167 Bacteria 3546
146 Ga0466714_110229 3300042603 Bacteria 2273
147 Ga0466714_118098 3300042603 Bacteria 2324
148 Ga0466716_332318 3300042605 Bacteria 4185
149 Ga0264413_116615 3300024493 Bacteria 8717
150 Ga0415639_075121 3300038395 Bacteria 7046
151 Ga0466693_163883 3300042592 Bacteria 1212
152 Ga0466734_105059 3300042623 Bacteria 1566
153 Ga0466704_213179 3300042643 Unclassified 1375
154 Ga0466708_343765 3300042652 Unclassified 15676
155 Ga0466711_049732 3300042615 Bacteria 3213

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_072992 Ga0415639_072992_928_1698 256
2 3300042602 Ga0466713_027650 Ga0466713_027650_10_855 281
3 3300010167 Ga0123353_10029881 Ga0123353_100298814 290
4 3300010882 Ga0123354_10073455 Ga0123354_100734554 290
5 3300009826 Ga0123355_10165360 Ga0123355_101653602 292
6 3300010049 Ga0123356_10436075 Ga0123356_104360752 292
7 3300009826 Ga0123355_10366371 Ga0123355_103663712 295
8 3300010882 Ga0123354_10066153 Ga0123354_100661534 296
9 3300042609 Ga0466722_229508 Ga0466722_229508_35_973 297
10 3300005201 Ga0072941_1644704 Ga0072941_16447041 298
11 3300009826 Ga0123355_10302785 Ga0123355_103027852 298
12 3300042619 Ga0466726_125067 Ga0466726_125067_6842_7783 299
13 3300056842 Ga0562377_0006 Ga0562377_0006_290298_291197 299
14 iso_pr_bacteria 2820389254 2820390107 299
15 3300010049 Ga0123356_10002098 Ga0123356_100020988 300
16 3300010049 Ga0123356_10060380 Ga0123356_100603803 300
17 3300042600 Ga0466700_396789 Ga0466700_396789_203_1144 301
18 3300042609 Ga0466722_126302 Ga0466722_126302_43_990 301
19 3300042615 Ga0466711_063441 Ga0466711_063441_693_1601 302
20 iso_pr_bacteria 2820499546 2820500519 302
21 iso_pr_bacteria 2820537337 2820537383 302
22 iso_pr_bacteria 2820681712 2820682081 302
23 3300042623 Ga0466734_105059 Ga0466734_105059_435_1373 303
24 iso_pr_bacteria 2873589062 2873590852 303
25 3300010049 Ga0123356_10752006 Ga0123356_107520061 304
26 3300042600 Ga0466700_051752 Ga0466700_051752_1055_1969 304
27 3300042636 Ga0466703_124313 Ga0466703_124313_2709_3665 304
28 iso_pr_bacteria 2820479655 2820481147 304
29 iso_pr_bacteria 2820598593 2820599254 304
30 iso_pr_bacteria 2820619171 2820620412 304
31 3300009826 Ga0123355_10001266 Ga0123355_1000126634 305
32 3300009826 Ga0123355_10008290 Ga0123355_100082904 305
33 3300009826 Ga0123355_10059866 Ga0123355_100598666 305
34 3300009826 Ga0123355_10100101 Ga0123355_101001012 305
35 3300009826 Ga0123355_10279377 Ga0123355_102793772 305
36 3300042591 Ga0466692_066220 Ga0466692_066220_16346_17302 306
37 3300042605 Ga0466716_332318 Ga0466716_332318_2208_3128 306
38 3300042654 Ga0466725_367631 Ga0466725_367631_69_1007 306
39 3300042625 Ga0466730_000615 Ga0466730_000615_714_1637 307
40 3300056790 Ga0562379_0560 Ga0562379_0560_4725_5717 307
41 3300056814 Ga0562378_0427 Ga0562378_0427_14022_15014 307
42 3300056842 Ga0562377_2383 Ga0562377_2383_457_1449 307
43 3300057007 Ga0562374_3302 Ga0562374_3302_4701_5693 307
44 iso_pr_bacteria 8030337018 8030339466 307
45 3300007080 Ga0102735_1000253 Ga0102735_100025316 308
46 3300007129 Ga0102734_1003853 Ga0102734_10038532 308
47 3300007188 Ga0103264_1000026 Ga0103264_100002628 308
48 3300007190 Ga0103267_1000150 Ga0103267_100015026 308
49 3300007192 Ga0103268_1000007 Ga0103268_100000761 308
50 3300009826 Ga0123355_10550161 Ga0123355_105501611 308
51 iso_pr_bacteria 2820596822 2820596961 308
52 3300009826 Ga0123355_10000238 Ga0123355_1000023835 309
53 3300042603 Ga0466714_000341 Ga0466714_000341_1703_2632 309
54 3300042603 Ga0466714_052888 Ga0466714_052888_109_1038 309
55 3300042604 Ga0466717_026851 Ga0466717_026851_331_1260 309
56 3300056564 Ga0530661_000784 Ga0530661_000784_3678_4607 309
57 3300056790 Ga0562379_0092 Ga0562379_0092_169550_170479 309
58 3300056790 Ga0562379_0102 Ga0562379_0102_224436_225365 309
59 3300056790 Ga0562379_1345 Ga0562379_1345_20832_21761 309
60 3300056790 Ga0562379_1386 Ga0562379_1386_17145_18074 309
61 3300056790 Ga0562379_4608 Ga0562379_4608_2300_3229 309
62 3300056814 Ga0562378_0008 Ga0562378_0008_914732_915661 309
63 3300056814 Ga0562378_0019 Ga0562378_0019_453353_454282 309
64 3300056842 Ga0562377_0040 Ga0562377_0040_427604_428533 309
65 3300056842 Ga0562377_0237 Ga0562377_0237_114277_115206 309
66 3300056856 Ga0562375_0025 Ga0562375_0025_644643_645572 309
67 3300056856 Ga0562375_0326 Ga0562375_0326_39799_40728 309
68 3300057007 Ga0562374_0014 Ga0562374_0014_437022_437951 309
69 3300057007 Ga0562374_0022 Ga0562374_0022_65955_66884 309
70 3300057007 Ga0562374_0196 Ga0562374_0196_9424_10353 309
71 iso_pr_bacteria 2718218422 2721397132 309
72 iso_pr_bacteria 2781125629 2781264072 309
73 iso_pr_bacteria 2781125630 2781266002 309
74 iso_pr_bacteria 2820427814 2820429215 309
75 iso_pr_bacteria 2820539610 2820539620 309
76 iso_pr_bacteria 2820838073 2820838649 309
77 iso_pr_bacteria 2864985977 2864986413 309
78 iso_pr_bacteria 2940218408 2940220797 309
79 iso_pr_bacteria 2940261461 2940263844 309
80 iso_pr_bacteria 647533136 647746480 309
81 iso_pr_bacteria 8012939035 8012939906 309
82 iso_pr_bacteria 8018750880 8018752920 309
83 iso_pr_bacteria 8018754795 8018757550 309
84 iso_pr_bacteria 8077780672 8077781220 309
85 3300002932 CVPL010L_1000321 CVPL010L_10003212 310
86 3300010167 Ga0123353_10163117 Ga0123353_101631172 310
87 3300042550 Ga0466656_310114 Ga0466656_310114_93_1049 310
88 3300042592 Ga0466693_147310 Ga0466693_147310_1509_2441 310
89 3300042595 Ga0466695_107371 Ga0466695_107371_1994_2926 310
90 3300042659 Ga0466733_087809 Ga0466733_087809_1751_2683 310
91 iso_pr_bacteria 2775507261 2778149163 310
92 iso_pr_bacteria 2820501819 2820503708 310
93 iso_pr_bacteria 2820535361 2820537019 310
94 iso_pr_bacteria 2820547636 2820548365 310
95 iso_pr_bacteria 2820823448 2820823700 310
96 iso_pr_bacteria 2881375749 2881375797 310
97 3300002450 JGI24695J34938_10038923 JGI24695J34938_100389232 311
98 3300005083 Ga0068305_10287311 Ga0068305_102873114 311
99 3300026175 Ga0255572_1000024 Ga0255572_10000244 311
100 3300038395 Ga0415639_121359 Ga0415639_121359_40_999 311
101 3300042594 Ga0466694_055152 Ga0466694_055152_1365_2300 311
102 3300042616 Ga0466715_181865 Ga0466715_181865_2324_3259 311
103 iso_pr_bacteria 2547132042 2547184104 311
104 iso_pr_bacteria 2820647881 2820650434 311
105 iso_pr_bacteria 2843246524 2843248941 311
106 iso_pr_bacteria 2856882415 2856885714 311
107 iso_pr_bacteria 2856954254 2856956056 311
108 iso_pr_bacteria 2856960404 2856963699 311
109 iso_pr_bacteria 2856973192 2856975652 311
110 iso_pr_bacteria 2859970369 2859976231 311
111 iso_pr_bacteria 2873589062 2873591524 311
112 iso_pr_bacteria 2890957088 2890961727 311
113 iso_pr_bacteria 2914375287 2914376554 311
114 2225789003 2226980395 2227325102 312
115 3300002450 JGI24695J34938_10000106 JGI24695J34938_1000010649 312
116 3300002450 JGI24695J34938_10000214 JGI24695J34938_1000021440 312
117 3300009826 Ga0123355_10202518 Ga0123355_102025182 312
118 3300038395 Ga0415639_075121 Ga0415639_075121_1941_2879 312
119 3300038395 Ga0415639_093781 Ga0415639_093781_559_1497 312
120 3300042550 Ga0466656_080481 Ga0466656_080481_185_1123 312
121 3300042599 Ga0466706_208127 Ga0466706_208127_4481_5419 312
122 3300042601 Ga0466707_155385 Ga0466707_155385_3833_4771 312
123 3300042601 Ga0466707_226981 Ga0466707_226981_1911_2849 312
124 3300042603 Ga0466714_128448 Ga0466714_128448_307_1245 312
125 3300042621 Ga0466729_184814 Ga0466729_184814_4437_5375 312
126 3300056842 Ga0562377_0078 Ga0562377_0078_147280_148218 312
127 3300056857 Ga0562376_0650 Ga0562376_0650_56733_57671 312
128 iso_pr_bacteria 2758568506 2760254403 312
129 iso_pr_bacteria 2820227065 2820227936 312
130 iso_pr_bacteria 2873586004 2873588515 312
131 iso_pr_bacteria 2896402965 2896403758 312
132 iso_pr_bacteria 2916858470 2916861129 312
133 iso_pr_bacteria 2940236825 2940237803 312
134 iso_pr_bacteria 2940339133 2940340258 312
135 iso_pr_bacteria 2940341480 2940342746 312
136 iso_pr_bacteria 2940343849 2940345084 312
137 iso_pr_bacteria 646311952 646430477 312
138 iso_pr_bacteria 8007211731 8007213321 312
139 iso_pr_bacteria 8007215774 8007217505 312
140 iso_pr_bacteria 8018798118 8018801671 312
141 iso_pr_bacteria 8018802046 8018805519 312
142 iso_pr_bacteria 8064008355 8064009735 312
143 iso_pr_bacteria 8108576847 8108577442 312
144 iso_pr_bacteria 8114537524 8114537853 312
145 iso_pr_bacteria 8114544644 8114544744 312
146 iso_pr_bacteria 8114549044 8114549639 312
147 3300000062 IMNBL1DRAFT_c0000020 IMNBL1DRAFT_000002077 313
148 3300002462 JGI24702J35022_10007430 JGI24702J35022_100074303 313
149 3300009784 Ga0123357_10000327 Ga0123357_1000032716 313
150 3300009784 Ga0123357_10070001 Ga0123357_100700012 313
151 3300009784 Ga0123357_10293246 Ga0123357_102932462 313
152 3300042603 Ga0466714_064008 Ga0466714_064008_675_1616 313
153 3300042604 Ga0466717_213602 Ga0466717_213602_7341_8282 313
154 iso_pr_bacteria 2545555866 2545775788 313
155 iso_pr_bacteria 2565956565 2566195536 313
156 iso_pr_bacteria 2758568501 2760246036 313
157 iso_pr_bacteria 2758568502 2760247697 313
158 iso_pr_bacteria 2758568503 2760249359 313
159 iso_pr_bacteria 2758568504 2760251021 313
160 iso_pr_bacteria 2758568505 2760252623 313
161 iso_pr_bacteria 2758568507 2760255933 313
162 iso_pr_bacteria 2758568508 2760257633 313
163 iso_pr_bacteria 2758568509 2760259333 313
164 iso_pr_bacteria 2758568510 2760261124 313
165 iso_pr_bacteria 2785510748 2785747906 313
166 iso_pr_bacteria 2799112230 2799232240 313
167 iso_pr_bacteria 2820369699 2820369842 313
168 iso_pr_bacteria 2881902429 2881903449 313
169 iso_pr_bacteria 2958885890 2958887414 313
170 iso_pr_bacteria 2961465228 2961466836 313
171 iso_pr_bacteria 2968368220 2968368460 313
172 iso_pr_bacteria 2971062614 2971064077 313
173 iso_pr_bacteria 8004832522 8004834033 313
174 iso_pr_bacteria 8017440191 8017440668 313
175 iso_pr_bacteria 8114010755 8114011617 313
176 3300002462 JGI24702J35022_10007200 JGI24702J35022_100072006 314
177 3300005201 Ga0072941_1022085 Ga0072941_10220853 314
178 3300005201 Ga0072941_1024023 Ga0072941_10240236 314
179 3300010049 Ga0123356_10046008 Ga0123356_100460083 314
180 3300010049 Ga0123356_10423529 Ga0123356_104235291 314
181 3300042592 Ga0466693_163883 Ga0466693_163883_257_1201 314
182 3300042596 Ga0466696_419013 Ga0466696_419013_19_963 314
183 3300042612 Ga0466705_306364 Ga0466705_306364_1449_2393 314
184 iso_pr_bacteria 2820411483 2820412025 314
185 iso_pr_bacteria 2820416776 2820417298 314
186 iso_pr_bacteria 2820459456 2820459710 314
187 iso_pr_bacteria 2820724199 2820726749 314
188 iso_pr_bacteria 651324002 651579732 314
189 3300005201 Ga0072941_1000968 Ga0072941_100096825 315
190 3300010049 Ga0123356_10122173 Ga0123356_101221732 315
191 3300010167 Ga0123353_10032510 Ga0123353_100325104 315
192 3300010167 Ga0123353_10042794 Ga0123353_100427942 315
193 3300038395 Ga0415639_062336 Ga0415639_062336_555_1502 315
194 3300042601 Ga0466707_251168 Ga0466707_251168_9845_10813 315
195 3300042601 Ga0466707_277810 Ga0466707_277810_5309_6277 315
196 3300042602 Ga0466713_107250 Ga0466713_107250_34763_35710 315
197 3300042602 Ga0466713_138385 Ga0466713_138385_333902_334849 315
198 3300042652 Ga0466708_301966 Ga0466708_301966_1208_2155 315
199 3300056856 Ga0562375_0013 Ga0562375_0013_1172215_1173162 315
200 iso_pr_bacteria 2513020017 2513099568 315
201 iso_pr_bacteria 2531839602 2534154257 315
202 iso_pr_bacteria 2622736579 2623392512 315
203 iso_pr_bacteria 2836714267 2836715232 315
204 iso_pr_bacteria 2931425734 2931428680 315
205 3300010049 Ga0123356_10010367 Ga0123356_100103676 316
206 3300042596 Ga0466696_464787 Ga0466696_464787_1333_2283 316
207 3300042611 Ga0466697_142896 Ga0466697_142896_1505_2455 316
208 3300042622 Ga0466731_057572 Ga0466731_057572_709_1659 316
209 iso_pr_bacteria 2565956518 2566028113 316
210 iso_pr_bacteria 2751185832 2753510666 316
211 iso_pr_bacteria 2848878685 2848879565 316
212 iso_pr_bacteria 2852123468 2852123879 316
213 3300002462 JGI24702J35022_10003238 JGI24702J35022_100032385 317
214 3300042625 Ga0466730_088179 Ga0466730_088179_2029_2982 317
215 iso_pr_bacteria 2820866620 2820867201 317
216 3300005201 Ga0072941_1034873 Ga0072941_10348731 318
217 3300010049 Ga0123356_10072782 Ga0123356_100727824 318
218 3300010167 Ga0123353_10150988 Ga0123353_101509884 318
219 3300024493 Ga0264413_116615 Ga0264413_1166155 318
220 3300038395 Ga0415639_070025 Ga0415639_070025_8926_9882 318
221 3300042597 Ga0466699_424928 Ga0466699_424928_727_1683 318
222 3300042602 Ga0466713_037610 Ga0466713_037610_2691_3647 318
223 3300042612 Ga0466705_254122 Ga0466705_254122_842_1798 318
224 3300042615 Ga0466711_049732 Ga0466711_049732_483_1439 318
225 3300042615 Ga0466711_196720 Ga0466711_196720_1005_1961 318
226 3300042616 Ga0466715_395694 Ga0466715_395694_15886_16842 318
227 3300042617 Ga0466718_153000 Ga0466718_153000_33348_34304 318
228 3300042643 Ga0466704_213179 Ga0466704_213179_279_1235 318
229 3300042652 Ga0466708_343765 Ga0466708_343765_10529_11485 318
230 3300057007 Ga0562374_0519 Ga0562374_0519_53727_54683 318
231 iso_pr_bacteria 2781125653 2781314299 318
232 iso_pr_bacteria 2820906387 2820906634 318
233 3300005201 Ga0072941_1223254 Ga0072941_12232548 319
234 3300009784 Ga0123357_10033746 Ga0123357_100337464 319
235 3300010049 Ga0123356_10105820 Ga0123356_101058202 319
236 3300042600 Ga0466700_470039 Ga0466700_470039_5008_5967 319
237 3300042603 Ga0466714_129882 Ga0466714_129882_116_1075 319
238 3300002464 Meta3P_1000869 Meta3P_10008699 320
239 3300042603 Ga0466714_110229 Ga0466714_110229_149_1111 320
240 3300042624 Ga0466735_101764 Ga0466735_101764_2490_3452 320
241 3300042596 Ga0466696_493622 Ga0466696_493622_601_1566 321
242 3300010167 Ga0123353_10041755 Ga0123353_100417552 322
243 3300010167 Ga0123353_10222023 Ga0123353_102220232 322
244 3300042603 Ga0466714_118098 Ga0466714_118098_1146_2114 322
245 3300042652 Ga0466708_109046 Ga0466708_109046_380_1348 322
246 3300010049 Ga0123356_10168768 Ga0123356_101687683 324
247 3300056814 Ga0562378_2893 Ga0562378_2893_6017_7009 324
248 3300042605 Ga0466716_144776 Ga0466716_144776_35069_36046 325
249 3300042652 Ga0466708_456516 Ga0466708_456516_279_1280 325
250 3300042606 Ga0466719_208724 Ga0466719_208724_1302_2282 326
251 3300042625 Ga0466730_057632 Ga0466730_057632_21748_22803 326
252 3300042620 Ga0466728_076506 Ga0466728_076506_62_1045 327
253 iso_pr_bacteria 8012935351 8012935798 330
254 iso_pr_bacteria 2989309576 2989310809 339
255 3300038395 Ga0415639_000550 Ga0415639_000550_7721_8770 349
256 3300042654 Ga0466725_432863 Ga0466725_432863_6875_7969 364

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00696 AA_kinase Amino acid kinase family 62 344 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.