Protein Family IF10094

Metagenome Isolate
185 Members
54 Samples
183 Scaffolds
398.94 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_364013|Ga0466725_364013_251_1555
Length
434 aa
Sequence
MMYVDMNALKIRIEAVLPSLNEYQRRRYLSAEAKSLGRGGITLVSRVSGVSRQTLTEGVKELNNPESAIPEDGRSRKPGGGRKALWEDKPEILDILSDLLEAHTKGDPMRLLLWTNKSLRNLSAALAEKGYLANKDTVGLMLKMLGYGLQADKKTLTAKPSHPERDAQFEHINDESKKAMAEGNPVLSIDAKKKENIGNFKNNGRTYQLYKTPIEVLDHDFPIPELGKATPLGLYNIFKNKGFVNVGLSSDTAVFAVESIRKWWYAEGVVEYANAERIVLTADCGGSNGNRNRLWKFELQKLANEINKDIQVLHYPPGTSKWNKIEHRMFSFISKNWQGIPLISASVIINLIGATKTQKGLSIRCVLDESTYEKGIKVTDEEFNSINIKTCDFHGEWNYTICRNMAGFVKFINRQILKPHQARLGVEFGIRHSN

📊 Sample Types

Isolate 1.1%
Metagenome 98.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 56.6%
Kalotermitidae 26.4%
Unclassified 5.7%
Termopsidae 5.7%
Rhinotermitidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 13
Bacteria 86
Eukaryota 0
Viruses 0
Unclassified 86

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2772190990 Unclassified Bathyarchaeota Emb289P1bin127 Isolate Unclassified
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2772190991 Unclassified Bathyarchaeota Emb289P3bin109 Isolate Unclassified
38 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
47 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
48 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
50 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_158826 3300042612 Unclassified 1424
2 Ga0466705_267419 3300042612 Bacteria 60917
3 Ga0466705_270557 3300042612 Unclassified 1896
4 Ga0466733_120312 3300042659 Unclassified 1530
5 Ga0466717_075815 3300042604 Archaea 2309
6 Ga0466717_084784 3300042604 Unclassified 2333
7 Ga0466716_167891 3300042605 Bacteria 2534
8 Ga0466719_080397 3300042606 Unclassified 2216
9 Ga0466719_178188 3300042606 Unclassified 1510
10 Ga0466723_009850 3300042618 Bacteria 2485
11 Ga0466726_019453 3300042619 Bacteria 12878
12 Ga0466728_430015 3300042620 Unclassified 1625
13 Ga0466729_110189 3300042621 Bacteria 1505
14 Ga0415639_166707 3300038395 Unclassified 3177
15 Ga0466656_355725 3300042550 Unclassified 1444
16 Ga0466657_279460 3300042582 Unclassified 1456
17 Ga0466693_244660 3300042592 Bacteria 1534
18 Ga0466693_297159 3300042592 Unclassified 1545
19 Ga0466693_439121 3300042592 Unclassified 1733
20 Ga0466694_124934 3300042594 Bacteria 34227
21 Ga0466699_323450 3300042597 Bacteria 1523
22 Ga0466734_010003 3300042623 Bacteria 1565
23 Ga0466703_136254 3300042636 Bacteria 8944
24 Ga0466704_178824 3300042643 Bacteria 6496
25 Ga0466709_147240 3300042648 Bacteria 2694
26 Ga0466725_244260 3300042654 Unclassified 1505
27 Ga0466727_096180 3300042655 Bacteria 10682
28 Ga0123356_10202800 3300010049 Unclassified 2025
29 Ga0466697_123170 3300042611 Bacteria 1644
30 Ga0466705_133673 3300042612 Bacteria 6416
31 Ga0466700_151258 3300042600 Unclassified 1486
32 Ga0466714_013032 3300042603 Bacteria 2048
33 Ga0466714_066894 3300042603 Unclassified 1418
34 Ga0466717_175462 3300042604 Unclassified 1309
35 Ga0466719_309260 3300042606 Unclassified 1228
36 Ga0466721_373457 3300042608 Bacteria 1532
37 Ga0466715_219007 3300042616 Bacteria 1578
38 Ga0415639_188633 3300038395 Unclassified 1497
39 Ga0466657_022236 3300042582 Unclassified 1709
40 Ga0466694_188002 3300042594 Unclassified 5109
41 Ga0466703_224770 3300042636 Unclassified 1310
42 Ga0466703_276765 3300042636 Bacteria 3875
43 Ga0466704_261662 3300042643 Bacteria 1528
44 Ga0466704_323124 3300042643 Bacteria 40862
45 Ga0123355_10356802 3300009826 Unclassified 1930
46 Ga0123356_10001187 3300010049 Bacteria 28844
47 JGI24702J35022_10149705 3300002462 Unclassified 1309
48 Ga0466717_109639 3300042604 Unclassified 1505
49 Ga0466716_010330 3300042605 Unclassified 3840
50 Ga0466711_030308 3300042615 Bacteria 3749
51 Ga0466711_353489 3300042615 Unclassified 1635
52 Ga0466715_465959 3300042616 Bacteria 2148
53 Ga0466718_021175 3300042617 Bacteria 1749
54 Ga0466723_182952 3300042618 Unclassified 1533
55 Ga0466726_298320 3300042619 Bacteria 4377
56 Ga0466728_229752 3300042620 Bacteria 1308
57 Ga0415639_276935 3300038395 Unclassified 1379
58 Ga0466656_048509 3300042550 Unclassified 1730
59 Ga0466693_434041 3300042592 Unclassified 1552
60 Ga0466691_064198 3300042593 Bacteria 1565
61 Ga0466696_015060 3300042596 Bacteria 4159
62 Ga0466696_033446 3300042596 Bacteria 3268
63 Ga0466704_084620 3300042643 Bacteria 2522
64 Ga0466709_095416 3300042648 Unclassified 2323
65 Ga0123357_10258784 3300009784 Bacteria 1845
66 Ga0123356_10312764 3300010049 Unclassified 1681
67 Ga0123353_10511995 3300010167 Bacteria 1744
68 JGI24695J34938_10081516 3300002450 Unclassified 1336
69 Ga0466701_066984 3300042598 Bacteria 2316
70 Ga0466706_187516 3300042599 Archaea 1151
71 Ga0466700_052487 3300042600 Unclassified 1620
72 Ga0466707_144399 3300042601 Bacteria 2294
73 Ga0466707_302760 3300042601 Bacteria 1474
74 Ga0466716_275537 3300042605 Unclassified 1866
75 Ga0466721_366181 3300042608 Unclassified 1595
76 Ga0466698_433931 3300042610 Unclassified 1817
77 Ga0466710_168778 3300042613 Unclassified 1351
78 Ga0466712_293110 3300042614 Unclassified 1694
79 Ga0466715_458560 3300042616 Bacteria 2321
80 Ga0466723_046420 3300042618 Bacteria 1902
81 Ga0466728_140988 3300042620 Bacteria 1483
82 Ga0466728_413051 3300042620 Bacteria 2124
83 Ga0466656_233418 3300042550 Unclassified 1321
84 Ga0466693_056644 3300042592 Unclassified 2157
85 Ga0466691_147490 3300042593 Bacteria 2419
86 Ga0466699_380988 3300042597 Bacteria 1321
87 Ga0466708_122571 3300042652 Bacteria 12690
88 Ga0466725_364013 3300042654 Archaea 1827
89 Ga0123355_10442947 3300009826 Unclassified 1643
90 Ga0123356_10000155 3300010049 Unclassified 77400
91 Ga0123353_10339612 3300010167 Bacteria 2269
92 JGI24695J34938_10058840 3300002450 Unclassified 1646
93 Ga0466701_050519 3300042598 Bacteria 4416
94 Ga0466701_051685 3300042598 Unclassified 1639
95 Ga0466717_115896 3300042604 Unclassified 1494
96 Ga0466717_124212 3300042604 Unclassified 1459
97 Ga0466711_214605 3300042615 Bacteria 2573
98 Ga0466711_228053 3300042615 Bacteria 1595
99 Ga0466711_278187 3300042615 Bacteria 1849
100 Ga0466723_040343 3300042618 Bacteria 3072
101 Ga0466723_234322 3300042618 Unclassified 1477
102 Ga0466726_229690 3300042619 Bacteria 1588
103 Ga0415639_099584 3300038395 Unclassified 1575
104 Ga0466656_324720 3300042550 Bacteria 1296
105 Ga0466690_010097 3300042590 Unclassified 1199
106 Ga0466693_088905 3300042592 Unclassified 1770
107 Ga0466695_180071 3300042595 Unclassified 1981
108 Ga0466696_180322 3300042596 Unclassified 1352
109 Ga0466734_168442 3300042623 Bacteria 1707
110 Ga0466735_122647 3300042624 Unclassified 1654
111 Ga0466702_251850 3300042635 Unclassified 1599
112 Ga0466703_199653 3300042636 Bacteria 2530
113 Ga0466704_278157 3300042643 Bacteria 2330
114 Ga0123353_10602246 3300010167 Bacteria 1570
115 JGI24695J34938_10083741 3300002450 Unclassified 1315
116 JGI24705J35276_12173426 3300002504 Unclassified 1310
117 Ga0072940_1202970 3300005200 Archaea 2414
118 Ga0466701_070110 3300042598 Archaea 2430
119 Ga0466707_141116 3300042601 Bacteria 1798
120 Ga0466719_231700 3300042606 Bacteria 1711
121 Ga0466719_253016 3300042606 Unclassified 2280
122 Ga0466705_497547 3300042612 Unclassified 1549
123 Ga0466710_107550 3300042613 Bacteria 1751
124 Ga0466711_007210 3300042615 Bacteria 12673
125 Ga0466723_199237 3300042618 Bacteria 11376
126 Ga0415639_039710 3300038395 Unclassified 1265
127 Ga0466656_162377 3300042550 Unclassified 1322
128 Ga0466657_210860 3300042582 Unclassified 3721
129 Ga0466694_026571 3300042594 Bacteria 1500
130 Ga0466696_219250 3300042596 Bacteria 2174
131 Ga0466731_071400 3300042622 Archaea 1850
132 Ga0466703_184067 3300042636 Bacteria 4158
133 Ga0466725_016104 3300042654 Bacteria 1906
134 Ga0123353_10204857 3300010167 Unclassified 3100
135 JGI24702J35022_10145919 3300002462 Unclassified 1324
136 Ga0072940_1248346 3300005200 Archaea 1538
137 Ga0466705_021709 3300042612 Unclassified 2593
138 Ga0466705_117951 3300042612 Bacteria 4729
139 Ga0466719_161635 3300042606 Bacteria 1221
140 Ga0466698_480884 3300042610 Bacteria 1655
141 Ga0466710_180703 3300042613 Unclassified 1474
142 Ga0466710_221363 3300042613 Unclassified 1510
143 Ga0466723_056769 3300042618 Unclassified 2929
144 Ga0466656_098400 3300042550 Bacteria 5342
145 Ga0466657_095028 3300042582 Unclassified 1469
146 Ga0466690_058020 3300042590 Unclassified 2037
147 Ga0466694_335459 3300042594 Unclassified 1548
148 Ga0466696_464030 3300042596 Bacteria 3679
149 Ga0466699_268830 3300042597 Bacteria 1557
150 Ga0466703_019872 3300042636 Bacteria 2194
151 Ga0466708_008142 3300042652 Bacteria 3372
152 Ga0123353_10556832 3300010167 Unclassified 1652
153 JGI24695J34938_10080023 3300002450 Bacteria 1351
154 Ga0072941_1033516 3300005201 Unclassified 1305
155 Ga0466705_068930 3300042612 Bacteria 2002
156 Ga0466705_152957 3300042612 Bacteria 3033
157 Ga0466717_113890 3300042604 Archaea 9633
158 Ga0466716_131480 3300042605 Unclassified 1828
159 Ga0466719_222906 3300042606 Unclassified 1237
160 Ga0466719_334672 3300042606 Bacteria 3859
161 Ga0466722_026681 3300042609 Bacteria 11203
162 Ga0466698_455894 3300042610 Unclassified 1594
163 Ga0466712_162066 3300042614 Bacteria 1702
164 Ga0466711_239407 3300042615 Bacteria 1797
165 Ga0466715_032390 3300042616 Unclassified 1854
166 Ga0466718_001857 3300042617 Unclassified 1667
167 Ga0466718_065963 3300042617 Bacteria 1634
168 Ga0466718_066611 3300042617 Bacteria 2032
169 Ga0466718_167408 3300042617 Bacteria 1198
170 Ga0466723_194261 3300042618 Unclassified 1197
171 Ga0466723_238247 3300042618 Unclassified 1732
172 Ga0466728_151614 3300042620 Bacteria 1440
173 Ga0466728_443847 3300042620 Unclassified 2029
174 Ga0415639_075779 3300038395 Unclassified 1541
175 Ga0415639_128037 3300038395 Unclassified 1323
176 Ga0466693_039039 3300042592 Unclassified 1521
177 Ga0466694_146647 3300042594 Archaea 4037
178 Ga0466694_369022 3300042594 Bacteria 1600
179 Ga0466699_049687 3300042597 Archaea 1769
180 Ga0123356_10335035 3300010049 Bacteria 1631
181 Ga0123353_10707102 3300010167 Unclassified 1413
182 Ga0123353_10791564 3300010167 Archaea 1311
183 Ga0072941_1218533 3300005201 Bacteria 8632

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_222906 Ga0466719_222906_79_1089 329
2 3300042599 Ga0466706_187516 Ga0466706_187516_128_1123 331
3 3300042590 Ga0466690_010097 Ga0466690_010097_21_1031 336
4 3300042605 Ga0466716_010330 Ga0466716_010330_14_1024 336
5 3300042616 Ga0466715_032390 Ga0466715_032390_819_1829 336
6 3300042617 Ga0466718_167408 Ga0466718_167408_130_1164 344
7 3300042550 Ga0466656_162377 Ga0466656_162377_137_1183 348
8 3300042605 Ga0466716_131480 Ga0466716_131480_45_1091 348
9 3300042620 Ga0466728_443847 Ga0466728_443847_12_1058 348
10 3300042624 Ga0466735_122647 Ga0466735_122647_500_1546 348
11 3300042597 Ga0466699_380988 Ga0466699_380988_39_1106 355
12 3300042606 Ga0466719_161635 Ga0466719_161635_120_1193 357
13 3300042612 Ga0466705_267419 Ga0466705_267419_44264_45352 362
14 3300042615 Ga0466711_030308 Ga0466711_030308_917_2008 363
15 3300038395 Ga0415639_166707 Ga0415639_166707_1937_3067 376
16 3300042618 Ga0466723_194261 Ga0466723_194261_48_1178 376
17 3300038395 Ga0415639_075779 Ga0415639_075779_373_1509 378
18 3300042620 Ga0466728_229752 Ga0466728_229752_58_1197 379
19 3300042596 Ga0466696_033446 Ga0466696_033446_2103_3245 380
20 3300010167 Ga0123353_10556832 Ga0123353_105568322 381
21 3300042615 Ga0466711_353489 Ga0466711_353489_10_1158 382
22 3300042594 Ga0466694_335459 Ga0466694_335459_175_1392 386
23 3300042615 Ga0466711_007210 Ga0466711_007210_11394_12614 386
24 3300010049 Ga0123356_10001187 Ga0123356_100011873 388
25 3300042618 Ga0466723_234322 Ga0466723_234322_50_1216 388
26 3300042635 Ga0466702_251850 Ga0466702_251850_225_1394 389
27 3300042652 Ga0466708_008142 Ga0466708_008142_32_1249 389
28 3300042594 Ga0466694_026571 Ga0466694_026571_286_1458 390
29 3300042606 Ga0466719_309260 Ga0466719_309260_33_1205 390
30 3300042609 Ga0466722_026681 Ga0466722_026681_9930_11135 390
31 3300010167 Ga0123353_10791564 Ga0123353_107915641 391
32 3300042613 Ga0466710_180703 Ga0466710_180703_114_1325 391
33 3300010167 Ga0123353_10602246 Ga0123353_106022462 392
34 3300042601 Ga0466707_141116 Ga0466707_141116_426_1637 392
35 3300042613 Ga0466710_168778 Ga0466710_168778_158_1339 393
36 3300042616 Ga0466715_219007 Ga0466715_219007_152_1375 393
37 3300042623 Ga0466734_010003 Ga0466734_010003_115_1296 393
38 3300042601 Ga0466707_302760 Ga0466707_302760_119_1303 394
39 3300005200 Ga0072940_1248346 Ga0072940_12483462 395
40 3300042593 Ga0466691_147490 Ga0466691_147490_81_1268 395
41 3300042615 Ga0466711_239407 Ga0466711_239407_154_1341 395
42 3300042619 Ga0466726_298320 Ga0466726_298320_3090_4319 395
43 3300042592 Ga0466693_088905 Ga0466693_088905_88_1278 396
44 3300042659 Ga0466733_120312 Ga0466733_120312_158_1348 396
45 3300042596 Ga0466696_180322 Ga0466696_180322_35_1228 397
46 3300042604 Ga0466717_109639 Ga0466717_109639_172_1389 397
47 3300042582 Ga0466657_022236 Ga0466657_022236_245_1441 398
48 3300042595 Ga0466695_180071 Ga0466695_180071_38_1258 398
49 3300042617 Ga0466718_021175 Ga0466718_021175_294_1514 398
50 3300042617 Ga0466718_001857 Ga0466718_001857_95_1321 399
51 3300042594 Ga0466694_146647 Ga0466694_146647_1647_2867 400
52 3300042615 Ga0466711_214605 Ga0466711_214605_309_1529 401
53 3300042615 Ga0466711_228053 Ga0466711_228053_244_1449 401
54 3300042643 Ga0466704_178824 Ga0466704_178824_5010_6218 402
55 3300042654 Ga0466725_016104 Ga0466725_016104_509_1717 402
56 3300042582 Ga0466657_095028 Ga0466657_095028_112_1323 403
57 3300042596 Ga0466696_464030 Ga0466696_464030_890_2101 403
58 3300042597 Ga0466699_268830 Ga0466699_268830_100_1311 403
59 3300002450 JGI24695J34938_10083741 JGI24695J34938_100837411 404
60 3300042590 Ga0466690_058020 Ga0466690_058020_709_1923 404
61 3300042596 Ga0466696_015060 Ga0466696_015060_1237_2451 404
62 3300042597 Ga0466699_049687 Ga0466699_049687_532_1746 404
63 3300042597 Ga0466699_323450 Ga0466699_323450_138_1352 404
64 3300042603 Ga0466714_013032 Ga0466714_013032_169_1383 404
65 3300042604 Ga0466717_124212 Ga0466717_124212_125_1339 404
66 3300042605 Ga0466716_275537 Ga0466716_275537_414_1628 404
67 3300042606 Ga0466719_080397 Ga0466719_080397_598_1812 404
68 3300042606 Ga0466719_253016 Ga0466719_253016_708_1922 404
69 3300042606 Ga0466719_334672 Ga0466719_334672_1015_2256 404
70 3300042612 Ga0466705_021709 Ga0466705_021709_708_1922 404
71 3300042613 Ga0466710_107550 Ga0466710_107550_202_1416 404
72 3300042613 Ga0466710_221363 Ga0466710_221363_132_1346 404
73 3300042616 Ga0466715_458560 Ga0466715_458560_960_2174 404
74 3300042618 Ga0466723_056769 Ga0466723_056769_1539_2753 404
75 3300042618 Ga0466723_199237 Ga0466723_199237_7432_8646 404
76 3300042619 Ga0466726_229690 Ga0466726_229690_197_1411 404
77 3300042620 Ga0466728_430015 Ga0466728_430015_279_1493 404
78 3300042622 Ga0466731_071400 Ga0466731_071400_442_1656 404
79 3300042636 Ga0466703_136254 Ga0466703_136254_234_1448 404
80 3300042636 Ga0466703_224770 Ga0466703_224770_58_1272 404
81 3300042643 Ga0466704_261662 Ga0466704_261662_205_1419 404
82 3300042648 Ga0466709_095416 Ga0466709_095416_60_1274 404
83 3300042648 Ga0466709_147240 Ga0466709_147240_76_1290 404
84 iso_pu_archaea 2772190990 2773779140 404
85 iso_pu_archaea 2772190991 2773781505 404
86 3300002504 JGI24705J35276_12173426 JGI24705J35276_121734261 405
87 3300010167 Ga0123353_10204857 Ga0123353_102048572 405
88 3300038395 Ga0415639_099584 Ga0415639_099584_233_1450 405
89 3300038395 Ga0415639_128037 Ga0415639_128037_60_1277 405
90 3300042550 Ga0466656_233418 Ga0466656_233418_78_1295 405
91 3300042592 Ga0466693_297159 Ga0466693_297159_195_1412 405
92 3300042594 Ga0466694_188002 Ga0466694_188002_3331_4566 405
93 3300042600 Ga0466700_151258 Ga0466700_151258_177_1394 405
94 3300042601 Ga0466707_144399 Ga0466707_144399_60_1277 405
95 3300042604 Ga0466717_115896 Ga0466717_115896_167_1384 405
96 3300042636 Ga0466703_199653 Ga0466703_199653_60_1277 405
97 3300042654 Ga0466725_244260 Ga0466725_244260_160_1377 405
98 3300002450 JGI24695J34938_10081516 JGI24695J34938_100815161 406
99 3300009784 Ga0123357_10258784 Ga0123357_102587842 406
100 3300010049 Ga0123356_10202800 Ga0123356_102028002 406
101 3300038395 Ga0415639_039710 Ga0415639_039710_12_1232 406
102 3300038395 Ga0415639_276935 Ga0415639_276935_115_1335 406
103 3300042550 Ga0466656_098400 Ga0466656_098400_4008_5228 406
104 3300042550 Ga0466656_355725 Ga0466656_355725_75_1295 406
105 3300042582 Ga0466657_279460 Ga0466657_279460_110_1330 406
106 3300042592 Ga0466693_039039 Ga0466693_039039_240_1460 406
107 3300042592 Ga0466693_056644 Ga0466693_056644_700_1920 406
108 3300042592 Ga0466693_244660 Ga0466693_244660_175_1395 406
109 3300042592 Ga0466693_439121 Ga0466693_439121_395_1615 406
110 3300042593 Ga0466691_064198 Ga0466691_064198_167_1387 406
111 3300042598 Ga0466701_050519 Ga0466701_050519_125_1345 406
112 3300042598 Ga0466701_051685 Ga0466701_051685_83_1303 406
113 3300042600 Ga0466700_052487 Ga0466700_052487_161_1381 406
114 3300042603 Ga0466714_066894 Ga0466714_066894_129_1349 406
115 3300042604 Ga0466717_084784 Ga0466717_084784_139_1359 406
116 3300042604 Ga0466717_175462 Ga0466717_175462_21_1241 406
117 3300042605 Ga0466716_167891 Ga0466716_167891_573_1793 406
118 3300042606 Ga0466719_178188 Ga0466719_178188_58_1278 406
119 3300042606 Ga0466719_231700 Ga0466719_231700_352_1572 406
120 3300042608 Ga0466721_366181 Ga0466721_366181_179_1399 406
121 3300042610 Ga0466698_455894 Ga0466698_455894_102_1322 406
122 3300042610 Ga0466698_480884 Ga0466698_480884_268_1488 406
123 3300042611 Ga0466697_123170 Ga0466697_123170_152_1372 406
124 3300042612 Ga0466705_117951 Ga0466705_117951_59_1279 406
125 3300042612 Ga0466705_133673 Ga0466705_133673_295_1515 406
126 3300042612 Ga0466705_152957 Ga0466705_152957_1591_2811 406
127 3300042612 Ga0466705_158826 Ga0466705_158826_83_1303 406
128 3300042612 Ga0466705_270557 Ga0466705_270557_33_1253 406
129 3300042612 Ga0466705_497547 Ga0466705_497547_292_1512 406
130 3300042614 Ga0466712_162066 Ga0466712_162066_316_1536 406
131 3300042614 Ga0466712_293110 Ga0466712_293110_136_1356 406
132 3300042617 Ga0466718_065963 Ga0466718_065963_232_1452 406
133 3300042617 Ga0466718_066611 Ga0466718_066611_106_1326 406
134 3300042618 Ga0466723_040343 Ga0466723_040343_1823_3043 406
135 3300042618 Ga0466723_238247 Ga0466723_238247_336_1556 406
136 3300042619 Ga0466726_019453 Ga0466726_019453_3042_4262 406
137 3300042620 Ga0466728_140988 Ga0466728_140988_146_1366 406
138 3300042621 Ga0466729_110189 Ga0466729_110189_122_1342 406
139 3300042623 Ga0466734_168442 Ga0466734_168442_106_1326 406
140 3300042636 Ga0466703_019872 Ga0466703_019872_945_2165 406
141 3300042636 Ga0466703_276765 Ga0466703_276765_1870_3090 406
142 3300042643 Ga0466704_084620 Ga0466704_084620_653_1873 406
143 3300042643 Ga0466704_278157 Ga0466704_278157_1094_2314 406
144 3300042643 Ga0466704_323124 Ga0466704_323124_10_1230 406
145 3300042655 Ga0466727_096180 Ga0466727_096180_22_1242 406
146 3300002450 JGI24695J34938_10058840 JGI24695J34938_100588402 407
147 3300002450 JGI24695J34938_10080023 JGI24695J34938_100800231 407
148 3300005201 Ga0072941_1033516 Ga0072941_10335161 407
149 3300009826 Ga0123355_10356802 Ga0123355_103568022 407
150 3300010049 Ga0123356_10312764 Ga0123356_103127641 407
151 3300010049 Ga0123356_10335035 Ga0123356_103350352 407
152 3300010167 Ga0123353_10339612 Ga0123353_103396122 407
153 3300010167 Ga0123353_10511995 Ga0123353_105119951 407
154 3300042596 Ga0466696_219250 Ga0466696_219250_300_1523 407
155 3300042604 Ga0466717_113890 Ga0466717_113890_775_1998 407
156 3300042616 Ga0466715_465959 Ga0466715_465959_129_1352 407
157 3300042618 Ga0466723_009850 Ga0466723_009850_224_1447 407
158 3300042618 Ga0466723_046420 Ga0466723_046420_630_1853 407
159 3300042618 Ga0466723_182952 Ga0466723_182952_148_1371 407
160 3300042598 Ga0466701_070110 Ga0466701_070110_792_2018 408
161 3300042612 Ga0466705_068930 Ga0466705_068930_59_1285 408
162 3300042652 Ga0466708_122571 Ga0466708_122571_10849_12075 408
163 3300042550 Ga0466656_048509 Ga0466656_048509_403_1632 409
164 3300042550 Ga0466656_324720 Ga0466656_324720_45_1274 409
165 3300042594 Ga0466694_124934 Ga0466694_124934_10425_11654 409
166 3300005201 Ga0072941_1218533 Ga0072941_12185337 410
167 3300010049 Ga0123356_10000155 Ga0123356_1000015545 410
168 3300010167 Ga0123353_10707102 Ga0123353_107071021 410
169 3300038395 Ga0415639_188633 Ga0415639_188633_61_1293 410
170 3300042598 Ga0466701_066984 Ga0466701_066984_920_2152 410
171 3300042608 Ga0466721_373457 Ga0466721_373457_171_1427 410
172 3300042615 Ga0466711_278187 Ga0466711_278187_93_1325 410
173 3300002462 JGI24702J35022_10149705 JGI24702J35022_101497051 411
174 3300042620 Ga0466728_413051 Ga0466728_413051_781_2016 411
175 3300042592 Ga0466693_434041 Ga0466693_434041_175_1413 412
176 3300042604 Ga0466717_075815 Ga0466717_075815_126_1364 412
177 3300042610 Ga0466698_433931 Ga0466698_433931_376_1614 412
178 3300042620 Ga0466728_151614 Ga0466728_151614_104_1342 412
179 3300002462 JGI24702J35022_10145919 JGI24702J35022_101459191 415
180 3300005200 Ga0072940_1202970 Ga0072940_12029701 415
181 3300009826 Ga0123355_10442947 Ga0123355_104429472 415
182 3300042582 Ga0466657_210860 Ga0466657_210860_141_1394 417
183 3300042594 Ga0466694_369022 Ga0466694_369022_57_1331 424
184 3300042654 Ga0466725_364013 Ga0466725_364013_251_1555 434
185 3300042636 Ga0466703_184067 Ga0466703_184067_2297_3610 437

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07592 DDE_Tnp_ISAZ013 Rhodopirellula transposase DDE domain 96 402 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.68 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.